BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780378|ref|YP_003064791.1| flagellar basal body rod
protein FlgG [Candidatus Liberibacter asiaticus str. psy62]
         (262 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|289523332|ref|ZP_06440186.1| flagellar basal-body rod protein FlgG [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503024|gb|EFD24188.1| flagellar basal-body rod protein FlgG [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 262

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 166/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A    A GM AQQ+NL++I+NN+AN+NTTGYK+ RAEF D +YQ  +  G+P +    
Sbjct: 2   IRALWSGATGMIAQQSNLDVISNNLANVNTTGYKKIRAEFEDLIYQIGREPGAPVEPDSM 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G G ++     + + G +  T N  D+A+ G G+FQV  PD T+ YTR G+
Sbjct: 62  --IPTGVQVGLGTRLIGTSRIMSPGNLQVTDNPFDIAIEGDGFFQVTLPDGTMAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           +++D  GQ+VT++G  L P I IPE+T EI VS +G++ A    + +   +GQ+ +A F+
Sbjct: 120 WHVDGDGQIVTSNGYLLEPQIAIPEDTVEITVSPTGEVYARQAGDVEPDEIGQIELARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GLR +G NL   T  SG PI+  P + GF  ++QG LE SNV  V+E+  MI +QRA
Sbjct: 180 NPQGLRAMGKNLFLETPASGFPILGQPGEEGFGTLRQGALEMSNVQVVEEMVSMIVSQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ ADE+  +   +R
Sbjct: 240 YEANSKTIQTADELLQIANNLR 261


>gi|225850285|ref|YP_002730519.1| flagellar basal-body rod protein FlgG [Persephonella marina EX-H1]
 gi|225645911|gb|ACO04097.1| flagellar basal-body rod protein FlgG [Persephonella marina EX-H1]
          Length = 266

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 112/266 (42%), Positives = 166/266 (62%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL++I+NNIAN+NT G+KR+RA F D +YQ  K  G    S+++
Sbjct: 2   IRALWTSASGMGAQQTNLDVISNNIANVNTVGFKRSRANFEDLIYQDIKDPGV--MSSNE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG GV++S V  ++TQG ++ T   LD+A+ G G+F++E P     YTRAG+
Sbjct: 60  TRVPSGIQIGLGVKLSDVSKIFTQGSLIKTDKPLDIAIQGDGFFKIELPGGGEAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV----SRSGQILAVTGKNSDFQPVGQLLI 176
           F ID++G +VT +G  L P I I      + +    +    ++   G     + +  + +
Sbjct: 120 FQIDNEGYIVTPNGYRLSPNIQISAPETLVSISISPNGKVYVVRNEGGQQTTEELTDIKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             FIN AGL+ IG+NL   T  SG+PI  +P+  GF  + QG+LEASNV+ V+E+  +I 
Sbjct: 180 YKFINPAGLKAIGENLFKYTEASGEPIEGDPNTDGFGKLAQGFLEASNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE+NSK I  ADEM   +  ++
Sbjct: 240 AQRAYEINSKGIITADEMLRTVGTLK 265


>gi|319790434|ref|YP_004152067.1| flagellar basal-body rod protein FlgG [Thermovibrio ammonificans
           HB-1]
 gi|317114936|gb|ADU97426.1| flagellar basal-body rod protein FlgG [Thermovibrio ammonificans
           HB-1]
          Length = 266

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 113/266 (42%), Positives = 167/266 (62%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL++I+NNIAN+NT G+KR+RA F D +YQ  +  G    S+++
Sbjct: 2   LRALWTSASGMEAQQTNLDVISNNIANVNTVGFKRSRANFEDLMYQDIRDPGV--MSSEE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG GV++S V  ++TQG ++ T   LD+A+ G G+F++E P     YTRAG 
Sbjct: 60  NRVPTGIQIGLGVKLSDVSKIFTQGSLIKTDKPLDVAIQGPGFFKIELPGGGEAYTRAGD 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV----SRSGQILAVTGKNSDFQPVGQLLI 176
           F +D++G +VT +G  L P I I      + +    +    ++  TG     +  G + +
Sbjct: 120 FQLDNEGYIVTPEGYRLSPNIQISAPETVVNISISPNGKVYVVRNTGGQQVTEEAGTIKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             FIN AGL+ IG NL  +T  SG+PI  +P+  GF  + QG+LEASNV+ V+E+  +I 
Sbjct: 180 YRFINPAGLKAIGGNLFVQTEASGEPIEGDPNTDGFGKLTQGFLEASNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE+NSK I AADEM   +  ++
Sbjct: 240 AQRAYEINSKGIIAADEMLRTVASLK 265


>gi|254780378|ref|YP_003064791.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040055|gb|ACT56851.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 262

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 262/262 (100%), Positives = 262/262 (100%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK
Sbjct: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS
Sbjct: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI
Sbjct: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA
Sbjct: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVIEAADEMSSLITKMR
Sbjct: 241 YEMNSKVIEAADEMSSLITKMR 262


>gi|325295399|ref|YP_004281913.1| flagellar basal-body rod protein FlgG [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065847|gb|ADY73854.1| flagellar basal-body rod protein FlgG [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 266

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 110/266 (41%), Positives = 168/266 (63%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A GM AQQTNL++I++NIAN+NT G+K++RA F D +YQ  +  G    S+++
Sbjct: 2   LRALWTSATGMEAQQTNLDVISHNIANVNTVGFKKSRANFEDLIYQDIRDPGV--MSSEE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG GV++S V  ++TQG ++ T   LDLA+ G G+F++E P     YTRAG+
Sbjct: 60  NRVPSGIQIGLGVKVSDVSKIFTQGSLMKTDKPLDLAIQGAGFFKIELPGGGEAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV----SRSGQILAVTGKNSDFQPVGQLLI 176
           F ++ +G +VT +G  L P I I      + +    +    ++  TG     + VG + +
Sbjct: 120 FQLNEEGYIVTPEGYKLSPNIQISSPETVVNISISPNGKVYVVRNTGGVQTTEEVGTIKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             FIN AGL+ +G NLL +T  SG+P+  +P+  GF  + QG+LEASNV+ V+E+  +I 
Sbjct: 180 YRFINPAGLKALGGNLLVKTDASGEPVEGDPNTDGFGKLAQGFLEASNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE+NSK I  ADEM  ++  ++
Sbjct: 240 AQRAYEVNSKGITTADEMLRVVGTLK 265


>gi|121534936|ref|ZP_01666755.1| flagellar basal-body rod protein FlgG [Thermosinus carboxydivorans
           Nor1]
 gi|121306535|gb|EAX47458.1| flagellar basal-body rod protein FlgG [Thermosinus carboxydivorans
           Nor1]
          Length = 262

 Score =  252 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 117/262 (44%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A +GM AQQ N+++I+NN+AN+NTTG+K++R +F D +YQ  + AG  + +   
Sbjct: 2   MRALWTAGSGMVAQQANVDVISNNLANVNTTGFKKSRTDFQDLMYQTIRQAG--AATGAD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI IG GV+  + + +YTQG    TGN LDLA+ G G+FQ+  PD T+ YTR G+
Sbjct: 60  TQLPTGIQIGHGVRQVATQKIYTQGNFQQTGNPLDLAIEGDGFFQITLPDGTLAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D++G++VT++G  L P I+IPE   E+ +S  G++ A     +D Q +GQ+ I  FI
Sbjct: 120 FKKDAQGRIVTSEGYPLEPQIIIPENATELLISADGRVTAKIPGQTDPQDLGQIQIVRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL +IG NLL  T+ SG P++ NP   G   + Q YLE SNV  V+E+  MI AQRA
Sbjct: 180 NPAGLDSIGRNLLKETAASGAPVVLNPGTDGAGTLVQQYLEMSNVQVVEEMVNMIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+K I  AD+M   +  ++
Sbjct: 240 YEINAKAITTADDMLGQVANLK 261


>gi|289548898|ref|YP_003473886.1| flagellar basal-body rod protein FlgG [Thermocrinis albus DSM
           14484]
 gi|289182515|gb|ADC89759.1| flagellar basal-body rod protein FlgG [Thermocrinis albus DSM
           14484]
          Length = 262

 Score =  252 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 113/261 (43%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A   +A+GMSAQQTNL++I++N+AN+NT G+K+ R  F D LYQ  +  G+P+    +A
Sbjct: 3   RALWTSASGMSAQQTNLDVISHNMANVNTVGFKKMRPTFQDLLYQTVRDPGAPTSPTTRA 62

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P G  IG GV IS    ++TQG +  TGN LDLA+ G G+F+V  PD T+ YTR G F
Sbjct: 63  --PSGFQIGLGVYISDTYGIFTQGNLFQTGNQLDLAIQGDGFFKVVLPDGTIAYTRNGQF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +D+ G++V  DG  L P I +P +   + +   G +  +    +  + +G++ +A F+N
Sbjct: 121 RLDADGRIVNPDGYPLDPEITVPADAISVSIGPDGTVSVLRQGATTVEEIGRIELAKFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGLR IG+NL  +T  SG+PI+ NP + G   + QGYLE+SNV+ V+E+  +I AQRA+
Sbjct: 181 PAGLRRIGNNLFIQTDASGEPIVDNPGNQGLGTLLQGYLESSNVNIVEEMVNLIIAQRAF 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E NSK I AAD+M   +  +R
Sbjct: 241 EFNSKGIMAADDMLGQVANLR 261


>gi|15606190|ref|NP_213567.1| flagellar hook basal-body protein FlgG [Aquifex aeolicus VF5]
 gi|2983377|gb|AAC06963.1| flagellar hook basal-body protein FlgG [Aquifex aeolicus VF5]
          Length = 262

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 114/261 (43%), Positives = 172/261 (65%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A   +A+GM+AQQTNL++I++N+AN+NT GYK+ RA F D LYQ  +  G+P+    ++
Sbjct: 3   RALWTSASGMTAQQTNLDVISHNMANVNTVGYKKMRATFQDLLYQTVEEPGAPTSPTTRS 62

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P G  IG G  +S    ++TQG +  T N LD+A+ G G+F++  PD T+ YTR G F
Sbjct: 63  --PSGFQIGLGTYVSDTYGIFTQGNLTKTDNQLDIAIQGDGFFKIVLPDGTIAYTRNGQF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +DS+G++V +DG  L P I IP +   + ++  G +  +    ++ + VG++ +A F+N
Sbjct: 121 RLDSEGRIVNSDGYPLDPEITIPADAISVSIAADGTVSVLRQGATEVEEVGRIELAKFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGLR IG+NL  +T+ SG+PII NP + G   + QGYLE+SNV+ V+E+  +I AQRAY
Sbjct: 181 PAGLRRIGNNLYIQTTASGEPIIDNPGNQGLGTLLQGYLESSNVNIVEEMVNLIIAQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E N+K I+AADEM S    +R
Sbjct: 241 EFNTKGIQAADEMLSQAANLR 261


>gi|306846278|ref|ZP_07478839.1| flagellar basal-body rod protein FlgG [Brucella sp. BO1]
 gi|306273273|gb|EFM55142.1| flagellar basal-body rod protein FlgG [Brucella sp. BO1]
          Length = 262

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 148/263 (56%), Positives = 195/263 (74%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTG+KRARAEF D LYQ+E+ AG P+Q A++
Sbjct: 1   MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLLYQSERTAGVPNQ-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  +G GVQ ++VRN++ QG    TGN  D+AL GRGWFQ+++P    +YTRAG+
Sbjct: 60  AIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGWFQIQSPTGETLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DGN + P I IP +  E+ ++ +GQ+ A      +   +GQL +ANF 
Sbjct: 120 FNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAKLQDQINQVDLGQLTLANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG P++  P D G+  +KQGYLEASNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLEPLGGNLYRETEASGSPLVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AADEM++ ++  +R
Sbjct: 240 YEMNSKVIQAADEMAATVSKNLR 262


>gi|17989431|ref|NP_542064.1| flagellar basal body rod protein FlgG [Brucella melitensis bv. 1
           str. 16M]
 gi|23499916|ref|NP_699356.1| flagellar basal body rod protein FlgG [Brucella suis 1330]
 gi|62317103|ref|YP_222956.1| flagellar basal body rod protein FlgG [Brucella abortus bv. 1 str.
           9-941]
 gi|83269095|ref|YP_418386.1| flagellar basal body rod protein FlgG [Brucella melitensis biovar
           Abortus 2308]
 gi|148557926|ref|YP_001257213.1| flagellar basal body rod protein FlgG [Brucella ovis ATCC 25840]
 gi|161620236|ref|YP_001594122.1| flagellar basal body rod protein FlgG [Brucella canis ATCC 23365]
 gi|163844346|ref|YP_001622001.1| flagellar basal body rod protein FlgG [Brucella suis ATCC 23445]
 gi|189022368|ref|YP_001932109.1| flagellar basal body rod protein FlgG [Brucella abortus S19]
 gi|225628625|ref|ZP_03786659.1| flagellar basal-body rod protein FlgG [Brucella ceti str. Cudo]
 gi|237816665|ref|ZP_04595657.1| flagellar basal-body rod protein FlgG [Brucella abortus str. 2308
           A]
 gi|254691412|ref|ZP_05154666.1| flagellar basal body rod protein FlgG [Brucella abortus bv. 6 str.
           870]
 gi|254695290|ref|ZP_05157118.1| flagellar basal body rod protein FlgG [Brucella abortus bv. 3 str.
           Tulya]
 gi|254702576|ref|ZP_05164404.1| flagellar basal body rod protein FlgG [Brucella suis bv. 3 str.
           686]
 gi|254706292|ref|ZP_05168120.1| flagellar basal body rod protein FlgG [Brucella pinnipedialis
           M163/99/10]
 gi|254711414|ref|ZP_05173225.1| flagellar basal body rod protein FlgG [Brucella pinnipedialis
           B2/94]
 gi|254720610|ref|ZP_05182421.1| flagellar basal body rod protein FlgG [Brucella sp. 83/13]
 gi|254731833|ref|ZP_05190411.1| flagellar basal body rod protein FlgG [Brucella abortus bv. 4 str.
           292]
 gi|256029956|ref|ZP_05443570.1| flagellar basal body rod protein FlgG [Brucella pinnipedialis
           M292/94/1]
 gi|256043073|ref|ZP_05446017.1| flagellar basal body rod protein FlgG [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256059608|ref|ZP_05449806.1| flagellar basal body rod protein FlgG [Brucella neotomae 5K33]
 gi|256111943|ref|ZP_05452894.1| flagellar basal body rod protein FlgG [Brucella melitensis bv. 3
           str. Ether]
 gi|256158118|ref|ZP_05456036.1| flagellar basal body rod protein FlgG [Brucella ceti M490/95/1]
 gi|256252928|ref|ZP_05458464.1| flagellar basal body rod protein FlgG [Brucella ceti B1/94]
 gi|256256598|ref|ZP_05462134.1| flagellar basal body rod protein FlgG [Brucella abortus bv. 9 str.
           C68]
 gi|260544341|ref|ZP_05820162.1| flagellar basal body rod protein [Brucella abortus NCTC 8038]
 gi|260564303|ref|ZP_05834788.1| flagellar basal body rod protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260568516|ref|ZP_05838985.1| flagellar basal body rod protein [Brucella suis bv. 4 str. 40]
 gi|260757026|ref|ZP_05869374.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 6 str.
           870]
 gi|260759602|ref|ZP_05871950.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 4 str.
           292]
 gi|260882836|ref|ZP_05894450.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 9 str.
           C68]
 gi|261215659|ref|ZP_05929940.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 3 str.
           Tulya]
 gi|261220019|ref|ZP_05934300.1| flagellar basal-body rod protein FlgG [Brucella ceti B1/94]
 gi|261313736|ref|ZP_05952933.1| flagellar basal-body rod protein FlgG [Brucella pinnipedialis
           M163/99/10]
 gi|261319022|ref|ZP_05958219.1| flagellar basal-body rod protein FlgG [Brucella pinnipedialis
           B2/94]
 gi|261323577|ref|ZP_05962774.1| flagellar basal-body rod protein FlgG [Brucella neotomae 5K33]
 gi|261753156|ref|ZP_05996865.1| flagellar basal-body rod protein FlgG [Brucella suis bv. 3 str.
           686]
 gi|265985650|ref|ZP_06098385.1| flagellar basal-body rod protein FlgG [Brucella sp. 83/13]
 gi|265986975|ref|ZP_06099532.1| flagellar basal-body rod protein FlgG [Brucella pinnipedialis
           M292/94/1]
 gi|265989511|ref|ZP_06102068.1| flagellar basal-body rod protein FlgG [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265993390|ref|ZP_06105947.1| flagellar basal-body rod protein FlgG [Brucella melitensis bv. 3
           str. Ether]
 gi|265996635|ref|ZP_06109192.1| flagellar basal-body rod protein FlgG [Brucella ceti M490/95/1]
 gi|297249954|ref|ZP_06933655.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 5 str.
           B3196]
 gi|306838572|ref|ZP_07471409.1| flagellar basal-body rod protein FlgG [Brucella sp. NF 2653]
 gi|306841049|ref|ZP_07473773.1| flagellar basal-body rod protein FlgG [Brucella sp. BO2]
 gi|17985308|gb|AAL54328.1| flagellar basal-body rod protein flgg [Brucella melitensis bv. 1
           str. 16M]
 gi|23463493|gb|AAN33361.1| flagellar basal-body rod protein FlgG [Brucella suis 1330]
 gi|62197296|gb|AAX75595.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 1 str.
           9-941]
 gi|82939369|emb|CAJ12317.1| Flagellar basal body rod protein [Brucella melitensis biovar
           Abortus 2308]
 gi|148369211|gb|ABQ62083.1| flagellar basal-body rod protein FlgG [Brucella ovis ATCC 25840]
 gi|161337047|gb|ABX63351.1| flagellar basal-body rod protein FlgG [Brucella canis ATCC 23365]
 gi|163675069|gb|ABY39179.1| flagellar basal-body rod protein FlgG [Brucella suis ATCC 23445]
 gi|189020942|gb|ACD73663.1| Flagellar basal body rod protein [Brucella abortus S19]
 gi|225616471|gb|EEH13519.1| flagellar basal-body rod protein FlgG [Brucella ceti str. Cudo]
 gi|237787478|gb|EEP61694.1| flagellar basal-body rod protein FlgG [Brucella abortus str. 2308
           A]
 gi|260097612|gb|EEW81486.1| flagellar basal body rod protein [Brucella abortus NCTC 8038]
 gi|260151946|gb|EEW87039.1| flagellar basal body rod protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260155181|gb|EEW90262.1| flagellar basal body rod protein [Brucella suis bv. 4 str. 40]
 gi|260669920|gb|EEX56860.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 4 str.
           292]
 gi|260677134|gb|EEX63955.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 6 str.
           870]
 gi|260872364|gb|EEX79433.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 9 str.
           C68]
 gi|260917266|gb|EEX84127.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 3 str.
           Tulya]
 gi|260918603|gb|EEX85256.1| flagellar basal-body rod protein FlgG [Brucella ceti B1/94]
 gi|261298245|gb|EEY01742.1| flagellar basal-body rod protein FlgG [Brucella pinnipedialis
           B2/94]
 gi|261299557|gb|EEY03054.1| flagellar basal-body rod protein FlgG [Brucella neotomae 5K33]
 gi|261302762|gb|EEY06259.1| flagellar basal-body rod protein FlgG [Brucella pinnipedialis
           M163/99/10]
 gi|261742909|gb|EEY30835.1| flagellar basal-body rod protein FlgG [Brucella suis bv. 3 str.
           686]
 gi|262550932|gb|EEZ07093.1| flagellar basal-body rod protein FlgG [Brucella ceti M490/95/1]
 gi|262764260|gb|EEZ10292.1| flagellar basal-body rod protein FlgG [Brucella melitensis bv. 3
           str. Ether]
 gi|263000180|gb|EEZ12870.1| flagellar basal-body rod protein FlgG [Brucella melitensis bv. 1
           str. Rev.1]
 gi|264659172|gb|EEZ29433.1| flagellar basal-body rod protein FlgG [Brucella pinnipedialis
           M292/94/1]
 gi|264664242|gb|EEZ34503.1| flagellar basal-body rod protein FlgG [Brucella sp. 83/13]
 gi|297173823|gb|EFH33187.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 5 str.
           B3196]
 gi|306288938|gb|EFM60238.1| flagellar basal-body rod protein FlgG [Brucella sp. BO2]
 gi|306406358|gb|EFM62600.1| flagellar basal-body rod protein FlgG [Brucella sp. NF 2653]
          Length = 262

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 148/263 (56%), Positives = 195/263 (74%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTG+KRARAEF D LYQ+E+ AG P+Q A++
Sbjct: 1   MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLLYQSERTAGVPNQ-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  +G GVQ ++VRN++ QG    TGN  D+AL GRGWFQ+++P    +YTRAG+
Sbjct: 60  AIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGWFQIQSPTGETLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DGN + P I IP +  E+ ++ +GQ+ A      +   +GQL +ANF 
Sbjct: 120 FNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAKLQDQINQVDLGQLTLANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG P++  P D G+  +KQGYLEASNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AADEM++ ++  +R
Sbjct: 240 YEMNSKVIQAADEMAATVSKNLR 262


>gi|256014942|ref|YP_003104951.1| flagellar basal-body rod protein FlgG [Brucella microti CCM 4915]
 gi|255997602|gb|ACU49289.1| flagellar basal-body rod protein FlgG [Brucella microti CCM 4915]
          Length = 262

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 149/263 (56%), Positives = 196/263 (74%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA MIAA GM+AQQ NLE+IANNIANINTTG+KRARAEF D LYQ+E+ AG P+Q A++
Sbjct: 1   MKALMIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLLYQSERTAGVPNQ-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  +G GVQ ++VRN++ QG    TGN  D+AL GRGWFQ+++P    +YTRAG+
Sbjct: 60  AIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGWFQIQSPTGETLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DGN + P I IP +  E+ ++ +GQ+ A      +   +GQL +ANF 
Sbjct: 120 FNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAKLQDQINQVDLGQLTLANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG P++  P D G+  +KQGYLEASNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AADEM++ ++  +R
Sbjct: 240 YEMNSKVIQAADEMAATVSKNLR 262


>gi|222100099|ref|YP_002534667.1| Flagellar basal-body rod protein FlgG [Thermotoga neapolitana DSM
           4359]
 gi|221572489|gb|ACM23301.1| Flagellar basal-body rod protein FlgG [Thermotoga neapolitana DSM
           4359]
          Length = 268

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 124/262 (47%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M +   AA GMSAQQ  L+ IANN+AN++TTGYK+ RAEF D LYQ  K AG+P+ +   
Sbjct: 9   MISLYSAATGMSAQQFKLDTIANNLANVDTTGYKKVRAEFQDLLYQYVKNAGTPTAATS- 67

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++   ++T G    TGN LDLA+ G G+FQ++  D  + YTR GS
Sbjct: 68  -TLPTGLYVGHGVRTAATTRIFTLGNFEQTGNALDLAIAGDGFFQIQLQDGRIAYTRDGS 126

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G++VT++G  LVP I IPE    I VS  G + A     +  Q +G + +  F+
Sbjct: 127 FKVDSEGRIVTSNGLLLVPEITIPENAVSINVSPDGIVSAELQDGT-IQQLGTITLVRFV 185

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL++IGDNL   T  SGDPI   P   GF  +KQG+LE SNVD V+E+ +MI+AQRA
Sbjct: 186 NPSGLKSIGDNLYIATPASGDPIEGVPGQDGFGAIKQGFLEKSNVDVVREMVDMITAQRA 245

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NS+VI+ ADEM    T ++
Sbjct: 246 YEFNSRVIQTADEMLRTATNVK 267


>gi|291280520|ref|YP_003497355.1| flagellar basal-body rod protein FlgG [Deferribacter desulfuricans
           SSM1]
 gi|290755222|dbj|BAI81599.1| flagellar basal-body rod protein FlgG [Deferribacter desulfuricans
           SSM1]
          Length = 262

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++    AA+GM+ QQ N++ I+NN+AN+NT G+K++R  F D LYQ  K AG    +A  
Sbjct: 2   LRTLWTAASGMTTQQINIDNISNNLANVNTAGFKKSRVNFEDLLYQELKPAG--GVTAAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI IG G ++ S   +++QG    TGN LD+A+ G G+FQV  PD T+ YTR GS
Sbjct: 60  INHPTGIQIGLGSKVVSTEKIFSQGNFQQTGNPLDIAIEGDGFFQVTLPDGTIGYTRNGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ G LVTA+G  L P I IP+   EI V   G +       ++   +GQ+ +A FI
Sbjct: 120 FKVDADGNLVTAEGYLLEPNIAIPDNALEIIVGEDGTLSVTLPGEAEPTELGQIELAKFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GLR+IG N+  +T+ SG+P    P + GF  + QG LE SNV+ V+E+  +I+ QRA
Sbjct: 180 NPSGLRSIGKNIYLQTAASGEPTTGIPGEDGFGTLAQGILEMSNVNVVEEMVNLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+  DEM  ++  ++
Sbjct: 240 YEINSKAIQTGDEMLQIVNNLK 261


>gi|163782718|ref|ZP_02177714.1| flagellar hook basal-body protein FlgG [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159881839|gb|EDP75347.1| flagellar hook basal-body protein FlgG [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 262

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 112/261 (42%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A   +A+GM+AQQTNL++I++N+AN+NT G+K+ R  F D +YQ  +  G+P+    ++
Sbjct: 3   RALWTSASGMTAQQTNLDVISHNMANVNTIGFKKMRPTFQDLIYQTVREPGAPTSPTTRS 62

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P G  IG G  I+    ++TQG +  TGN LDLA+ G G+F+V  PD T+ YTR G F
Sbjct: 63  --PSGFQIGLGTYIADTYGIFTQGNINQTGNTLDLAIQGDGFFKVVLPDGTIAYTRNGQF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +D  G++V +DG  L P I IP +   I ++  G +  +    +  + VG++ +A F+N
Sbjct: 121 RLDRDGRIVNSDGYPLDPEISIPPDALSIGIAADGTVTVLRQGATSVEEVGRIELAKFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGLR +G+NL  +T  SG+P+I NP + G   + QGYLE+SNV+ V+E+  +I AQRAY
Sbjct: 181 PAGLRRVGNNLYIQTDASGEPLIDNPGNQGIGTLLQGYLESSNVNIVEEMVNLIIAQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E N+K I AADEM S    +R
Sbjct: 241 EFNTKGITAADEMLSQAANLR 261


>gi|170288994|ref|YP_001739232.1| flagellar basal-body rod protein FlgG [Thermotoga sp. RQ2]
 gi|170176497|gb|ACB09549.1| flagellar basal-body rod protein FlgG [Thermotoga sp. RQ2]
          Length = 261

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M +   AA GMSAQQ  L+ IANN+AN++TTGYK+ RAEF D LYQ  K AG+P+ +   
Sbjct: 2   MISLYSAATGMSAQQFKLDTIANNLANVDTTGYKKVRAEFQDLLYQYVKNAGTPTAATSS 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++   ++T G    TGN LDLA+ G G+FQ++  D  + YTR GS
Sbjct: 62  --LPTGLYVGHGVRTAATTRIFTLGNFEQTGNALDLAIAGDGFFQIQLQDGRIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F IDS+G++VT++G  LVP I IPE    I VS  G + A     +  Q +G + +  F+
Sbjct: 120 FKIDSEGRIVTSNGLLLVPEITIPENAVSINVSPDGIVSAELQDGT-IQELGTITLVRFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL++IGDNL   T  SGDPI   P   GF  +KQG+LE SNVD V+E+ +MI+AQRA
Sbjct: 179 NPSGLKSIGDNLYIATPASGDPIEGVPGQDGFGAIKQGFLEKSNVDVVREMVDMITAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NS+VI+ ADEM    T ++
Sbjct: 239 YEFNSRVIQTADEMLRTATNVK 260


>gi|225686012|ref|YP_002733984.1| flagellar basal body rod protein FlgG [Brucella melitensis ATCC
           23457]
 gi|256262865|ref|ZP_05465397.1| flagellar basal body rod protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|225642117|gb|ACO02030.1| flagellar basal-body rod protein FlgG [Brucella melitensis ATCC
           23457]
 gi|263092700|gb|EEZ16909.1| flagellar basal body rod protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326410335|gb|ADZ67399.1| flagellar basal body rod protein FlgG [Brucella melitensis M28]
 gi|326553627|gb|ADZ88266.1| flagellar basal body rod protein FlgG [Brucella melitensis M5-90]
          Length = 262

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 147/263 (55%), Positives = 194/263 (73%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTG+KRARAEF D LYQ+E+ AG P+Q A++
Sbjct: 1   MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLLYQSERTAGVPNQ-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  +G GVQ ++VRN++ QG    TGN  D+AL GRGWFQ+++P    +YTRAG+
Sbjct: 60  AIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGWFQIQSPTGETLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DGN + P I IP +  E+ ++ +GQ+ A      +   +GQL +ANF 
Sbjct: 120 FNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAKLQDQINQVDLGQLTLANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG  ++  P D G+  +KQGYLEASNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLEPLGGNLYRETEASGGALVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AADEM++ ++  +R
Sbjct: 240 YEMNSKVIQAADEMAATVSKNLR 262


>gi|153011524|ref|YP_001372738.1| flagellar basal body rod protein FlgG [Ochrobactrum anthropi ATCC
           49188]
 gi|151563412|gb|ABS16909.1| flagellar basal-body rod protein FlgG [Ochrobactrum anthropi ATCC
           49188]
          Length = 262

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 147/263 (55%), Positives = 195/263 (74%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTG+KRARAEF+D LYQ+E+ AG P+Q A++
Sbjct: 1   MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFSDLLYQSERTAGVPNQ-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           ++VPEG  +G GVQ ++VRN++ QG    TGN  DLAL G+GWFQ+++P    +Y RAG+
Sbjct: 60  SIVPEGALVGLGVQTAAVRNLHMQGSFNQTGNPFDLALTGKGWFQIQSPTGETLYARAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DGN + P I IP +  E+ V+ +GQ+ A      +   +GQL +ANF 
Sbjct: 120 FNKNADGQLVTLDGNPVEPAITIPPDAVEVTVTDTGQVFAKLQDQVNQVDLGQLTLANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG P++  P D G+  +KQGYLEASNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AADEM++ ++  +R
Sbjct: 240 YEMNSKVIQAADEMAATVSKNLR 262


>gi|302392939|ref|YP_003828759.1| flagellar basal-body rod protein FlgG [Acetohalobium arabaticum DSM
           5501]
 gi|302205016|gb|ADL13694.1| flagellar basal-body rod protein FlgG [Acetohalobium arabaticum DSM
           5501]
          Length = 262

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQ N++ I+NN+AN+NT G+K++R  F D +YQ+ + AG+P+     
Sbjct: 2   IRSLWTAATGMKAQQLNIDTISNNLANVNTNGFKKSRVNFQDLMYQSLREAGTPNN--QG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + VP GI +G GV+ ++ + ++ QG    TGN LD+A+ G G+FQV  P+  V YTR GS
Sbjct: 60  SQVPAGIEVGHGVRPAATQKLFAQGSFQQTGNPLDMAIEGDGFFQVVRPNGQVGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS G++VT+DG  L   I IPE+T ++ ++  G+++     N +   VGQ+ ++ F 
Sbjct: 120 FKRDSNGRIVTSDGYPLASDITIPEDTTDVSITAEGRVMVKQPGNEEVTEVGQIELSRFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL++IG NL A T  SG P +  P + GF  + QGYLE  NV  V+E++ MI+AQRA
Sbjct: 180 NPAGLKSIGRNLFAETPASGGPTVGVPAEDGFGTISQGYLEKGNVKVVEEMTNMIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+A+D+M      ++
Sbjct: 240 YEVNSKAIKASDQMLQQANNLK 261


>gi|188997557|ref|YP_001931808.1| flagellar basal-body rod protein FlgG [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932624|gb|ACD67254.1| flagellar basal-body rod protein FlgG [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 266

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 111/266 (41%), Positives = 168/266 (63%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL++I++NIAN+NT G+KR+RA F D +YQ  +  G  S + ++
Sbjct: 2   LRALWTSASGMEAQQTNLDVISHNIANVNTVGFKRSRANFEDLIYQDVRDPGVLSSTQNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG GV++S V  +++QG ++ T N LD+A+ G G+F++E PD +  +TRAG+
Sbjct: 62  --VPAGIQIGLGVKVSDVAKMFSQGSLMKTDNPLDVAIQGEGFFKIEMPDGSEAFTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQ----ILAVTGKNSDFQPVGQLLI 176
           F ID++G +V  +G  L P I I      + +S S      ++  +G     + VG + +
Sbjct: 120 FQIDNEGYIVNPEGYRLSPNIQISAPETVLNISISPNGKVIVVRNSGGQQTTEEVGNIKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             FIN AGL+ IG NL   T  SG PI  +P+   F  + QG+LE SNV+ V+E+  +I 
Sbjct: 180 YKFINPAGLKAIGGNLFKYTEASGQPIEGDPNTDAFGKLTQGFLEMSNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE+NSK I  ADEM   ++ ++
Sbjct: 240 AQRAYEVNSKGIITADEMLKTVSTLK 265


>gi|225849135|ref|YP_002729299.1| flagellar basal-body rod protein FlgG [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644492|gb|ACN99542.1| flagellar basal-body rod protein FlgG [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 266

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 113/266 (42%), Positives = 172/266 (64%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL++I++NIAN+NT G+KR+RA F D +YQ  +  G  S + ++
Sbjct: 2   LRALWTSASGMEAQQTNLDVISHNIANVNTVGFKRSRANFEDLIYQDIRDPGVLSSTQNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG GV++S V  +++QG ++ T N LDLA+ G G+F++E PD +  +TRAG+
Sbjct: 62  --VPAGIQIGLGVKVSDVAKIFSQGSLIKTDNPLDLAIQGDGFFKIEMPDGSEAFTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQ----ILAVTGKNSDFQPVGQLLI 176
           F +D++G +V  +G  L P I I      I +S S      ++  +G     + VG + +
Sbjct: 120 FQLDNEGYIVNPEGYRLSPNIQISAPETVINISVSPNGKVVVVRNSGGQQTTEEVGDIKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             F+N+AGL+ IG NL   T  SG+PI  +P+  GF  + QG+LEASNV+ V+E+  +I 
Sbjct: 180 YRFMNQAGLKAIGQNLFKYTEASGEPIEGDPNTDGFGKITQGFLEASNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE+NSK I  ADEM   ++ ++
Sbjct: 240 AQRAYEVNSKGIITADEMLRTVSTLK 265


>gi|15644290|ref|NP_229342.1| flagellar basal-body rod protein FlgG [Thermotoga maritima MSB8]
 gi|148270380|ref|YP_001244840.1| flagellar basal-body rod protein FlgG [Thermotoga petrophila RKU-1]
 gi|281412686|ref|YP_003346765.1| flagellar basal-body rod protein FlgG [Thermotoga naphthophila
           RKU-10]
 gi|4982109|gb|AAD36609.1|AE001800_19 flagellar basal-body rod protein FlgG [Thermotoga maritima MSB8]
 gi|147735924|gb|ABQ47264.1| flagellar basal-body rod protein FlgG [Thermotoga petrophila RKU-1]
 gi|281373789|gb|ADA67351.1| flagellar basal-body rod protein FlgG [Thermotoga naphthophila
           RKU-10]
          Length = 261

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 124/262 (47%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M +   AA GMSAQQ  L+ IANN+AN++TTGYK+ RAEF D LYQ  K AG+P+ +   
Sbjct: 2   MISLYSAATGMSAQQFKLDTIANNLANVDTTGYKKVRAEFQDLLYQYVKNAGTPTAATSS 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++   ++T G    TGN LDLA+ G G+FQ++  D  + YTR GS
Sbjct: 62  --LPTGLYVGHGVRTAATTRIFTLGNFEQTGNALDLAIAGDGFFQIQLQDGRIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G++VT++G  LVP I IPE    I VS  G + A     +  Q +G + +  F+
Sbjct: 120 FKMDSEGRIVTSNGLLLVPEITIPENAVSINVSPDGIVSAELQDGT-IQELGTITLVRFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL++IGDNL   T  SGDPI   P   GF  +KQG+LE SNVD V+E+ +MI+AQRA
Sbjct: 179 NPSGLKSIGDNLYIATPASGDPIEGVPGQDGFGAIKQGFLEKSNVDVVREMVDMITAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NS+VI+ ADEM    T ++
Sbjct: 239 YEFNSRVIQTADEMLRTATNVK 260


>gi|237755437|ref|ZP_04584062.1| flagellar basal-body rod protein FlgG [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692401|gb|EEP61384.1| flagellar basal-body rod protein FlgG [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 266

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 110/266 (41%), Positives = 168/266 (63%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL++I++NIAN+NT G+KR+RA F D +YQ  +  G  S + ++
Sbjct: 2   LRALWTSASGMEAQQTNLDVISHNIANVNTVGFKRSRANFEDLIYQDVRDPGVLSSTQNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG GV++S V  +++QG ++ T N LD+A+ G G+F++E PD +  +TRAG+
Sbjct: 62  --VPAGIQIGLGVKVSDVAKMFSQGSLMKTDNPLDVAIQGEGFFKIEMPDGSEAFTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQ----ILAVTGKNSDFQPVGQLLI 176
           F +D++G +V  +G  L P I I      + +S S      ++  +G     + VG + +
Sbjct: 120 FQLDNEGYIVNPEGYRLSPNIQISAPETVLNISISPNGKVIVVRNSGGQQTTEEVGNIKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             FIN AGL+ IG NL   T  SG PI  +P+   F  + QG+LE SNV+ V+E+  +I 
Sbjct: 180 YKFINPAGLKAIGGNLFKYTEASGQPIEGDPNTDAFGKLTQGFLEMSNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE+NSK I  ADEM   ++ ++
Sbjct: 240 AQRAYEVNSKGIITADEMLRTVSTLK 265


>gi|118581849|ref|YP_903099.1| flagellar basal body rod protein FlgG [Pelobacter propionicus DSM
           2379]
 gi|118504559|gb|ABL01042.1| flagellar basal-body rod protein FlgG [Pelobacter propionicus DSM
           2379]
          Length = 262

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ N++++A+N+AN+NTTG+KR+RA+F D +YQ ++  GSP  + + 
Sbjct: 2   MRALWTAASGMQAQQKNIDVVAHNLANVNTTGFKRSRADFEDLIYQNQRSTGSP--ATNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG G +++SV  ++T G+   TGN LD+A+ G G+FQ++ PD T  Y+RAG+
Sbjct: 60  TQVPTGIQIGLGTRLASVSKLFTTGDFSQTGNELDIAIEGDGFFQIQMPDGTTAYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D +G++VT +G+ L+P IVIP  T +I +   G + A     +    VG + +A F 
Sbjct: 120 FKKDDQGRIVTPNGDPLLPEIVIPNNTTKIDIGSDGTVSATQSGQTTPTTVGTIQLALFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G NL   T  SG P    P   G   V QG LE SNV   +E+  MI  QRA
Sbjct: 180 NPAGLFSMGKNLYKETDSSGTPTTGTPGQDGLGTVAQGMLEMSNVSVAEEMVNMIIGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK ++AADEM      +R
Sbjct: 240 YEANSKAVQAADEMLQTANNLR 261


>gi|152990359|ref|YP_001356081.1| flagellar basal-body rod protein FlgG [Nitratiruptor sp. SB155-2]
 gi|151422220|dbj|BAF69724.1| flagellar basal-body rod protein FlgG [Nitratiruptor sp. SB155-2]
          Length = 266

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 113/266 (42%), Positives = 168/266 (63%), Gaps = 6/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL++++NNIAN+NTTG+K++RA F D +YQ  K  G   ++ + 
Sbjct: 2   IRALWTSASGMQAQQTNLDVVSNNIANVNTTGFKQSRANFEDLIYQNIKDPGV--ENGNG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI IG GV+++ V  +++QG + HT  +LD+A+ G+G+F++E P     YTRAG+
Sbjct: 60  NRLPTGIQIGLGVRVADVAKIFSQGSLKHTERDLDVAIQGKGFFKIELPGGGEAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAV----TGKNSDFQPVGQLLI 176
           F ID++G LVT  G  ++P I I      + +S S     V     G     + +GQL +
Sbjct: 120 FQIDNEGNLVTDQGYKVLPNIQINAPETLVGISISPNGKVVAVRSEGVGQTTEELGQLKL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
             FIN AGL+ IG NL  ++  S +PI  +PD  GF  + QG+LE SNV+ V+E+  +I 
Sbjct: 180 YRFINPAGLKAIGGNLFVQSEASAEPIEGDPDTNGFGKLSQGFLEMSNVNIVEEMVNLIV 239

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYEMNSK I  ADEM   +  ++
Sbjct: 240 AQRAYEMNSKGITTADEMLRTVATLK 265


>gi|86356312|ref|YP_468204.1| flagellar basal body rod protein FlgG [Rhizobium etli CFN 42]
 gi|86280414|gb|ABC89477.1| flagellar basal-body rod protein [Rhizobium etli CFN 42]
          Length = 262

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 155/263 (58%), Positives = 209/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTG+KRARAEF D LYQ E+  G  ++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFTDLLYQTERAKGVANR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEG +IG GVQ S+VRN++ QGE+  TGN+LD+AL+G+G+FQ+++ D T +YTRAG+
Sbjct: 60  AVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQIQSTDGTTLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN + +GQLVT DG  ++PGI IP+ + E+ +SRSG++ A     +D   +GQL +A+F+
Sbjct: 120 FNKNDQGQLVTIDGYEVLPGITIPQGSTELTISRSGEVSAKLPGQTDPTVLGQLTLADFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ IGDNL   T  SG+ ++ NPD+ GFA++KQGYLE+SNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLQPIGDNLFQETPASGEAVVGNPDEEGFAYMKQGYLESSNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|220932494|ref|YP_002509402.1| flagellar basal-body rod protein FlgG [Halothermothrix orenii H
           168]
 gi|219993804|gb|ACL70407.1| flagellar basal-body rod protein FlgG [Halothermothrix orenii H
           168]
          Length = 262

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 115/260 (44%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A   AA GM AQQTN++ I+NN+AN+NTTG+K+ R  F D +YQ  +  G+P+  +    
Sbjct: 4   ALWTAATGMDAQQTNIDTISNNLANVNTTGFKKTRVNFQDLMYQHIRQPGTPN--SQGGQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P GI +G GV++S+ + +++ G + +T N LD+ + G G+ QV  PD T+ YTR GS  
Sbjct: 62  IPVGIEVGHGVKVSATQKIFSPGNIQNTDNPLDILIEGDGFLQVLLPDGTLAYTRDGSLK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            DS G++VT+DG  + P I IPE+   I ++  G I      ++  Q +GQ+ +A F N 
Sbjct: 122 RDSMGRIVTSDGYPIQPEIYIPEDASSISITSDGTIAVEINGSNQPQQIGQIELARFSNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL +IG NL   T  SGDPI+  P   GF  + QG+LE SNV  V+E+  MI+AQRAYE
Sbjct: 182 AGLNSIGRNLFKPTVASGDPIVGTPGSPGFGTIAQGFLEMSNVKVVEEMVNMIAAQRAYE 241

Query: 243 MNSKVIEAADEMSSLITKMR 262
           +NSK I+AADEM    +++R
Sbjct: 242 INSKAIQAADEMLRTASQLR 261


>gi|32266580|ref|NP_860612.1| flagellar basal body rod protein FlgG [Helicobacter hepaticus ATCC
           51449]
 gi|32262631|gb|AAP77678.1| flagellar distal rod protein FlgG [Helicobacter hepaticus ATCC
           51449]
          Length = 262

 Score =  245 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A+ GM  QQ  ++  +NNIAN+NTTGYK+ RAEFAD  YQ  + AG  + +++ 
Sbjct: 2   MRSLYTASTGMLGQQLQIDNTSNNIANVNTTGYKKQRAEFADLFYQVLQYAG--TSTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+  +++ +++QG    T NNLD+A+ G G+FQ+E PD  + YTRAGS
Sbjct: 60  TISPTGIEVGIGVRPVAIQKMFSQGHPKETENNLDIAITGNGFFQIELPDGNIAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ G +V A+G  L+P + IPE   +I +   G +  + G  ++   +GQ+ I NFI
Sbjct: 120 FKLDNDGNVVNAEGYRLIPELTIPEGATQINIGTDGTVSVIEGNQTEVNILGQIEIVNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   T+ SGDP+   P   GF  ++QG+LE SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSLGDNLFINTNASGDPVAGVPGLDGFGQLRQGFLELSNVKLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKTIQTADSMLQTVNGLK 261


>gi|327398888|ref|YP_004339757.1| flagellar basal-body rod protein FlgG [Hippea maritima DSM 10411]
 gi|327181517|gb|AEA33698.1| flagellar basal-body rod protein FlgG [Hippea maritima DSM 10411]
          Length = 262

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 162/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQ N++ IANN+AN+NT G+KR+RA+F D LYQ  +  G    S   
Sbjct: 2   IRSLWTAATGMEAQQLNVDTIANNLANVNTVGFKRSRADFEDLLYQMVRQPGV--ASTAN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P GI IG GV+ ++V   ++QG    TGN LD+A+ G G+FQ++ PD T  YTR+G+
Sbjct: 60  TVEPTGIQIGLGVKPAAVVKNFSQGNFKETGNPLDIAIAGHGFFQIQMPDGTTAYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID+ G++V ++G  L+P I IP +T  I +   G +  +         +GQ+ +A F+
Sbjct: 120 FKIDNNGRIVNSEGYPLIPQITIPNDTVAINIGNDGTVSVLEAGQQTPSQIGQIQLAYFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ IG NL   T+ SG   + NP   G   ++QG LE SNV  V+E+ EMI+AQRA
Sbjct: 180 NPAGLKAIGHNLYQETTASGTATVDNPGSNGLGTLEQGVLEMSNVSVVQEMVEMIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE N+K I+ +DEM      ++
Sbjct: 240 YETNAKAIQTSDEMLQTANNVK 261


>gi|82702455|ref|YP_412021.1| hypothetical protein Nmul_A1326 [Nitrosospira multiformis ATCC
           25196]
 gi|82410520|gb|ABB74629.1| conserved hypothetical protein [Nitrosospira multiformis ATCC
           25196]
          Length = 260

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++IANN+AN++T G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLDAQQTQMDVIANNLANVSTNGFKRSRAVFEDLLYQTLRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +  +++TQG +  TGN+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TQLPSGLQLGTGVRPVATEHIFTQGNLQQTGNSKDVAIQGQGFFQVLRPDGSTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D +GQLVT+ G  + P I IP   + I V R G +   T  ++    VG L +A FI
Sbjct: 120 FQTDFEGQLVTSSGYHVQPAITIPPNAQSITVGRDGIVSVTTQDSTTPVQVGNLQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+++G+NL   T+ SG P ++NP   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQSVGENLYVETASSGTPNVTNPGTDGAGLLNQGYVETSNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   +T++
Sbjct: 240 YEINSKSVQTSDQMLQRLTQL 260


>gi|320354342|ref|YP_004195681.1| flagellar basal-body rod protein FlgG [Desulfobulbus propionicus
           DSM 2032]
 gi|320122844|gb|ADW18390.1| flagellar basal-body rod protein FlgG [Desulfobulbus propionicus
           DSM 2032]
          Length = 260

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 116/261 (44%), Positives = 178/261 (68%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   +  GMSAQ  N+++IANN+AN++TTG+K++RA+F D LYQ  KV GSP+ +  +
Sbjct: 1   MRSLWTSTTGMSAQNLNMDVIANNLANVSTTGFKKSRADFQDLLYQIMKVPGSPTSADTR 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +  P GI +G GV+ ++V  V+T+G++V T N LD+A+ G G+FQV  PD  + YTRAG+
Sbjct: 61  S--PTGIQVGLGVKPAAVTKVFTEGDIVQTENTLDVAIEGPGFFQVTLPDGNIAYTRAGN 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
             +D +G+L T+DG  + P IVIPE+ RE+ +S++G + A+ G ++    +G + + +F+
Sbjct: 119 LKLDGEGRLTTSDGFPIEPEIVIPEDAREVTISQTGVVSAIVGDDTTSTELGNVDLVDFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IG NL   T  SG P+I  P   G   + QGY+E SNV+ V+E++ MI+ QRA
Sbjct: 179 NDAGLIAIGRNLFRETEASGAPLIGAPGTNGIGTLLQGYVENSNVNLVEEMTHMITTQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           +E+NS VI  +DEM   +T M
Sbjct: 239 FEINSNVITTSDEMMQTVTNM 259


>gi|239817163|ref|YP_002946073.1| flagellar basal-body rod protein FlgG [Variovorax paradoxus S110]
 gi|239803740|gb|ACS20807.1| flagellar basal-body rod protein FlgG [Variovorax paradoxus S110]
          Length = 260

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+ AQQT L++++NN+AN+ TTG+KR+RA F D +YQ  +  G   Q++D+
Sbjct: 2   MRSLYIAKTGLDAQQTQLDVVSNNLANVGTTGFKRSRAVFEDLMYQNLRQVG--GQTSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV + +   +++QG +  T    D+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  TRLPSGLQVGTGVHVVATERIHSQGNLTKTDKPTDVAINGGGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVTA G  + P I +P     + + R G +       ++   VGQL +A F+
Sbjct: 120 FQTDRDGQLVTASGFPVQPAITLPANATSLTIGRDGIVSITQAGQTNTVQVGQLQLATFL 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL++ G+NL A T  SG P   NP   G   + QGY+EASNV+ V+E+  MI+ QRA
Sbjct: 180 NPAGLQSKGENLYAETDASGAPNQVNPGIDGAGILSQGYVEASNVNVVEELVNMIATQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   + ++
Sbjct: 240 YEINSKAVQTSDQMLQRLAQL 260


>gi|86157777|ref|YP_464562.1| flagellar basal-body rod FlgG [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774288|gb|ABC81125.1| flagellar basal-body rod FlgG [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 266

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQ  +++IANN+AN  TTG+KR RAEF D L +  + A +P      
Sbjct: 7   LRSLYTAATGMEAQQLRMDVIANNLANTGTTGFKRQRAEFEDLLSETVRGAEAP--DPRG 64

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+  S    + QGE++ TGN LDLA+ G G+F+V+ PD ++ YTRAG+
Sbjct: 65  GTAPAPLQVGLGVRTGSTVRNFGQGELLTTGNALDLAVEGDGFFRVQRPDGSLAYTRAGN 124

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ G+LVTA G  + P I  P ET  + V   G + A        Q +G+L +  F 
Sbjct: 125 FRVDAAGRLVTARGEVVDPEITFPPETTRVTVDADGTVRAQVAGREAPQELGRLELCTFP 184

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL   G NLL +T+ SG+ + + P + G   + QG+LE +NV AV+E+ +MI+ QRA
Sbjct: 185 NPGGLEAAGGNLLLQTAASGEAVDARPGEQGAGTLAQGFLEGANVKAVEEMIDMIATQRA 244

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NS+V++ AD+M   +T +R
Sbjct: 245 YELNSRVVQTADQMLQRLTSLR 266


>gi|312880335|ref|ZP_07740135.1| flagellar basal-body rod protein FlgG [Aminomonas paucivorans DSM
           12260]
 gi|310783626|gb|EFQ24024.1| flagellar basal-body rod protein FlgG [Aminomonas paucivorans DSM
           12260]
          Length = 262

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++    A GM AQQTNL++++NN+AN+NT+GYK+ RA+F D +YQ ++  G+P + A  
Sbjct: 2   IRSLWSGATGMIAQQTNLDVVSNNLANVNTSGYKKVRADFQDLMYQIDREPGAPVEPASM 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G G ++     +  +G +  TGN  D+A+ G G++QV  PD T+ YTR G+
Sbjct: 62  --IPTGIQVGLGTRVVGTSRIMGEGNIQTTGNPTDVAIEGDGFYQVTLPDGTLAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           + ID  GQ+VT+DG  L P I IP+  +E+ +S +GQ+  +   + + Q +GQ+ +A F+
Sbjct: 120 WRIDGNGQIVTSDGFLLEPAITIPDNMKELIISTTGQVSVLLPGDPNPQEIGQIQLARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GLR  G NL   T  SG PI+ NP D G     Q  LE +NV  V+E+  MI AQRA
Sbjct: 180 NPGGLRASGKNLFLETPASGAPIVGNPGDDGLGATLQRVLEMANVQVVEEMVNMIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  ADE+  +   +R
Sbjct: 240 YEANSKTISTADELLRIANNLR 261


>gi|220934396|ref|YP_002513295.1| flagellar basal-body rod protein FlgG [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995706|gb|ACL72308.1| flagellar basal-body rod protein FlgG [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 263

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 119/259 (45%), Positives = 163/259 (62%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           KA  IA  G+ AQQT + +I+NN+AN+NTTG+K+ RA F D +YQ  + AG  +Q+A   
Sbjct: 3   KALWIAKTGLDAQQTRMSVISNNLANVNTTGFKKGRAVFQDLIYQTVRQAG--AQAAQDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV+  +   ++TQG V  T N LD+A+ GRG+FQ+  PD  + YTR GSF
Sbjct: 61  ELPSGLMLGTGVRTVATEKMFTQGNVTQTENALDMAIEGRGFFQILMPDGNIAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            ++S GQLVT+ G  + PGIVIPE    + V+  G + A    N     VG L +A+FIN
Sbjct: 121 QLNSDGQLVTSGGYEVDPGIVIPEGALSVTVAEDGTVSATVAGNVAPIVVGNLQLADFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG NL   T+ SG P   NP   G   + QG+LE+SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLQPIGQNLFIETAASGAPQAGNPGLDGRGRLLQGFLESSNVNTVEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I  AD+M   +  
Sbjct: 241 EMNSKAISTADQMLQYVNN 259


>gi|197122909|ref|YP_002134860.1| flagellar basal-body rod protein FlgG [Anaeromyxobacter sp. K]
 gi|220917701|ref|YP_002493005.1| flagellar basal-body rod protein FlgG [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196172758|gb|ACG73731.1| flagellar basal-body rod protein FlgG [Anaeromyxobacter sp. K]
 gi|219955555|gb|ACL65939.1| flagellar basal-body rod protein FlgG [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 266

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 160/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQ  +++IANN+AN  TTG+KR RAEF D L +    A +P      
Sbjct: 7   LRSLYTAATGMEAQQLRMDVIANNLANTGTTGFKRQRAEFEDLLSETIHGAEAP--DPRG 64

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+  S    + QGE++ TGN LDLA+ G G+F+V+ PD ++ YTRAG+
Sbjct: 65  GTAPAALQVGLGVRTGSTVRNFGQGELLTTGNALDLAIEGDGFFRVQRPDGSLAYTRAGN 124

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ G+LVTA G  + P I  P ET  + V   G + A        Q +G+L +  F 
Sbjct: 125 FRVDAAGRLVTARGEVVDPEITFPPETTRVTVDADGTVRAQVAGREAPQELGRLELCTFP 184

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL   G NLL +T+ SG+ + + P + G   + QG+LE +NV AV+E+ +MI+ QRA
Sbjct: 185 NPGGLEAAGGNLLLQTAASGEAVDARPGEQGAGTLAQGFLEGANVKAVEEMIDMIATQRA 244

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NS+V++ AD+M   +T +R
Sbjct: 245 YELNSRVVQTADQMLQRLTSLR 266


>gi|209547928|ref|YP_002279845.1| flagellar basal body rod protein FlgG [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533684|gb|ACI53619.1| flagellar basal-body rod protein FlgG [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 262

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 155/263 (58%), Positives = 210/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTG+KRARAEF+D LYQ E+  G  ++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFSDLLYQTERAKGVANR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEG +IG GVQ S+VRN++ QGE+  TGN+LD+AL+G+G+FQ+++ D T +YTRAG+
Sbjct: 60  AVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQIQSTDGTTLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN + +GQLVT DG  ++PGI IP  + E+ +SRSGQ+ A     +D   +GQL +A+F+
Sbjct: 120 FNKNDQGQLVTIDGYEVLPGITIPTGSTELTISRSGQVSAKLPGAADATVLGQLTLADFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL   T+ SG+ ++ NPD+ GFA++KQGYLE+SNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLQPLGDNLFQETAASGEAVVGNPDEEGFAYMKQGYLESSNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|114330363|ref|YP_746585.1| flagellar basal body rod protein FlgG [Nitrosomonas eutropha C91]
 gi|114307377|gb|ABI58620.1| flagellar basal-body rod protein FlgG [Nitrosomonas eutropha C91]
          Length = 260

 Score =  243 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 164/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  I+  G+ AQQT +++IANN+ANI+T G+KR R  F D LYQ  +  G  +QS+++ 
Sbjct: 3   RSLWISKTGLDAQQTKMDVIANNLANISTNGFKRMRPVFEDLLYQTIRQPG--AQSSERT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV+  +  N++ QG +  TGN  D+A+ G G+FQ+  PD T+ YTR G+F
Sbjct: 61  RLPSGLQLGTGVRPVATENIFLQGNLQQTGNTRDVAIQGEGFFQILLPDGTLAYTRDGAF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             D  GQLVTA G  L P I IP  T  I + R G +  +T  ++   PVG + + +FIN
Sbjct: 121 QSDQDGQLVTASGFPLQPSITIPPNTLSITIGRDGTVSVLTPGSATPLPVGNIQLTSFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+  G+NL   T  SG P    P   G   + QG++E SNV+ V+E+ EMI  QRAY
Sbjct: 181 PAGLQRFGENLYLETMSSGVPNPGIPGTNGIGLLNQGFVETSNVNVVEELVEMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NS+ I+ +D+M S +T++
Sbjct: 241 EINSRSIQTSDQMLSRLTQL 260


>gi|116250482|ref|YP_766320.1| flagellar basal body rod protein FlgG [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255130|emb|CAK06204.1| flgG [Rhizobium leguminosarum bv. viciae 3841]
          Length = 262

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 154/263 (58%), Positives = 209/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTG+KRARAEF+D LYQ E+  G  ++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFSDLLYQTERAKGVANR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEG +IG GVQ S+VRN++ QGE+  TGN+LD+AL+G+G+FQ+++ D T +Y+RAG+
Sbjct: 60  AVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQIQSTDGTTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN + +GQLVT DG  ++PGI IP  + E+ +SRSGQ+ A     ++   +GQL +A+F+
Sbjct: 120 FNKNDQGQLVTIDGYEVLPGITIPTGSTELTISRSGQVSAKLPGATEATELGQLTLADFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL   T  SG+ +I NPD+ GFA++KQGYLE+SNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLQPLGDNLFQETPASGEAVIGNPDEEGFAYMKQGYLESSNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|227820858|ref|YP_002824828.1| flagellar basal body rod protein FlgG [Sinorhizobium fredii NGR234]
 gi|227339857|gb|ACP24075.1| flagellar basal-body rod protein FlgG [Sinorhizobium fredii NGR234]
          Length = 262

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 163/263 (61%), Positives = 211/263 (80%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTGYKRARAEF+D LYQ E+  G P++S ++
Sbjct: 1   MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLYQTERAQGVPNRS-NQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  +G GVQ ++VRN++ QG +V+T N+LDLALVGRGWFQVETP+   +YTR+G+
Sbjct: 60  AIVPEGAIVGLGVQTAAVRNLHVQGSLVNTSNDLDLALVGRGWFQVETPNGETVYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG T+VPGI +P++  EI VS SGQ+L   G  ++ Q +GQL IANF+
Sbjct: 120 FNTNATGQLVTIDGYTVVPGITVPQDATEITVSASGQVLVRIGDATETQEIGQLTIANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL   G+NL  +T+ SG+PI+  P D GFA +KQGYLE+SNVD VKEI+++ISAQRA
Sbjct: 180 NEAGLEPQGENLFKQTAASGEPIVGTPADPGFAQIKQGYLESSNVDPVKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AADEM++ ++  +R
Sbjct: 240 YEMNSKVIQAADEMAATVSKNLR 262


>gi|190890363|ref|YP_001976905.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652]
 gi|218516082|ref|ZP_03512922.1| flagellar basal body rod protein FlgG [Rhizobium etli 8C-3]
 gi|190695642|gb|ACE89727.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652]
          Length = 262

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 154/263 (58%), Positives = 208/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTG+KRARAEF D LYQ E+  G  ++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFTDLLYQTERAKGVANR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEG +IG GVQ S+VRN++ QGE+  TGN+LD+AL+G+G+FQ+++ D T +YTRAG+
Sbjct: 60  AVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQIQSTDGTTLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN + +GQLVT DG  ++PGI IP  + E+ +SRSG++       +D   +GQL +A+F+
Sbjct: 120 FNKNDQGQLVTVDGYEVLPGITIPTGSTELTISRSGEVSVKLPGATDTTVLGQLTLADFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ IGDNL   T+ SG+ ++ NPD+ GFA++KQGYLE+SNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLQPIGDNLFQETAASGEAVVGNPDEEGFAYMKQGYLESSNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|241203106|ref|YP_002974202.1| flagellar basal body rod protein FlgG [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856996|gb|ACS54663.1| flagellar basal-body rod protein FlgG [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 262

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 154/263 (58%), Positives = 209/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTG+KRARAEF+D LYQ E+  G  ++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFSDLLYQTERAKGVANR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEG +IG GVQ S+VRN++ QGE+  TGN+LD+AL+G+G+FQ+++ D T +Y+RAG+
Sbjct: 60  AVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQIQSTDGTTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN + +GQLVT DG  ++PGI IP  + E+ +SRSGQ+ A     ++   +GQL +A+F+
Sbjct: 120 FNKNDQGQLVTIDGYEVLPGITIPTGSTELTISRSGQVTAKLPGATEATELGQLTLADFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL   T  SG+ +I NPD+ GFA++KQGYLE+SNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLQPLGDNLFQETPASGEAVIGNPDEEGFAYMKQGYLESSNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|288574697|ref|ZP_06393054.1| flagellar basal-body rod protein FlgG [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570438|gb|EFC91995.1| flagellar basal-body rod protein FlgG [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 262

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 158/262 (60%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++    A GM AQQTNL++ +NN+AN+NT GYK+ R  FAD LYQ  +  GSP +    
Sbjct: 2   IRSLWTGATGMVAQQTNLDVTSNNLANVNTVGYKKVRTNFADLLYQINREPGSPVE--GG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI +G G +++    + T G    T   L++A+ G  +FQV  P+  + Y+  G 
Sbjct: 60  TTVPTGIQVGLGARVNGTSRITTPGSYEVTDAPLNVAIEGNAYFQVVLPNGDIAYSANGE 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           +  D  GQ+VT+DG  L P IVIPE+  +I +S +GQ+      + + Q +GQ+ +  F+
Sbjct: 120 WQRDGDGQIVTSDGYLLEPAIVIPEDGTDITISSTGQVYVSQPGDDEAQEIGQIELVRFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR IG NL   T+ SGDP I NP D GF  ++QG LE SNV  V+E+  +I AQRA
Sbjct: 180 NPAGLRAIGRNLFRETAASGDPQIGNPGDDGFPTLQQGILERSNVQVVEEMVNLIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD +  +   ++
Sbjct: 240 YEANSKTIQTADRLLEVANGLK 261


>gi|34558104|ref|NP_907919.1| flagellar basal body rod protein FlgG [Wolinella succinogenes DSM
           1740]
 gi|34483822|emb|CAE10819.1| FLAGELLAR BASAL-BODY ROD PROTEIN DISTAL ROD PROTEIN [Wolinella
           succinogenes]
          Length = 263

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GM  QQ  +++ +NNIAN+NT GYK+ RAEFAD  YQ  + AG  S +++ 
Sbjct: 2   MRALYTATTGMMGQQLQIDVTSNNIANVNTIGYKKQRAEFADLFYQVMEYAG--SSTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+ +++  +++QG    TGNNLD+A+ G G+FQ++ PD T  YTR G+
Sbjct: 60  TLSPTGIEVGLGVRPTAITKIFSQGNFKETGNNLDIAITGNGFFQIQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D +G +V +DG  L+P I IPE+  +I +   G +  + G  ++   +GQ+ IA FI
Sbjct: 120 FKPDDEGNIVNSDGYRLIPEITIPEDATQINIGVDGTVSVLQGNQTEVNTIGQIEIATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   T+ SGDPI+  P   GF  ++QG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSLGDNLYLNTNASGDPIVDTPGLNGFGQLRQGFVELSNVKLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADSMLQTVNSLK 261


>gi|206890777|ref|YP_002249848.1| flagellar basal-body rod protein FlgG [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742715|gb|ACI21772.1| flagellar basal-body rod protein FlgG [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 262

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A+ GM AQQ NL++I++N+AN+NTTG+K+ RAEF D LYQ     G+PS   D 
Sbjct: 2   LRSLFTASTGMYAQQLNLDVISHNLANVNTTGFKKGRAEFQDLLYQNVINPGAPSD--DG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+  +V   +T G++++TGN+LDLA+ G G+FQV  PD T+ YTRAG+
Sbjct: 60  TQYPSGIQVGLGVRPVAVAKFFTPGDLINTGNDLDLAIDGDGFFQVTLPDGTIAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  G++VT DG  + PGI +P +  +I     G +  +         +G + +A FI
Sbjct: 120 FRIDKDGRIVTNDGYPIEPGITVPADATKITFGADGTVTVLQPGTVAPVQIGTVELARFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL+ IG NL   T  SG P    P   G   + QG+LE SNV+ V+E++ MI AQRA
Sbjct: 180 NPGGLQAIGRNLFLETDASGTPTTGTPGTEGRGKIVQGFLEMSNVNIVEELANMIIAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           +++NSK ++ +DEM   +  ++
Sbjct: 240 FDINSKAVQTSDEMLQTVAALK 261


>gi|163758015|ref|ZP_02165103.1| flagellar basal-body rod protein [Hoeflea phototrophica DFL-43]
 gi|162284304|gb|EDQ34587.1| flagellar basal-body rod protein [Hoeflea phototrophica DFL-43]
          Length = 262

 Score =  242 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 160/263 (60%), Positives = 206/263 (78%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANN+ANINTTG+KRARAEFAD LYQ E+  G P+ ++++
Sbjct: 1   MKALAIAATGMNAQQLNLEVIANNVANINTTGFKRARAEFADLLYQVERNQGVPN-ASNQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  IG GVQ S+VRN++ QG +V T N  DLALVGRGWFQ+ETPD    YTRAG+
Sbjct: 60  AIVPEGAHIGLGVQTSAVRNLHIQGSLVGTSNKFDLALVGRGWFQIETPDGETNYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G+LVT DG T+VPGIV P+E  E+ +SR+GQ+ A  G  ++ Q +GQL +ANF+
Sbjct: 120 FNTNADGELVTIDGYTVVPGIVFPDEASEVVISRTGQVFARIGNEAEMQELGQLTLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +GDNL   T+ SG   +  PDD GFAH++QGYLE SNVD +KEI+++ISAQRA
Sbjct: 180 NEAGLEPLGDNLFRETTASGPANVGVPDDPGFAHIQQGYLEGSNVDPIKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSK+I+AADEM+S ++  +R
Sbjct: 240 YEMNSKIIQAADEMASTVSKNLR 262


>gi|224437199|ref|ZP_03658180.1| flagellar basal body rod protein FlgG [Helicobacter cinaedi CCUG
           18818]
 gi|313143665|ref|ZP_07805858.1| flagellar basal body rod protein FlgG [Helicobacter cinaedi CCUG
           18818]
 gi|313128696|gb|EFR46313.1| flagellar basal body rod protein FlgG [Helicobacter cinaedi CCUG
           18818]
          Length = 262

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 169/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A  GM  QQ  ++  +NNIAN+NTTGYK+ RAEFAD  YQ  + AG  + +++ 
Sbjct: 2   MRSLYTATTGMLGQQMQIDNTSNNIANVNTTGYKKQRAEFADLFYQVLQYAG--TSTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+  +V+ +++QG    T NNLD+A+ G G+FQ+E PD  + YTRAGS
Sbjct: 60  TISPTGIEVGIGVRPVAVQKMFSQGHPKETENNLDVAITGNGFFQIELPDGNIAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ G +V A+G  L+P + IPE   +I +   G +  + G  ++   +GQ+ I NFI
Sbjct: 120 FKLDNNGNVVNAEGYRLIPELTIPEGATQINIGTDGTVSVIEGNQTEVNVLGQIEIVNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   T+ SGDP+   P   GF  ++QG+LE SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSLGDNLFINTNASGDPVAGVPGLDGFGQLRQGFLELSNVKLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADSMLQTVNGLK 261


>gi|74317650|ref|YP_315390.1| flagellar basal body rod protein FlgG [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057145|gb|AAZ97585.1| flagellar basal body rod protein FlgG [Thiobacillus denitrificans
           ATCC 25259]
          Length = 260

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 112/261 (42%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I+NN+AN++T+G+KRARA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISNNLANVSTSGFKRARAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  TGN  D+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  TQLPSGLQIGTGVKPVATERIFTQGNLQQTGNAKDVAIQGNGFFQVLMPDGTTSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ GQLVTA G  + P I IP +T+ + + R G +      ++    +G L +A F+
Sbjct: 120 FMADANGQLVTASGYAVQPAITIPADTQTLTIGRDGTVSVTQPGSATPVTIGTLQLAMFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+++G+NL A T+ SG P  S P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQSLGENLYAETAASGTPSSSAPGSNGAGLLNQGYVETSNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I+ +D+M   +T++
Sbjct: 240 YEINSKAIQTSDQMLQRLTQL 260


>gi|325982369|ref|YP_004294771.1| flagellar basal-body rod protein FlgG [Nitrosomonas sp. AL212]
 gi|325531888|gb|ADZ26609.1| flagellar basal-body rod protein FlgG [Nitrosomonas sp. AL212]
          Length = 260

 Score =  241 bits (614), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT L++IANN+AN+NT G+KR+RA F D +YQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLEAQQTKLDVIANNLANVNTNGFKRSRAVFEDLMYQTLRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +  +++TQG +  T N  D+A+ G G+FQV  PD T  YTR G+
Sbjct: 60  TQLPSGLQLGTGVKPVATESIFTQGIIQPTDNPRDVAIRGLGFFQVLMPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P IV+P  T+ + V R G + A    ++    +G + +A+FI
Sbjct: 120 FQLDLNGQLVTSSGYMVQPAIVVPPNTQTVTVGRDGTVSATVPGSNVPIQLGNIQLASFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL+ +G+NL   T+ SG P  + P   G   + QG++E SNV  V+E+  MI  QRA
Sbjct: 180 NPSGLQKMGENLYMETASSGTPNQNAPGTNGLGILDQGFVETSNVSVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK IE +D+M   + ++
Sbjct: 240 YEMNSKSIETSDQMLQKLAQL 260


>gi|295097201|emb|CBK86291.1| flagellar basal-body rod protein FlgG, Gram-negative bacteria
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 260

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 174/261 (66%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN+NT G+KR RA F D LYQ  +  G  +Q++++
Sbjct: 2   IRSLWIAKTGLEAQQTNMDVISNNLANVNTNGFKRQRAVFQDLLYQTMRQPG--AQASEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S + V+TQG +  TGN+ D+A+ G+G+FQV+ PD +  YTR G 
Sbjct: 60  TTLPSGLQLGTGVRPVSTQRVHTQGGLNMTGNDTDVAIEGKGFFQVQLPDGSTAYTRDGH 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ +  GQLV A+G+ ++PG+V+P++ +E+++S  G +       +  Q VGQL +A F+
Sbjct: 120 FDKNENGQLVNAEGHPILPGVVVPQDAKEMQISPDGIVSVTLPGQAQPQQVGQLTLATFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL +IG NL   T  SG P   NP       +KQ Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESIGGNLYRETQSSGAPNELNPGLEDAGTLKQKYIETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   +T++
Sbjct: 240 YEINSKAVSASDQMLQRLTQL 260


>gi|238782794|ref|ZP_04626823.1| Flagellar basal-body rod protein flgG [Yersinia bercovieri ATCC
           43970]
 gi|238716217|gb|EEQ08200.1| Flagellar basal-body rod protein flgG [Yersinia bercovieri ATCC
           43970]
          Length = 260

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN++T G+KR RA F D LYQ  +  G  +QS ++
Sbjct: 2   IRSLWIAKTGLEAQQTNMDVISNNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S   +++QG +  T N+ DLA+ G G+FQ++  D T  +TR GS
Sbjct: 60  TTIPSGLQLGTGVRPVSTERLHSQGSLNQTSNSKDLAIQGNGFFQIQLADGTTAFTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  GQLVT+ G  + P I +P +   + V   G +       +  Q VGQ+ ++ FI
Sbjct: 120 FQIDQNGQLVTSSGYPVQPAITLPPDAETLTVGNDGIVSVTVQGQTAPQQVGQITLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL +IG+NL   T  SG P  + P   G   ++QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESIGENLYRETQSSGAPNETTPGLNGSGTLRQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQRLTQL 260


>gi|197285508|ref|YP_002151380.1| flagellar basal-body rod protein [Proteus mirabilis HI4320]
 gi|227355999|ref|ZP_03840391.1| flagellar basal-body rod protein (distal rod protein) [Proteus
           mirabilis ATCC 29906]
 gi|194682995|emb|CAR43442.1| flagellar basal-body rod protein (distal rod protein) [Proteus
           mirabilis HI4320]
 gi|227163987|gb|EEI48889.1| flagellar basal-body rod protein (distal rod protein) [Proteus
           mirabilis ATCC 29906]
          Length = 260

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN++T G+KR RA F D LYQ  +  G  + ++++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVISNNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AMTSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ IG+GV+  +   +++QG +  T    D+A+ G+G+F V+ PD T  YTR GS
Sbjct: 60  TNAPSGLQIGTGVRPVATERLHSQGNLAQTNGTRDVAIKGQGFFHVQLPDGTDAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  +VP I++PE  +++ V R G +      +   Q VGQL +  FI
Sbjct: 120 FQMDQNGQLVTSSGFQIVPAIILPETAKKVMVGRDGIVSVEIEGSPAPQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESVGENLYLETASSGAPTENAPGINGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAISTSDQMLQKLTQL 260


>gi|2275161|gb|AAB81413.1| FlgG [Sinorhizobium meliloti]
          Length = 262

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 160/263 (60%), Positives = 210/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTGYKRARAEF+D LYQ E+  G P++S ++
Sbjct: 1   MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLYQTERAQGVPNRS-NQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  IG GVQ S+VRN++ QG +V+TGN+ DLALVGRGWFQ+ETPD   +YTR+G+
Sbjct: 60  AIVPEGAIIGLGVQTSAVRNLHIQGSLVNTGNDYDLALVGRGWFQIETPDGETVYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG T+VPG+ +P++  EI  + SGQ++   G +++ Q +GQL IANF+
Sbjct: 120 FNTNATGQLVTIDGYTVVPGVTVPQDATEIVFTSSGQVMVRIGNDTELQEIGQLTIANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G+NL  +T  SGDPI+  P D GFA +KQ YLE+SNVD VKEI+++ISAQRA
Sbjct: 180 NEAGLEPMGENLFRQTPASGDPIVGTPADPGFAQIKQNYLESSNVDPVKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSK+I+AADEM++ ++  +R
Sbjct: 240 YEMNSKIIQAADEMAATVSKNLR 262


>gi|15964415|ref|NP_384768.1| flagellar basal body rod protein FlgG [Sinorhizobium meliloti 1021]
 gi|307311557|ref|ZP_07591198.1| flagellar basal-body rod protein FlgG [Sinorhizobium meliloti
           BL225C]
 gi|307318912|ref|ZP_07598343.1| flagellar basal-body rod protein FlgG [Sinorhizobium meliloti AK83]
 gi|17380480|sp|Q52946|FLGG_RHIME RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|15073592|emb|CAC45234.1| Flagellar basal-body rod protein [Sinorhizobium meliloti 1021]
 gi|306895326|gb|EFN26081.1| flagellar basal-body rod protein FlgG [Sinorhizobium meliloti AK83]
 gi|306899574|gb|EFN30203.1| flagellar basal-body rod protein FlgG [Sinorhizobium meliloti
           BL225C]
          Length = 262

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 161/263 (61%), Positives = 210/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTGYKRARAEF+D LYQ E+  G P++S ++
Sbjct: 1   MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLYQTERAQGVPNRS-NQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  IG GVQ S+VRN++ QG +V+TGN+ DLALVGRGWFQ+ETPD   +YTR+G+
Sbjct: 60  AIVPEGAIIGLGVQTSAVRNLHIQGSLVNTGNDYDLALVGRGWFQIETPDGETVYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG T+VPG+ +P++  EI  + SGQ++   G +++ Q +GQL IANF+
Sbjct: 120 FNTNATGQLVTIDGYTVVPGVTVPQDATEIVFTSSGQVMVRIGNDTELQEIGQLTIANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G+NL  +T  SGDPI+  P D GFA VKQ YLE+SNVD VKEI+++ISAQRA
Sbjct: 180 NEAGLEPMGENLFRQTPASGDPIVGTPADPGFAQVKQNYLESSNVDPVKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSK+I+AADEM++ ++  +R
Sbjct: 240 YEMNSKIIQAADEMAATVSKNLR 262


>gi|308185371|ref|YP_003929504.1| flagellar basal body rod protein FlgG [Helicobacter pylori SJM180]
 gi|308061291|gb|ADO03187.1| flagellar basal body rod protein FlgG [Helicobacter pylori SJM180]
          Length = 262

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 181/262 (69%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++RA+F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRADFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+ G+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDIAITGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SGD I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGDAIVGNPDSQGLGKLRQGFLELSNVKLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|313141242|ref|ZP_07803435.1| flagellar basal-body rod protein distal rod protein [Helicobacter
           canadensis MIT 98-5491]
 gi|313130273|gb|EFR47890.1| flagellar basal-body rod protein distal rod protein [Helicobacter
           canadensis MIT 98-5491]
          Length = 262

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GM  QQ  +++ +NNI+N+NT GY++ RAEFAD  +Q  + AG  S +++ 
Sbjct: 1   MRALYTATTGMLGQQLQIDVTSNNISNVNTFGYRKERAEFADLFHQVLQYAG--SSTSET 58

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+ +SV+ +++QG    T NNLD+A+ G G+FQ+E PD T+ YTR GS
Sbjct: 59  TLSPTGIEVGLGVRPTSVQKIFSQGNFKETENNLDIAITGNGFFQIELPDGTIAYTRDGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G +V + G  LVP I IP++  +I +   G +  V G  ++   +GQ+   NFI
Sbjct: 119 FKLDDEGNVVNSQGYLLVPNITIPDDATQINIGTDGTVSVVQGNETEVNELGQIETVNFI 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T+ SGDPI+  P   GF  ++QG++E SNV  V+E++++I  QRA
Sbjct: 179 NPAGLHALGDNLYLNTNASGDPIVGTPGLNGFGQLRQGFVETSNVKLVEEMTDLIVGQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M  ++ +++
Sbjct: 239 YEANSKSIQTADSMLQIVNQLK 260


>gi|90422610|ref|YP_530980.1| flagellar basal body rod protein FlgG [Rhodopseudomonas palustris
           BisB18]
 gi|90104624|gb|ABD86661.1| Flagellar basal-body rod FlgG [Rhodopseudomonas palustris BisB18]
          Length = 262

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 141/260 (54%), Positives = 184/260 (70%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ N+E+IANNIANINTT YKRARAEF D  YQ +++ G P++  + 
Sbjct: 1   MRALAIAATGMSAQQLNVEVIANNIANINTTSYKRARAEFTDLFYQIDRMQGVPNRVGEG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV PEG  +G GV+ ++VR ++ QG +  TGN  DLA+ GRGWFQV  P+   +YTRAG+
Sbjct: 61  AV-PEGAKLGLGVRSAAVRKLHLQGALTQTGNPYDLAVNGRGWFQVVGPNGETLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVTADG  + P I+IP+ T E+ V+ SGQ+ A        + +G+L +ANF 
Sbjct: 120 FNTNADGQLVTADGYNVDPAILIPQGTVEVTVNESGQVFAKLDGEITPRELGRLTLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG P++  P D GF  +   YLE+SNVD VKEI+E+ISAQR+
Sbjct: 180 NEAGLDPLGSNLYKETLSSGVPVVGVPGDPGFGKIYHHYLESSNVDPVKEITELISAQRS 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI AADEM+  ++K
Sbjct: 240 YEMNSKVITAADEMAQTVSK 259


>gi|109946869|ref|YP_664097.1| flagellar basal body rod protein FlgG [Helicobacter acinonychis
           str. Sheeba]
 gi|109714090|emb|CAJ99098.1| flagellar basal-body rod protein FlgG [Helicobacter acinonychis
           str. Sheeba]
          Length = 262

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 182/262 (69%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++RA+F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRADFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+VG+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDVAIVGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SGD I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGDAIVGNPDSQGLGKLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|307718428|ref|YP_003873960.1| flagellar basal-body rod protein [Spirochaeta thermophila DSM 6192]
 gi|306532153|gb|ADN01687.1| flagellar basal-body rod protein [Spirochaeta thermophila DSM 6192]
          Length = 264

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 111/264 (42%), Positives = 161/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA+GM  QQ +++ +ANN++N+NTTG+K+ R +F D +YQ  ++AG+P  + + 
Sbjct: 2   MRSLWTAASGMVGQQYHIDTVANNLSNVNTTGFKKNRVDFQDLIYQTVRMAGTP--ATEV 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP    +G GV++++   ++TQG + HT N  DLA+ G G+F+V   D T  YTR GS
Sbjct: 60  TVVPTPTQVGHGVRVAASSKIFTQGALQHTDNVSDLAIQGEGFFRVLLYDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIK--VSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS GQLVT++G  L+P IV+PE        VS  G++        D   VGQ+ +  
Sbjct: 120 FKIDSNGQLVTSNGYRLIPEIVLPEGFIADTLAVSEDGRVTVKVPGQDDPVEVGQIQLYR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  +GDNL   T+ SGDPI   P   G   +   +LE SNV  V E+ EMI AQ
Sbjct: 180 FVNPAGLLAVGDNLYKVTNASGDPIGGRPGFDGMGKLLHKFLEMSNVSVVNEMVEMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK ++ +D M      ++
Sbjct: 240 RAYELNSKAVQTSDSMLGTAVNLK 263


>gi|114320059|ref|YP_741742.1| flagellar basal-body rod protein FlgG [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226453|gb|ABI56252.1| flagellar basal-body rod protein FlgG [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 261

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 164/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQQT +++++NN+AN+NTTG+K+ RA F D +YQ  + AG   QS    +
Sbjct: 4   ALWVAKTGLDAQQTRMQVVSNNLANVNTTGFKKDRANFEDLIYQTVRQAG--GQSTQDTL 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+++G+GV+++S   ++ QG +  T N+LD+A+ G G+FQ+  PD  + Y+R GSFN
Sbjct: 62  LPTGLNLGTGVRVTSTEKIHMQGNIQQTENSLDIAIEGDGFFQILMPDGEIAYSRDGSFN 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +D +GQ+VT+ G  L P I IP++   + + R G + A     +D Q +G + +A+FIN 
Sbjct: 122 VDDQGQMVTSSGYQLQPPINIPDDAVSVTIGRDGTVSARLPGQADPQQLGNIQLADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T+ SG P IS+P   G   + QG LE+SNV+  +E+  MI  QRA+E
Sbjct: 182 AGLDAMGGNLFRETAASGPPQISDPGLDGVGTLLQGALESSNVNIAEELVNMIETQRAFE 241

Query: 243 MNSKVIEAADEMSSLITK 260
            N+K I + D+M   I  
Sbjct: 242 TNTKAISSTDQMLQFINN 259


>gi|15612557|ref|NP_224210.1| flagellar basal body rod protein FlgG [Helicobacter pylori J99]
 gi|4156115|gb|AAD07066.1| FLAGELLAR BASAL-BODY ROD PROTEIN (DISTAL ROD PROTEIN) [Helicobacter
           pylori J99]
 gi|317015022|gb|ADU82458.1| flagellar basal body rod protein FlgG [Helicobacter pylori
           Gambia94/24]
          Length = 262

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 181/262 (69%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++RA+F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRADFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+ G+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDIAITGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SGD I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGDAIVGNPDSQGLGKLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|108563958|ref|YP_628274.1| flagellar basal body rod protein FlgG [Helicobacter pylori HPAG1]
 gi|207092034|ref|ZP_03239821.1| flagellar basal body rod protein FlgG [Helicobacter pylori
           HPKX_438_AG0C1]
 gi|208435465|ref|YP_002267131.1| flagellar basal-body rod protein [Helicobacter pylori G27]
 gi|210135763|ref|YP_002302202.1| flagellar basal body rod protein FlgG [Helicobacter pylori P12]
 gi|217031740|ref|ZP_03437244.1| hypothetical protein HPB128_155g53 [Helicobacter pylori B128]
 gi|254780116|ref|YP_003058223.1| flagellar basal body rod protein FlgG [Helicobacter pylori B38]
 gi|298737122|ref|YP_003729652.1| flagellar basal-body rod protein FlgG [Helicobacter pylori B8]
 gi|107837731|gb|ABF85600.1| flagellar basal-body rod protein [Helicobacter pylori HPAG1]
 gi|208433394|gb|ACI28265.1| flagellar basal-body rod protein [Helicobacter pylori G27]
 gi|210133731|gb|ACJ08722.1| flagellar basal-body rod protein [Helicobacter pylori P12]
 gi|216946587|gb|EEC25187.1| hypothetical protein HPB128_155g53 [Helicobacter pylori B128]
 gi|254002029|emb|CAX30288.1| Flagellar basal-body rod protein flgG (Distal rod protein)
           [Helicobacter pylori B38]
 gi|298356316|emb|CBI67188.1| flagellar basal-body rod protein FlgG [Helicobacter pylori B8]
 gi|307638271|gb|ADN80721.1| Flagellar basal-body rod protein [Helicobacter pylori 908]
 gi|317010275|gb|ADU80855.1| flagellar basal body rod protein FlgG [Helicobacter pylori India7]
 gi|317011821|gb|ADU85568.1| flagellar basal body rod protein FlgG [Helicobacter pylori
           SouthAfrica7]
 gi|325996863|gb|ADZ52268.1| Flagellar basal-body rod protein [Helicobacter pylori 2018]
 gi|325998456|gb|ADZ50664.1| Flagellar basal-body rod protein [Helicobacter pylori 2017]
          Length = 262

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 181/262 (69%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++RA+F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRADFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+ G+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDVAITGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SGD I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGDAIVGNPDSQGLGKLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|15646192|ref|NP_208376.1| flagellar basal body rod protein FlgG [Helicobacter pylori 26695]
 gi|188528376|ref|YP_001911063.1| flagellar basal body rod protein FlgG [Helicobacter pylori Shi470]
 gi|217033804|ref|ZP_03439229.1| hypothetical protein HP9810_877g8 [Helicobacter pylori 98-10]
 gi|308183740|ref|YP_003927867.1| flagellar basal body rod protein FlgG [Helicobacter pylori PeCan4]
 gi|2314768|gb|AAD08623.1| flagellar basal-body rod protein (flgG) [Helicobacter pylori 26695]
 gi|188144616|gb|ACD49033.1| flagellar basal body rod protein FlgG [Helicobacter pylori Shi470]
 gi|216943702|gb|EEC23145.1| hypothetical protein HP9810_877g8 [Helicobacter pylori 98-10]
 gi|261838871|gb|ACX98637.1| flagellar basal-body rod protein [Helicobacter pylori 51]
 gi|297380761|gb|ADI35648.1| flagellar basal-body rod protein FlgG [Helicobacter pylori v225d]
 gi|308062867|gb|ADO04755.1| flagellar basal body rod protein FlgG [Helicobacter pylori Cuz20]
 gi|308064367|gb|ADO06254.1| flagellar basal body rod protein FlgG [Helicobacter pylori Sat464]
 gi|308065925|gb|ADO07817.1| flagellar basal body rod protein FlgG [Helicobacter pylori PeCan4]
 gi|315585990|gb|ADU40371.1| flagellar basal-body rod protein FlgG [Helicobacter pylori 35A]
 gi|317178306|dbj|BAJ56095.1| flagellar basal body rod protein FlgG [Helicobacter pylori F16]
 gi|317179787|dbj|BAJ57575.1| flagellar basal body rod protein FlgG [Helicobacter pylori F30]
 gi|317181286|dbj|BAJ59072.1| flagellar basal body rod protein FlgG [Helicobacter pylori F32]
 gi|317182809|dbj|BAJ60593.1| flagellar basal body rod protein FlgG [Helicobacter pylori F57]
 gi|332674396|gb|AEE71213.1| flagellar basal-body rod protein FlgG [Helicobacter pylori 83]
          Length = 262

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 181/262 (69%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++RA+F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRADFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+ G+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDVAITGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SG+ I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGEAIVGNPDSQGLGKLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|315185552|gb|EFU19321.1| flagellar basal-body rod protein FlgG [Spirochaeta thermophila DSM
           6578]
          Length = 264

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 111/264 (42%), Positives = 161/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA+GM  QQ +++ +ANN++N+NTTG+K+ R +F D +YQ  ++AG+P  + + 
Sbjct: 2   MRSLWTAASGMVGQQYHIDTVANNLSNVNTTGFKKNRVDFQDLIYQTVRMAGTP--ATEV 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP    +G GV++++   ++TQG + HT N  DLA+ G G+F+V   D T  YTR GS
Sbjct: 60  TVVPTPTQVGHGVRVAASSKIFTQGALQHTDNVSDLAIQGEGFFRVLLYDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIK--VSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS GQLVT++G  L+P IV+PE        VS  G++        D   VGQ+ I  
Sbjct: 120 FKIDSNGQLVTSNGYRLIPEIVLPEGFIADTLSVSEDGRVTVKVPGQDDPVEVGQIQIYR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N +GL  +GDNL   T+ SGDPI   P   G   +   +LE SNV  V E+ EMI AQ
Sbjct: 180 FVNPSGLLAVGDNLYKVTNASGDPIGGRPGFDGMGKLLHKFLEMSNVSVVNEMVEMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK ++ +D M      ++
Sbjct: 240 RAYELNSKAVQTSDSMLGTAVNLK 263


>gi|110632656|ref|YP_672864.1| flagellar basal body rod protein FlgG [Mesorhizobium sp. BNC1]
 gi|110283640|gb|ABG61699.1| flagellar basal-body rod protein FlgG [Chelativorans sp. BNC1]
          Length = 262

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 157/260 (60%), Positives = 198/260 (76%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQTNLE+IANNIANINTTG+KRARAEF+D LYQ E++ G P + A++
Sbjct: 1   MKALSIAATGMSAQQTNLEVIANNIANINTTGFKRARAEFSDLLYQVERLQGVPER-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VPEG +IG GV+ ++VRNV+ QG + +TGN LD+ALVG+GWFQ+E  D   +Y+RAG+
Sbjct: 60  NIVPEGANIGLGVKTAAVRNVHVQGSLTNTGNKLDMALVGKGWFQIEGADGEPLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG  + P I IP +  E+ V++SGQ+ A     +D Q +GQL +ANF 
Sbjct: 120 FNTNATGQLVTVDGFPVTPAITIPADAVEVIVNKSGQVFARIDGQADLQELGQLTLANFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IG+NL   T  SG   I  P D GFA V+QGYLEASNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLAPIGNNLFRETPASGPATIGVPGDPGFATVEQGYLEASNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI AADEM++ +T+
Sbjct: 240 YEMNSKVITAADEMAATVTQ 259


>gi|224417699|ref|ZP_03655705.1| flagellar basal body rod protein FlgG [Helicobacter canadensis MIT
           98-5491]
 gi|253827048|ref|ZP_04869933.1| flagellar distal rod protein FlgG [Helicobacter canadensis MIT
           98-5491]
 gi|253510454|gb|EES89113.1| flagellar distal rod protein FlgG [Helicobacter canadensis MIT
           98-5491]
          Length = 263

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GM  QQ  +++ +NNI+N+NT GY++ RAEFAD  +Q  + AG  S +++ 
Sbjct: 2   MRALYTATTGMLGQQLQIDVTSNNISNVNTFGYRKERAEFADLFHQVLQYAG--SSTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+ +SV+ +++QG    T NNLD+A+ G G+FQ+E PD T+ YTR GS
Sbjct: 60  TLSPTGIEVGLGVRPTSVQKIFSQGNFKETENNLDIAITGNGFFQIELPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G +V + G  LVP I IP++  +I +   G +  V G  ++   +GQ+   NFI
Sbjct: 120 FKLDDEGNVVNSQGYLLVPNITIPDDATQINIGTDGTVSVVQGNETEVNELGQIETVNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T+ SGDPI+  P   GF  ++QG++E SNV  V+E++++I  QRA
Sbjct: 180 NPAGLHALGDNLYLNTNASGDPIVGTPGLNGFGQLRQGFVETSNVKLVEEMTDLIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M  ++ +++
Sbjct: 240 YEANSKSIQTADSMLQIVNQLK 261


>gi|268317781|ref|YP_003291500.1| flagellar basal-body rod protein FlgG [Rhodothermus marinus DSM
           4252]
 gi|262335315|gb|ACY49112.1| flagellar basal-body rod protein FlgG [Rhodothermus marinus DSM
           4252]
          Length = 262

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 168/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA GM+AQQTN++ IA+N+AN NTTG+K AR  F D LYQ  +  G   + A+ 
Sbjct: 2   LRALRTAALGMNAQQTNVDNIAHNLANANTTGFKNARVVFQDLLYQTVQTPGQ--EEAEG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +GSGV + +    +TQG +V TGN LDLA+ G G+FQ+  PD T++YTR G+
Sbjct: 60  LTPPASLQLGSGVAVVATVRQFTQGSLVETGNALDLAINGDGFFQIRRPDGTIVYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +++ G  VT  G  L P + +P +T EI +S+ G +       ++   +G+L +A F 
Sbjct: 120 FTLNADGTFVTQTGLPLEPELSVPPDTIEIHISQDGVVSVRLQGETESVEIGRLELARFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR IG NL  +T  SG PI+  P + GF  VKQG+LEA+NVD V+E+  +I+AQRA
Sbjct: 180 NPAGLRAIGGNLYEQTEASGFPILGAPGEEGFGTVKQGFLEAANVDVVQEMVNLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK++   +EM    ++M+
Sbjct: 240 YEINSKMVTTTEEMLQTASQMK 261


>gi|242309754|ref|ZP_04808909.1| flagellar basal body rod protein FlgG [Helicobacter pullorum MIT
           98-5489]
 gi|239523755|gb|EEQ63621.1| flagellar basal body rod protein FlgG [Helicobacter pullorum MIT
           98-5489]
          Length = 263

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GM  QQ  +++ +NNI+N+NT GY++ RAEFAD  +Q  + AG  S +++ 
Sbjct: 2   MRALYTATTGMLGQQLQIDVTSNNISNVNTFGYRKERAEFADLFHQVLQYAG--SSTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+ +SV+ +++QG    T NNLD+A+ G G+FQ+E PD T+ YTR GS
Sbjct: 60  TLSPTGIEVGLGVRPTSVQKIFSQGNFKETENNLDIAITGNGFFQIELPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G +V + G  LVP I IP++  ++ +   G +  V G  ++   +GQ+   NFI
Sbjct: 120 FKLDDEGNVVNSQGYLLVPNITIPDDATQVNIGTDGTVTVVQGNETEVNELGQIETVNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T+ SGDPI+  P   GF  ++QG++E SNV  V+E++++I  QRA
Sbjct: 180 NPAGLHALGDNLYLNTNASGDPIVGTPGLNGFGQLRQGFVETSNVKLVEEMTDLIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M  ++ +++
Sbjct: 240 YEANSKSIQTADSMLQIVNQLK 261


>gi|269792757|ref|YP_003317661.1| flagellar basal-body rod protein FlgG [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100392|gb|ACZ19379.1| flagellar basal-body rod protein FlgG [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 262

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++    A GM AQQTNL+++++N+AN+NT G+K+ RA+F D +YQ ++  G+P + A  
Sbjct: 2   IRSLWSGATGMIAQQTNLDVVSHNLANVNTAGFKKLRADFQDLMYQIDREPGAPVEPASM 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI +G G ++S    +  QG +  TGN  D+A+ G G+FQV  PD TV YTR G+
Sbjct: 62  --VPNGIQVGLGSRVSGTSRIMGQGNMQVTGNPTDVAIEGDGFFQVTMPDGTVAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           + ID  GQ+VTADG  L P + +P   +EI +S +GQ+  +   + + Q +GQ+ +A F+
Sbjct: 120 WRIDGNGQIVTADGYLLEPAVTVPNNAKEIIISPTGQVSVLLPGDQNPQEIGQIQLARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL+ +G NL   T  SG PI+ NP + G     Q  LE +NV  V+E+  MI AQRA
Sbjct: 180 NPGGLKALGKNLFIETPASGAPIVGNPGEEGLGTTIQRTLEMANVQVVEEMVNMIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  ADE+  +   +R
Sbjct: 240 YEANSKTIATADELLRIANNLR 261


>gi|296283228|ref|ZP_06861226.1| flagellar basal body rod protein FlgG [Citromicrobium bathyomarinum
           JL354]
          Length = 261

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 123/262 (46%), Positives = 175/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  GM AQQTN+++I+NNIAN+NTTG+KR RA+F D LYQ     G+ S   + 
Sbjct: 1   MRSLSIAGTGMLAQQTNVDVISNNIANMNTTGFKRQRAQFQDLLYQQVSRPGASSAGPE- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A  P GI IG+GV+   V  +  QG +V T N  DLA+ G G+FQV+ P   + YTR G+
Sbjct: 60  ARAPTGIQIGAGVRTGGVYRIAEQGALVQTDNRFDLAIQGLGYFQVQMPTGEIGYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G+LVT+ G  + PGI IP+   ++ VSR+G++       ++ Q VGQ+ +A F+
Sbjct: 120 FQLSDQGELVTSQGLVVEPGITIPQGAVDVAVSRTGEVQIKIAGETEMQTVGQIELATFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL   GDNL   T+ SG+P I+ P + GF  V QG++EASNV+ V EI+ +I+AQRA
Sbjct: 180 NEAGLEAKGDNLFLATAASGEPTIAAPGEPGFGSVAQGFVEASNVNPVAEITALITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNS+V++ ADEM    +++R
Sbjct: 240 YEMNSRVVKTADEMLGTTSQLR 261


>gi|238796906|ref|ZP_04640410.1| Flagellar basal-body rod protein flgG [Yersinia mollaretii ATCC
           43969]
 gi|238719166|gb|EEQ10978.1| Flagellar basal-body rod protein flgG [Yersinia mollaretii ATCC
           43969]
          Length = 260

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLEAQQTNMDVISNNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   +++QG +  T N+ DLA+ G G+FQV+  D T  Y+R GS
Sbjct: 60  TTIPTGLQLGTGVRPVATERIHSQGNLTQTNNSKDLAIQGHGFFQVQMADGTTAYSRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT+ G  + P I IP++   + V   G +       +  Q VGQL ++ FI
Sbjct: 120 FQFDQNGQLVTSSGYPVQPAITIPQDADTLTVGNDGIVSVTVPGQTAPQQVGQLTVSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL +IG+NL   T  SG P  + P   G   +KQGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESIGENLYRETQSSGAPNETTPGLNGGGTLKQGYIETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQRLTQL 260


>gi|115523179|ref|YP_780090.1| flagellar basal body rod protein FlgG [Rhodopseudomonas palustris
           BisA53]
 gi|115517126|gb|ABJ05110.1| flagellar basal-body rod protein FlgG [Rhodopseudomonas palustris
           BisA53]
          Length = 262

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 143/260 (55%), Positives = 187/260 (71%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GMSAQQ N+E+IANNIANINTT YKR+RAEF D  YQ +++ G P++  + 
Sbjct: 1   MRSLAIAATGMSAQQLNVEVIANNIANINTTSYKRSRAEFTDLFYQIDRMQGVPNRVGEG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV PEG  +G GV+ ++VR ++ QG +  TGN  DLA+ GRGWFQV  P+   +YTRAG+
Sbjct: 61  AV-PEGAKLGLGVRSAAVRKLHLQGALAQTGNAYDLAVNGRGWFQVVGPNGDTLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++  QLVTADG  + P I+IPE T ++ V+ SGQ+ A        + +GQL +ANF 
Sbjct: 120 FNTNADAQLVTADGYKVDPTILIPEGTAQVTVNESGQVYAKLDTEVTPRLLGQLTLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG P++  P DIGF  + Q YLE+SNVD VKEI+E+ISAQR+
Sbjct: 180 NEAGLDPLGSNLYKETIASGTPVVGFPGDIGFGKIHQHYLESSNVDPVKEITELISAQRS 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI+AADEM+S I+K
Sbjct: 240 YEMNSKVIQAADEMASTISK 259


>gi|30248324|ref|NP_840394.1| flagellar basal body rod protein FlgG [Nitrosomonas europaea ATCC
           19718]
 gi|30138210|emb|CAD84218.1| Flagella basal body rod protein [Nitrosomonas europaea ATCC 19718]
          Length = 260

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 162/260 (62%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  I+  G+ AQQT +++IANN+ANI+T G+KR R  F D LYQ  +  G  +QS+++ 
Sbjct: 3   RSLWISKTGLDAQQTKMDVIANNLANISTNGFKRMRPVFEDLLYQTIRQPG--AQSSERT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV+  +  N++ QG +  TGN  D+A+ G G+FQ+  PD T+ YTR G+F
Sbjct: 61  RLPSGLQLGTGVRPVATENIFLQGNLQQTGNTRDVAIQGEGFFQILLPDGTLAYTRDGAF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             D  GQ+VTA G  L P I IP  T  I + R G +  +T  ++   PVG + +  FIN
Sbjct: 121 QSDQDGQMVTASGFPLQPSITIPPNTLNITIGRDGTVSVLTPGSALPVPVGNIQLTTFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+  G+NL   T  SG P    P   G   + QG++E SNV+ V+E+ EMI  QRAY
Sbjct: 181 PAGLQRFGENLYLETMSSGVPNPGIPGTNGIGLLNQGFVETSNVNVVEELVEMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NS+ I  +D+M + +T++
Sbjct: 241 EINSRSISTSDQMLARLTQL 260


>gi|292492365|ref|YP_003527804.1| flagellar basal-body rod protein FlgG [Nitrosococcus halophilus
           Nc4]
 gi|291580960|gb|ADE15417.1| flagellar basal-body rod protein FlgG [Nitrosococcus halophilus
           Nc4]
          Length = 261

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 110/259 (42%), Positives = 159/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  IA  G+ AQQT + +I+NN+AN+NTTG+KR RA F D LYQ  +  G  +QS+   
Sbjct: 3   QALWIAKTGLDAQQTRMAVISNNLANVNTTGFKRGRAVFEDLLYQTVRQPG--AQSSQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV+  +   +++QG +  T N LDLA+ GRG+FQ+  PD ++ YTR G+F
Sbjct: 61  QLPSGLMLGTGVRTVATEKLFSQGGIAQTENPLDLAIQGRGFFQILMPDGSLAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +D+ GQLVT+ G  + P I IPE    + V   G +  +   ++    +G + +A+FIN
Sbjct: 121 QVDADGQLVTSSGYPVEPRITIPEGALSVTVGSDGIVSVLVAGDTAPTQLGNVQLADFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG+NL   T+ SG      P   GF  + QG LE +NV+ V+E+  MI  QRAY
Sbjct: 181 PAGLQPIGNNLFKETASSGVAQTGIPGLTGFGTLVQGALEGANVNVVEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I   DEM    T+
Sbjct: 241 EMNSKAIAGTDEMLQFATQ 259


>gi|237750021|ref|ZP_04580501.1| flagellar distal rod protein FlgG [Helicobacter bilis ATCC 43879]
 gi|229374432|gb|EEO24823.1| flagellar distal rod protein FlgG [Helicobacter bilis ATCC 43879]
          Length = 262

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 102/262 (38%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A  GM  QQ  ++  +NNIAN+NT G+KR RAEF D  YQ  + AG  +Q+++ 
Sbjct: 2   MRSLYTATTGMLGQQLQIDTTSNNIANVNTVGFKRQRAEFNDLFYQTLQFAG--TQTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+  ++  +Y+QG    T N LD+A++G+G+F ++ PD  + YTR+G+
Sbjct: 60  TLTPTGIEVGVGVRTGAINRIYSQGSPKETENPLDVAIMGKGFFPIQLPDGNIAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G +VT++G  + P I +P E + I +   G +    G N   + +GQ+ + NF+
Sbjct: 120 FKLDDQGNIVTSEGYLVQPQITVPPEAQSINIGADGTVSVTLGNNGQAEVLGQIQLVNFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T+ SG+PI       G   ++ G+LE SNV  V E++++I+ QRA
Sbjct: 180 NPAGLHGLGDNLYMNTNASGEPIEGIAGQDGLGQIRAGFLELSNVRLVSEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADSMLQTVNGLK 261


>gi|119953549|ref|YP_945759.1| flagellar basal body rod protein FlgG [Borrelia turicatae 91E135]
 gi|119862320|gb|AAX18088.1| flagellar basal-body rod protein FlgG [Borrelia turicatae 91E135]
          Length = 264

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 110/264 (41%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +K AG+P  + + 
Sbjct: 2   MRALWTAASGMKAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQKRAGTP--ATED 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G  +G G ++S+   ++ QG +  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TVSPLGNQVGHGTKVSATHRIFEQGNLQATNLKTDVAIEGDGFYKILLPDGTYGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV--SRSGQILAVTGKNSDFQPVGQLLIAN 178
           F ID+ G LVT+ G  L+P I  PEE  +  +  S+ G I      + D   +GQ+ IA 
Sbjct: 120 FKIDANGDLVTSQGYKLLPEISFPEEYIKDSIIISQEGIISVKVDGSPDPIELGQMEIAR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG+N+   T  SG+ I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLNAIGNNIFKETIGSGEEISGTPGSSGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|261840277|gb|ACY00043.1| flagellar basal body rod protein FlgG [Helicobacter pylori 52]
          Length = 262

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 180/262 (68%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++R +F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRTDFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+ G+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDVAITGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SG+ I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGEAIVGNPDSQGLGKLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|15887898|ref|NP_353579.1| flagellar basal body rod protein FlgG [Agrobacterium tumefaciens
           str. C58]
 gi|20141428|sp|Q44338|FLGG_AGRT5 RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|15155490|gb|AAK86364.1| flagellar basal-body rod protein [Agrobacterium tumefaciens str.
           C58]
          Length = 262

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 152/263 (57%), Positives = 207/263 (78%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTGYKRARAEF D LYQ E++ G P++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLYQTERMQGVPNR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG +IG GVQ S+VRN++TQG ++ TGN LD+A++G+GWFQ+E  D + +Y+RAG+
Sbjct: 60  AIVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQIEAADGSTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G LVT DG  ++P I IP + ++I ++R+GQ+ A  G  +DF  +GQL IANF 
Sbjct: 120 FNKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGNAADFTQLGQLTIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL ++T  SG P++  PDD  + +VKQ YLE SNVDAVKEI+++I+AQRA
Sbjct: 180 NEAGLKPLGDNLFSQTPASGAPVVGVPDDPSYGYVKQSYLEGSNVDAVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|296274032|ref|YP_003656663.1| flagellar basal-body rod protein FlgG [Arcobacter nitrofigilis DSM
           7299]
 gi|296098206|gb|ADG94156.1| flagellar basal-body rod protein FlgG [Arcobacter nitrofigilis DSM
           7299]
          Length = 263

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 106/262 (40%), Positives = 170/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +K    AA+GM AQQ  +++ +NNI+N+NT G+K+ RAEF D +YQ     G    ++  
Sbjct: 2   IKGMYTAASGMYAQQHQIDVTSNNISNVNTAGFKKDRAEFEDLMYQRLNYTG--GSTSQD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +GSGV+IS ++  + +G++  TGN+LD+A+ G+G+F+V  P+    YTR G 
Sbjct: 60  TRNPTGIDVGSGVRISGIQKSFEEGDLEPTGNDLDIAIEGKGFFRVTLPNGETAYTRNGQ 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++S G +V  +G  L P IVIP+   +I +S  G I A      + Q VGQ+ +++F+
Sbjct: 120 FKVNSDGSIVNGNGYLLDPEIVIPDNLTKINISNDGLITATDPTTQEEQEVGQITLSDFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +G++L   T+ SGDPI +NP +  F +++QG++E SNV  V E+ ++I+AQRA
Sbjct: 180 NPAGLAPMGESLFRATTASGDPIDANPTEEQFGNLRQGFVEMSNVKLVSEMVDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD++ ++  +++
Sbjct: 240 YEANSKAIQTADKLLTIANQLK 261


>gi|237752808|ref|ZP_04583288.1| flagellar basal-body rod protein distal rod protein [Helicobacter
           winghamensis ATCC BAA-430]
 gi|229376297|gb|EEO26388.1| flagellar basal-body rod protein distal rod protein [Helicobacter
           winghamensis ATCC BAA-430]
          Length = 263

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 168/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GM  QQ  +++ +NNI+N+NT GY++ RAEFAD  +Q  + AG  S +++ 
Sbjct: 2   MRALYTATTGMLGQQLQIDVTSNNISNVNTFGYRKERAEFADLFHQVLQYAG--SSTSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+ ++V+ +++QG    T  NLD+A+ G G+FQ+E PD T+ YTR GS
Sbjct: 60  TLSPTGIEVGLGVRPTAVQKIFSQGNFKETEQNLDVAITGNGFFQIELPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D +G +V A G  LVP I IP++  +I + + G +  V G  ++   +GQ+   NFI
Sbjct: 120 FKRDDEGNVVNAQGYLLVPNITIPDDATQINIGKDGTVTVVQGNETEVNQLGQIETVNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T+ SGDPI+  P   GF  + QG++E SNV  V+E++++I  QRA
Sbjct: 180 NPAGLHALGDNLYLNTNASGDPIVGTPGLNGFGQLAQGFVETSNVKLVEEMTDLIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M  ++ +++
Sbjct: 240 YEANSKSIQTADSMLQIVNQLK 261


>gi|300311354|ref|YP_003775446.1| flagellar basal-body rod protein FlgG [Herbaspirillum seropedicae
           SmR1]
 gi|300074139|gb|ADJ63538.1| flagellar basal-body rod FlgG protein [Herbaspirillum seropedicae
           SmR1]
          Length = 260

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT L++I+NN+AN++T G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLDAQQTQLDVISNNLANVSTNGFKRSRAVFEDLLYQTVRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG V  T N+ DLA+ G G+FQ+  PD T  YTR G+
Sbjct: 60  TQLPSGLQIGTGVRPVATERIFTQGNVNQTNNDKDLAIQGNGFFQILLPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS+GQLVT+ G TL P I +P  T ++ V R G +  +   ++    +G + +A FI
Sbjct: 120 FQTDSQGQLVTSSGYTLQPPITVPLNTTKLTVGRDGVVSIMQAGSTATTQIGTIQVATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G+NL   T+ SG P  +NP   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLESRGENLYMETAASGAPNPNNPGTNGAGALWQGYVETSNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + ++++
Sbjct: 240 YEINSKAITTSDQMLAKLSQL 260


>gi|150395485|ref|YP_001325952.1| flagellar basal body rod protein FlgG [Sinorhizobium medicae
           WSM419]
 gi|150027000|gb|ABR59117.1| flagellar basal-body rod protein FlgG [Sinorhizobium medicae
           WSM419]
          Length = 262

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 158/263 (60%), Positives = 209/263 (79%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQ NLE+IANNIANINTTGYKRARAEF+D LYQ E+  G P++S ++
Sbjct: 1   MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLYQTERAQGVPNRS-NQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  IG GVQ S+VRN++ QG +V+TGN+ DLALVGRGWFQ+ETPD   +YTR+G+
Sbjct: 60  AIVPEGAIIGLGVQTSAVRNLHIQGSLVNTGNDYDLALVGRGWFQIETPDGETVYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG T+VPG+ +P++  EI  + SGQ++   G +++ Q +GQL +ANF+
Sbjct: 120 FNTNATGQLVTIDGYTVVPGVTVPQDATEIVFTSSGQVMVRIGNDTELQEIGQLTVANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G+NL  +T  SGD I+  P D GFA +KQ YLE+SNVD VKEI+++ISAQRA
Sbjct: 180 NEAGLEPMGENLFRQTPASGDAIVGTPADPGFAQIKQNYLESSNVDPVKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSK+I+AADEM++ ++  +R
Sbjct: 240 YEMNSKIIQAADEMAATVSKNLR 262


>gi|317013400|gb|ADU84008.1| flagellar basal body rod protein FlgG [Helicobacter pylori
           Lithuania75]
          Length = 262

 Score =  238 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 181/262 (69%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A +GM AQQT+++  +NNIAN+NTTG+K++RA+F D  YQA + AG  + +++ 
Sbjct: 2   LRSLYSATSGMLAQQTHIDTTSNNIANVNTTGFKKSRADFNDLFYQAMQYAG--TNTSNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P+G+ +G GV+ S++  +++QG    T NNLD+A+ G+G+FQV+ PD T  YTR+G+
Sbjct: 60  TLSPDGMEVGLGVRPSAITKMFSQGSPKETENNLDVAITGKGFFQVQLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +G LVT++G  L+P I +PE+T ++ +   G +    G  +    +GQ+ +ANF+
Sbjct: 120 FKLDEQGNLVTSEGYLLIPQITLPEDTTQVNIGVDGTVSVTQGLQTTSNVIGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL + T+ SG+ I+ NPD  G   ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHSMGDNLFSITNASGNAIVGNPDSQGLGKLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNSLK 261


>gi|160901817|ref|YP_001567398.1| flagellar basal-body rod protein FlgG [Petrotoga mobilis SJ95]
 gi|160359461|gb|ABX31075.1| flagellar basal-body rod protein FlgG [Petrotoga mobilis SJ95]
          Length = 261

 Score =  238 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 114/260 (43%), Positives = 170/260 (65%), Gaps = 3/260 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +   AA GM+A+Q  L+II+NN+AN++TTGYK+ RAEF D LY + K AG+P+  A  + 
Sbjct: 4   SLYNAATGMNAEQRKLDIISNNLANVDTTGYKKQRAEFQDLLYSSVKEAGTPT--AQGST 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G G ++++   ++T G +  T N+ D+A++G G+FQV+  D ++ YTR GSF 
Sbjct: 62  LPTGLYVGHGTRLAATTRIFTLGNIEPTDNSTDIAIMGDGFFQVQMQDGSIAYTRDGSFK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +D+ G+L T+DG  ++P IVIP+ +  I VS  G +    G  +  Q VG L    F+N 
Sbjct: 122 LDANGRLTTSDGLMVIPNIVIPQNSVGINVSPDGIVSVSLGDGT-IQNVGNLTTVRFLNP 180

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG+NL + T  SG+P    P   GF  ++QGYLE SNVD VKE+ +MI AQRAY+
Sbjct: 181 GGLKPIGNNLYSETPASGNPTEGIPGQDGFGALQQGYLEKSNVDVVKEMVDMIVAQRAYD 240

Query: 243 MNSKVIEAADEMSSLITKMR 262
           +NSK I  ADEM   ++ ++
Sbjct: 241 INSKTITTADEMLRTVSNVK 260


>gi|319944133|ref|ZP_08018411.1| flagellar basal-body rod protein FlgG [Lautropia mirabilis ATCC
           51599]
 gi|319742627|gb|EFV95036.1| flagellar basal-body rod protein FlgG [Lautropia mirabilis ATCC
           51599]
          Length = 260

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I++N+AN++T GYKR++A F D +YQ  +  G  +QS+  
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISHNLANVSTNGYKRSQAVFEDLIYQNMRQVG--AQSSAD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG +  T N+ DLA+ G G+FQ++ PD T  YTR GS
Sbjct: 60  TQLPTGLQLGTGVRPVATSRLFTQGNLQQTSNSFDLAISGHGFFQLQMPDGTTGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ D++GQLV ++G  L P I IP  TR++ V   G +            +GQ+ +A F 
Sbjct: 120 FHPDAQGQLVNSNGMPLSPPITIPPGTRDVTVGNDGTVSVTIAGQEGVTQIGQIQLATFQ 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G N+   +  SG P  + P   G   ++QGYLE SNV+ V+E+  MI  QRA
Sbjct: 180 NAAGLDPQGQNVFKESDASGTPTAATPGVNGAGLLQQGYLETSNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I+ +D+M + I+++
Sbjct: 240 YEINSKAIQTSDQMLARISQL 260


>gi|83312594|ref|YP_422858.1| flagellar basal body rod protein FlgG [Magnetospirillum magneticum
           AMB-1]
 gi|82947435|dbj|BAE52299.1| Flagellar basal body rod protein [Magnetospirillum magneticum
           AMB-1]
          Length = 261

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 119/262 (45%), Positives = 166/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GM AQQTN+E+I+NNIAN+NTT + R R EFAD LYQ  +  GS S S   
Sbjct: 1   MRSLNIAATGMLAQQTNVEVISNNIANMNTTAFTRRRPEFADLLYQNLRRVGSQS-SDTG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ ++V  +  QG V  T N LD+A+ G+G+FQ++ P     YTR GS
Sbjct: 60  TIVPTGVQLGLGVKTTAVYRITEQGSVQSTDNTLDMAIQGKGYFQIKLPSGETAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G +VT +G  ++P + IP +   + V  +GQ++         Q  GQL +A F 
Sbjct: 120 FQLSPEGTIVTHEGYQVIPQVTIPSDAVGVTVDSTGQVIVKQDGQVQSQIKGQLTLATFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL   G NL   T  SG P++  P   GF  + QG+LE SNV+ V E++ +I AQRA
Sbjct: 180 NDAGLEARGGNLFMETPASGQPVVQTPGKPGFGTILQGFLETSNVNVVAEVTNLIGAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+A+DEM S I +M+
Sbjct: 240 YEMNSKVIQASDEMLSTINQMK 261


>gi|254505064|ref|ZP_05117215.1| flagellar basal-body rod protein FlgG [Labrenzia alexandrii DFL-11]
 gi|222441135|gb|EEE47814.1| flagellar basal-body rod protein FlgG [Labrenzia alexandrii DFL-11]
          Length = 262

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 136/260 (52%), Positives = 187/260 (71%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQ N+E++ANNIAN+NTT +KRA+AEF+D LYQAE++ G P++  + 
Sbjct: 1   MKALAIAATGMSAQQLNVEVVANNIANMNTTSFKRAQAEFSDLLYQAERLQGVPNRGGED 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V PEG  +G GV+ + +R ++ QG + +TGN  D+AL GRGWF++  PD   +YTRAGS
Sbjct: 61  PV-PEGAQLGLGVKTAGIRKLHMQGPLTNTGNQFDIALDGRGWFEITGPDDESLYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G+LVT DG T+ P I++PEET E+ ++ +GQ+ +        + +GQL +ANF 
Sbjct: 120 FNKNADGRLVTIDGYTVEPAIIVPEETIEVVINETGQVYSKIDGEIQPREIGQLSLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL  +G NL   T  SG P+   P D GF  V+QGYLE+SNVD VKEI+ +ISAQR 
Sbjct: 180 NDVGLEPVGGNLFRETPASGAPVAGVPGDPGFGVVRQGYLESSNVDPVKEITALISAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKV++AADEM++ +T 
Sbjct: 240 YEMNSKVMKAADEMANTVTN 259


>gi|152980126|ref|YP_001353113.1| FlgG flagellar basal body rod protein [Janthinobacterium sp.
           Marseille]
 gi|151280203|gb|ABR88613.1| FlgG flagellar basal body rod protein [Janthinobacterium sp.
           Marseille]
          Length = 260

 Score =  238 bits (606), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I+NN+AN++T+G+KR+RA F D LYQ  +  G  + S+ +
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISNNLANVSTSGFKRSRAVFEDLLYQNIRQPG--AASSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  T N+ D+A++G G+FQV  PD T  YTR GS
Sbjct: 60  TQLPSGLQIGTGVRPVATERIHTQGNLQLTSNSKDMAILGDGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D++GQ+VT+ G  + P IVIP     I +SR G +       +    VG L +A FI
Sbjct: 120 FQTDNQGQMVTSSGFPIQPAIVIPANATAISISRDGIVSVTVPGTTAQTEVGALQVATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G+NL   T+ SG+P  +NP   G  +V+Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLESKGENLYVETTASGNPTTNNPGTNGAGYVQQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAISTSDQMLQRLTQL 260


>gi|284007173|emb|CBA72457.1| flagellar basal-body rod protein FlgG [Arsenophonus nasoniae]
          Length = 260

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  S ++++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVISNNLANVSTNGFKRGRAVFQDLMYQTLRQPG--SLTSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G+ +G+GV+  + + +++QG +  T  + D+A+ G+G+F ++ PD T  YTR G+
Sbjct: 60  TLSPSGLQLGTGVRPIATQRLHSQGNLSQTNGSTDVAIKGQGFFHIQLPDGTDAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D   Q VTA G  +VP IV+PE   ++ +S  G +  V   NS+ Q VGQL +  F+
Sbjct: 120 FQVDQNNQRVTAGGFAVVPPIVLPETALKVTISHDGIVSVVIPGNSEPQQVGQLALTTFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL +IG+NL   T+ SG P+ + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NETGLESIGENLYLETNSSGVPVETAPGVNGAGLLYQGYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   + ++
Sbjct: 240 YEINSKAVSTSDQMLQRLMQL 260


>gi|294635612|ref|ZP_06714089.1| flagellar basal-body rod protein FlgG [Edwardsiella tarda ATCC
           23685]
 gi|291091064|gb|EFE23625.1| flagellar basal-body rod protein FlgG [Edwardsiella tarda ATCC
           23685]
          Length = 260

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLYIAKTGLEAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVTLPDGSQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     + + R G +       +  Q VGQL ++ FI
Sbjct: 120 FQVDQNGQLVTASGFQVSPAITIPANATSMTIGRDGIVSVTVQGQAAAQQVGQLTLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESVGENLYQETDSSGAPTESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAISTSDQMLQRLTQL 260


>gi|92114096|ref|YP_574024.1| flagellar basal-body rod FlgG [Chromohalobacter salexigens DSM
           3043]
 gi|91797186|gb|ABE59325.1| Flagellar basal-body rod FlgG [Chromohalobacter salexigens DSM
           3043]
          Length = 260

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A  G+ +QQ  L++I+NN++N++T G+KR+R  F D LYQ  +  G+ + + D 
Sbjct: 2   IRSLWTAKTGLESQQVKLDVISNNLSNVSTNGFKRSRPVFEDLLYQNVRQPGAQASAVD- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG + +T N+ DLA+ G+G+F V+ PD T  YTR GS
Sbjct: 61  -TLPSGLQVGTGVRPVATERLHTQGGLQNTDNSKDLAINGQGFFAVQMPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  GQ+VTA G  L P IVIPE    + +S+ G +      ++  Q VGQL ++ FI
Sbjct: 120 FQIDENGQMVTAGGYPLDPPIVIPENALSVSISQDGVVSVTQPGDTAAQEVGQLTLSKFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+++G+NL   T  SG      P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQSMGENLYQETDASGPRNDLIPGMEGAGRLYQGYVETSNVNVVEEMVSMIETQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +E +D+M S +T++
Sbjct: 240 YEINSKAVETSDQMLSRLTQL 260


>gi|269138584|ref|YP_003295284.1| flagellar basal body rod protein [Edwardsiella tarda EIB202]
 gi|267984244|gb|ACY84073.1| flagellar basal body rod protein [Edwardsiella tarda EIB202]
 gi|304558594|gb|ADM41258.1| Flagellar basal-body rod protein FlgG [Edwardsiella tarda FL6-60]
          Length = 260

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLYIAKTGLEAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVTLPDGSQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     + + R G +       +  Q VGQL ++ FI
Sbjct: 120 FQVDQNGQLVTASGFQVTPAITIPANATSMTIGRDGIVSVTLQGQAAAQQVGQLTLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESVGENLYQETESSGAPTESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAISTSDQMLQRLTQL 260


>gi|90021853|ref|YP_527680.1| flagellar basal body rod protein FlgG [Saccharophagus degradans
           2-40]
 gi|89951453|gb|ABD81468.1| Flagellar basal-body rod FlgG [Saccharophagus degradans 2-40]
          Length = 261

 Score =  237 bits (605), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 108/258 (41%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T L  IANN+AN +T G+KR RA F D LYQ ++  G  +Q+ ++  
Sbjct: 4   ALYVSKTGLAAQDTRLTTIANNLANASTVGFKRDRAVFEDLLYQIQRQPG--AQTTEETQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   +  +T G +  TG +LD+A+ GRG+  V  PD TV YTR G F+
Sbjct: 62  LPSGLQLGTGVRVVGTQKQFTPGSLQVTGQSLDVAIDGRGFIPVLQPDGTVSYTRDGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +D +GQ+V A G  + P I IP+    + +   G + A          +G L I +F+N 
Sbjct: 122 LDGQGQVVNASGLLIQPAITIPDNAETVTIGTDGVVSASVRGEPAPVVLGNLQIVDFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG NL   T+ SG+PI   P + G   +KQG LE SNVD V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGGNLFLETASSGNPIQGTPGENGLGSIKQGMLENSNVDIVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+  +D+M   IT+
Sbjct: 242 MNSKVVSTSDQMLQFITQ 259


>gi|315636319|ref|ZP_07891569.1| flagellar basal-body rod protein FlgG [Arcobacter butzleri JV22]
 gi|315479408|gb|EFU70091.1| flagellar basal-body rod protein FlgG [Arcobacter butzleri JV22]
          Length = 262

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 99/262 (37%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++    AA GM+A Q  +++ +NNIAN+NTTG+K+ RAEF D +Y++     +  ++   
Sbjct: 2   IRGLYTAATGMNAMQHQIDVTSNNIANVNTTGFKKDRAEFQDLMYESLNY--TAGRTTQT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+IS+++  +T+G++  TGN LD+A+ G+G+FQ+  P     Y+R G+
Sbjct: 60  TLNPTGIDVGLGVRISNIQKEFTEGDLKSTGNPLDIAIAGKGFFQITLPSGETAYSRNGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++ +G +V  +G  L P IV+P   ++I V   G + A   +  D   +GQ+ +A+FI
Sbjct: 120 FKLNEEGTIVNGNGYPLQPEIVVPNNVKDISVGTDGLVTAKDPQTGDTIELGQITLADFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GD+L  ++  SG  +  +P    F  +KQ  LE+SNV  V E+ ++I+AQRA
Sbjct: 180 NPAGLTPLGDSLFMQSEASGPVVEGDPTTEQFGSLKQSMLESSNVKLVNEMVDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  AD M  ++ +++
Sbjct: 240 YEANSKAITTADNMLDIVNRLK 261


>gi|253990125|ref|YP_003041481.1| flagellar basal-body rod protein flgg [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781575|emb|CAQ84738.1| flagellar basal-body rod protein flgg (distal rod protein)
           [Photorhabdus asymbiotica]
          Length = 260

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  + S+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T NN  +A+ G+G+FQV+ PD +  YTR GS
Sbjct: 60  TRLPSGLQIGTGVRPVATERIHSQGNLSGTNNNHHVAIRGKGFFQVQLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVTA+G  + P I IP+   +I +S  G +       S  Q VGQ  +  FI
Sbjct: 120 FQEDQNGQLVTANGFLVFPTITIPDNATDIAISSDGVVSVKVQGQSAPQQVGQFTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL +IG+NL   TS SG PI + P   G   ++  YLE SNV+  +E+  MI  QRA
Sbjct: 180 NENGLESIGENLYVETSSSGVPIENTPGINGAGLLQHKYLETSNVNIAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEVNSKAVSTSDQMLQKLTQL 260


>gi|300871597|ref|YP_003786470.1| flagellar basal-body rod protein FlgG [Brachyspira pilosicoli
           95/1000]
 gi|300689298|gb|ADK31969.1| flagellar basal-body rod protein, FlgG [Brachyspira pilosicoli
           95/1000]
          Length = 264

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/264 (42%), Positives = 164/264 (62%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA+GM+  Q   + IANN+AN+NT GYK+ RA+F D +YQ  K+ G+P  + + 
Sbjct: 2   LRSLWTAASGMNGMQFKTDTIANNLANVNTIGYKKVRADFEDLIYQNLKIQGTP--ATED 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G+  G GV+ ++ + ++ QG +  TGN LDLAL G G+FQV  PD +V YTR GS
Sbjct: 60  TVTPVGLQTGLGVKSAATQKMFDQGSLQATGNKLDLALEGEGFFQVLMPDGSVSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F +D+ GQLVT++G  LVP I+ PE     +I +SR G +    G  ++   +G + +  
Sbjct: 120 FKVDANGQLVTSNGYKLVPEIIFPENFLVEKINISREGVVSVTIGDENEPVELGNITLHR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           FIN+AGL +IGDNL   T  SG          GF  + QG++E SNV  V E+ +MI AQ
Sbjct: 180 FINQAGLLSIGDNLYKETIASGPAFEGEAGSKGFPRIHQGFVEMSNVKVVDEMVDMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYEMNSK ++ +D + + +  ++
Sbjct: 240 RAYEMNSKAVQTSDNLLATVVNLK 263


>gi|193222346|emb|CAL62046.2| Flagellar basal-body rod protein FlgG (Distal rod protein)
           [Herminiimonas arsenicoxydans]
          Length = 260

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 161/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++I+NN+AN++TTG+KR+RA F D LYQ  +  G  + S+ +
Sbjct: 2   IRSLWISKTGLDAQQTQMDVISNNLANVSTTGFKRSRAVFEDLLYQTIRQPG--AASSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG +  T N  +LA+ G G+FQV  PD T  YTR GS
Sbjct: 60  TELPSGLQLGTGVRPVATERIHTQGNLQLTSNAKNLAIEGDGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D++GQ+VT+ G  + P I IPE    I +SR G +       +    +G L +A FI
Sbjct: 120 FQTDNQGQMVTSSGFPIQPAITIPENATSITISRDGIVSVTVSGTTAATEIGALQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G+NL   T+ SG    + P   G   +KQ Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLMSRGENLYVETTASGTANTNTPGSNGAGLLKQNYVETSNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAITTSDQMLQRLTQI 260


>gi|253996317|ref|YP_003048381.1| flagellar basal-body rod protein FlgG [Methylotenera mobilis JLW8]
 gi|253982996|gb|ACT47854.1| flagellar basal-body rod protein FlgG [Methylotenera mobilis JLW8]
          Length = 260

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++I+NN+AN++T G+KR+RA F D LYQ  +  G  +Q++ +
Sbjct: 2   IRSLWISKTGLDAQQTQMDVISNNLANVSTNGFKRSRAVFEDLLYQTIRQPG--AQTSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG +  TGN+ D+A+ G G+FQV  PD T  YTR G+
Sbjct: 60  TQLPSGLQLGTGVRPVATERIFTQGNIQQTGNDKDVAIQGAGFFQVLLPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +GQLVT+ G ++ P I +P   + + V R G +      ++    +GQL +A FI
Sbjct: 120 FQVDFQGQLVTSSGFSVQPPITVPSNAQTLTVGRDGTVSVTLAGSTAVTQIGQLQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+  G+NL   T+ SG    + P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQGNGENLYVETAASGTANANTPGTNGAGLLTQGYVETSNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T+M
Sbjct: 240 YEINSKAITTSDQMLQKLTQM 260


>gi|313672412|ref|YP_004050523.1| flagellar basal-body rod protein flgg [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939168|gb|ADR18360.1| flagellar basal-body rod protein FlgG [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 262

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 161/261 (61%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A   AA+GM+AQQ N++ IANN+AN+N  G+K++R  F D LYQ  + AG P+  A   
Sbjct: 3   RAMWTAASGMTAQQMNIDNIANNLANVNNIGFKKSRIHFEDLLYQEMRPAGGPT--AAGI 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P GI IG G ++ +   ++ QG    TGN LD+A+ G G+FQV  PD T+ YTR GSF
Sbjct: 61  NHPTGIQIGLGTKVVATEKIFGQGNFQQTGNQLDIAIEGDGFFQVTMPDGTIGYTRNGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +DS G +VTA+G  L P I +PE    I + + G +      +++   +G + +A FIN
Sbjct: 121 KLDSNGNIVTAEGYLLEPAIAVPENATSIIIGQDGTVSVTIPGDTNPTELGAIELARFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+NIG NL   T+ SG+P+   P    F  V QG LE SNV+  +E+  MI+ QRAY
Sbjct: 181 PSGLKNIGRNLYQPTAASGEPVTGAPGTDAFGTVAQGILEMSNVNVAEEMVNMITGQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK I+ +DEM  ++  ++
Sbjct: 241 ELNSKAIQTSDEMLQVVNNLK 261


>gi|325291939|ref|YP_004277803.1| flagellar basal body rod protein FlgG [Agrobacterium sp. H13-3]
 gi|325059792|gb|ADY63483.1| flagellar basal body rod protein FlgG [Agrobacterium sp. H13-3]
          Length = 262

 Score =  237 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 151/263 (57%), Positives = 206/263 (78%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTGYKRARAEF D LYQ E++ G P++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLYQTERMQGVPNR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG +IG GVQ S+VRN++TQG ++ TGN LD+A++G+GWFQ+E  D + +Y+RAG+
Sbjct: 60  AIVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQIEAADGSTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G LVT DG  ++P I IP + ++I ++R+GQ+ A  G  +DF  +GQL IANF 
Sbjct: 120 FNKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGNAADFTELGQLTIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL ++T  SG  +I  PDD  + ++KQ YLE SNVDAVKEI+++I+AQRA
Sbjct: 180 NEAGLKPLGDNLFSQTPASGAAVIGVPDDPSYGYIKQSYLEGSNVDAVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|23015788|ref|ZP_00055555.1| COG4786: Flagellar basal body rod protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 261

 Score =  237 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 119/262 (45%), Positives = 166/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GM AQQTN+E+I+NNIAN+NTT + R R EFAD LYQ  +  GS S S   
Sbjct: 1   MRSLNIAATGMLAQQTNVEVISNNIANMNTTAFTRRRPEFADLLYQNLRRVGSQS-SDTG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ ++V  +  QG V  T N LD+A+ G+G+FQ++ P     YTR GS
Sbjct: 60  TIVPTGVQLGLGVKTTAVYRITEQGSVQSTDNTLDMAVQGKGYFQIKLPSGETAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G +VT +G  ++P + IP +   + V  +GQ++         Q  GQL +A F 
Sbjct: 120 FQLSPEGTIVTHEGYQVIPQVTIPSDAVGVTVDSTGQVIVKQDGQVQSQIKGQLTLATFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL   G NL   T  SG P++  P   GF  + QG+LE SNV+ V E++ +I AQRA
Sbjct: 180 NDAGLEARGGNLFMETPASGQPVVQTPGKPGFGTILQGFLETSNVNVVAEVTNLIGAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+A+DEM S I +M+
Sbjct: 240 YEMNSKVIQASDEMLSTINQMK 261


>gi|238764394|ref|ZP_04625344.1| Flagellar basal-body rod protein flgG [Yersinia kristensenii ATCC
           33638]
 gi|238697420|gb|EEP90187.1| Flagellar basal-body rod protein flgG [Yersinia kristensenii ATCC
           33638]
          Length = 260

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N  D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNTKDVAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP    ++ + R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTASGFQVQPAITIPANALKMTIGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESVGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|157738176|ref|YP_001490860.1| flagellar distal rod protein FlgG [Arcobacter butzleri RM4018]
 gi|157700030|gb|ABV68190.1| flagellar distal rod protein FlgG [Arcobacter butzleri RM4018]
          Length = 262

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 101/262 (38%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++    AA GM+A Q  +++ +NNIAN+NTTG+K+ RAEF D +Y++     +  ++   
Sbjct: 2   IRGLYTAATGMNAMQHQIDVTSNNIANVNTTGFKKDRAEFQDLMYESLNY--TAGRTTQT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+IS+++  +T+G++  TGN LD+A+ G+G+FQ+  P     Y+R G+
Sbjct: 60  TLNPTGIDVGLGVRISNIQKEFTEGDLKSTGNPLDIAIAGKGFFQITLPSGETAYSRNGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++ +G +V  +G  L P IV+P   ++I V   G + A   +  D   +GQ+ +A+FI
Sbjct: 120 FKLNEEGTIVNGNGYPLQPEIVVPNNVKDISVGTDGLVTAKDPQTGDTIELGQITLADFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GD+L  ++  SGD I  +P    F  +KQ  LE+SNV  V E+ ++I+AQRA
Sbjct: 180 NPAGLTPLGDSLFMQSEASGDVIEGDPTTEQFGSLKQSMLESSNVKLVNEMVDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  AD M  ++ +++
Sbjct: 240 YEANSKAITTADNMLDIVNRLK 261


>gi|238755322|ref|ZP_04616665.1| Flagellar basal-body rod protein flgG [Yersinia ruckeri ATCC 29473]
 gi|238706458|gb|EEP98832.1| Flagellar basal-body rod protein flgG [Yersinia ruckeri ATCC 29473]
          Length = 260

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNSKDIAIKGQGFFQVQLPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I V R G +       +  Q VGQL +  FI
Sbjct: 120 FQMDQNGQLVTASGFQVQPAITIPANALSITVGRDGIVSVTQQGQTAAQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T+ SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESVGENLYQETASSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVTTSDQMLQKLTQL 260


>gi|225619854|ref|YP_002721111.1| flagellar basal body rod protein FlgG [Brachyspira hyodysenteriae
           WA1]
 gi|225214673|gb|ACN83407.1| flagellar basal body rod protein FlgG [Brachyspira hyodysenteriae
           WA1]
          Length = 264

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 115/263 (43%), Positives = 164/263 (62%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA+GM+  Q   + IANN+AN+NT GYK+ RA+F D +YQ  K+ G+P  + +  
Sbjct: 3   RSLWTAASGMNGMQFKTDTIANNLANVNTIGYKKVRADFEDLIYQNLKIQGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           V P G+  G GV+ ++ + ++ QG +  TGN LDLAL G G+FQV  PD +V YTR GSF
Sbjct: 61  VTPVGLQTGLGVKSAATQKMFDQGSLQATGNKLDLALEGEGFFQVLMPDGSVSYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            ID+ GQLVT++G  LVP IV PE     +I +SR G +    G  +D   +GQ+ +  F
Sbjct: 121 KIDANGQLVTSNGYRLVPEIVFPENFLVEQISISREGIVSVKIGDENDPVEIGQITLHRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN+ GL +IGDNL   T  SG      P   GF  + QG++E SNV  V E+ +MI AQR
Sbjct: 181 INQPGLLSIGDNLYKETIASGPAFEGEPGANGFPRIHQGFVEMSNVKVVDEMVDMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYEMNSK ++ +D + + +  ++
Sbjct: 241 AYEMNSKAVQTSDNLLATVVNLK 263


>gi|46578928|ref|YP_009736.1| flagellar basal body rod protein FlgG [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603471|ref|YP_967871.1| flagellar basal body rod protein FlgG [Desulfovibrio vulgaris DP4]
 gi|46448340|gb|AAS94995.1| flagellar basal-body rod protein FlgG [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563700|gb|ABM29444.1| flagellar basal-body rod protein FlgG [Desulfovibrio vulgaris DP4]
 gi|311232786|gb|ADP85640.1| flagellar basal-body rod protein FlgG [Desulfovibrio vulgaris RCH1]
          Length = 260

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 102/262 (38%), Positives = 160/262 (61%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ N+++I++N+AN+NT+G+K++RAEF D +YQ  ++AGS ++   +
Sbjct: 2   MRSLWTAATGMVAQQLNIDVISHNLANVNTSGFKKSRAEFEDLMYQNMRIAGSATEGDSR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+ ++V   ++QG+  ++GN LD+A+ G G+FQV        YTRAG+
Sbjct: 62  --IPVGIQVGMGVRPTAVHKFFSQGDFQNSGNPLDIAIEGDGFFQVLVN-GEPRYTRAGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G  L P   +P ET+ + V+ +G I A+     +      + +  FI
Sbjct: 119 FKLNQDGTVVTANGYVLQPEFTVPAETKNVVVTEAGHIAALDANGQELAAA-DIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   +  SG+ +   P +     + QG+LE SNV+ V E+  MI  QRA
Sbjct: 178 NPAGLDAIGRNLYVPSEASGEAVEGVPGEDNVGTLAQGFLEMSNVEVVDEMVNMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK I  +D+M      ++
Sbjct: 238 YEMNSKAISTSDQMLQTAVNLK 259


>gi|300114797|ref|YP_003761372.1| flagellar basal-body rod protein FlgG [Nitrosococcus watsonii
           C-113]
 gi|299540734|gb|ADJ29051.1| flagellar basal-body rod protein FlgG [Nitrosococcus watsonii
           C-113]
          Length = 261

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 112/259 (43%), Positives = 159/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  IA  G+ AQQT +  I+NN+AN+NTTG+KR RA F D LYQ  +  G  +QS+   
Sbjct: 3   QALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPG--AQSSQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           ++P G+ +G+GV+  +   ++TQG +  TGN+LD+A+ GRG+FQV  PD ++ YTR G+F
Sbjct: 61  LLPSGLMLGTGVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQVLMPDGSLAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            ID+ GQLVT+ G  + PGI IP+    + V   G +  +   +      G L +A+FIN
Sbjct: 121 QIDANGQLVTSSGYPVQPGITIPQSALSVTVGSDGIVSVLMPGDGTPVQAGNLQLADFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+  G+NL   T+ SG      P   G   + QG LE +NV+ V+E+  MI  QRAY
Sbjct: 181 PAGLQPTGNNLFKETAASGVAQTGIPGLNGIGTLVQGALEGANVNVVEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I + DEM    T+
Sbjct: 241 EMNSKAISSTDEMLRFATQ 259


>gi|83647171|ref|YP_435606.1| flagellar basal body rod protein FlgG [Hahella chejuensis KCTC
           2396]
 gi|83635214|gb|ABC31181.1| Flagellar basal body rod protein [Hahella chejuensis KCTC 2396]
          Length = 261

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 108/258 (41%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T L+ I+NN+AN+NTTG+KR RA F D LYQ ++  G   QS+    
Sbjct: 4   ALWVSKTGLAAQDTALKTISNNLANVNTTGFKRDRAVFQDLLYQIKRQPG--GQSSQDTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   + V+++G +  T   LD+A+ GRG+FQ+  PD T+ YTR G F+
Sbjct: 62  LPSGLQLGTGVRVVGTQKVFSEGNLEVTEQPLDIAINGRGFFQILMPDGTISYTRDGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S G +VTA+G  L PGI +P+    + +S  G +       +    VG +   +FIN 
Sbjct: 122 LNSDGDVVTANGFPLEPGITVPDGALHLTISTDGVVSVTVAGTATPTQVGNINTVDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG+NL   T+ SGDP    P   G   V+QG +E SNV+ V+E+  MI+ QRAYE
Sbjct: 182 AGLEAIGNNLFRETAASGDPQEGTPGLAGLGTVEQGMVETSNVEIVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+  AD+M   IT+
Sbjct: 242 MNAKVVTTADQMLQYITQ 259


>gi|297538898|ref|YP_003674667.1| flagellar basal-body rod protein FlgG [Methylotenera sp. 301]
 gi|297258245|gb|ADI30090.1| flagellar basal-body rod protein FlgG [Methylotenera sp. 301]
          Length = 260

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++IANN+AN++T G+KR+RA F D LYQ  +  G  +Q++ +
Sbjct: 2   IRSLWISKTGLDAQQTQMDVIANNLANVSTNGFKRSRAVFEDLLYQNIRQPG--AQTSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   +++QG +  T NN D+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  TQLPSGLQLGTGVRPVATERIFSQGNLQQTSNNKDVAIQGAGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS+GQLVT+ G  + P I +P       V R G +   T  ++    +G L +A FI
Sbjct: 120 FQTDSQGQLVTSSGFPVQPAITVPANAESFTVGRDGTVSITTTGSTATTQIGTLQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+  G+NL   T+ SG+P ++NP   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NTAGLQGKGENLFVETTASGNPTVNNPGTNGAGLLTQGYVETSNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T+M
Sbjct: 240 YEINSKAITTSDQMLQKLTQM 260


>gi|315453484|ref|YP_004073754.1| flagellar basal-body rod protein [Helicobacter felis ATCC 49179]
 gi|315132536|emb|CBY83164.1| flagellar basal-body rod protein [Helicobacter felis ATCC 49179]
          Length = 262

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 116/262 (44%), Positives = 173/262 (66%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A  GM  QQT+++  +NNIAN+NT G+K+ RA+F D  YQA + AG  + ++D 
Sbjct: 2   LRSLYSATTGMLGQQTHIDTTSNNIANVNTVGFKKQRADFNDLFYQALQYAG--TSTSDT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ SSV  +++QG    T NNLD+A+ G+G+FQ++ PD +  YTRAG+
Sbjct: 60  TKSPNGIEVGLGVRTSSVTKMFSQGSPKETENNLDIAITGKGFFQIQMPDGSTAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID +G +VT +G  L+P I  P++T +I +   G +    G  S    +GQ+ +ANFI
Sbjct: 120 FKIDDQGNMVTTEGYLLIPQITFPQDTTQISIGVDGTVSVTQGNASTSNVIGQITLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNLLA TS SG  I+ NP+  G+  ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHALGDNLLAVTSASGPAIVGNPNGDGYGQLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKTIQTADNMLQTVNSLK 261


>gi|222053732|ref|YP_002536094.1| flagellar basal-body rod protein FlgG [Geobacter sp. FRC-32]
 gi|221563021|gb|ACM18993.1| flagellar basal-body rod protein FlgG [Geobacter sp. FRC-32]
          Length = 262

 Score =  236 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQ N++++ANN+AN+NTTG+K++RA+F D +YQ+ K +G+PS +A  
Sbjct: 2   IRALWTAASGMQAQQLNIDVVANNLANVNTTGFKKSRADFHDLMYQSMKTSGAPSTNA-- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G G + ++V  ++T G V  TGN LD+A+ G G+FQ++ PD +  YTRAG+
Sbjct: 60  TQIPTGIQVGLGSKPAAVTKIFTTGNVTQTGNELDVAIEGDGFFQIQMPDGSTEYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS+G++VT++G  L+P +VIP  T  I +   G +  +    +    VG + +A F 
Sbjct: 120 FKKDSQGRVVTSEGYPLLPEVVIPNNTTSITIGNDGTVSVIQSGQTSPTSVGTIQLATFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G NL   T  SG          G   + QGYLE SNV   +E+  MI  QRA
Sbjct: 180 NPAGLSSQGHNLFKETESSGAATTGTSGQNGIGTLSQGYLEMSNVSVAEEMVNMIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK ++AADEM      ++
Sbjct: 240 YEINSKAVQAADEMLQTANNLK 261


>gi|317492426|ref|ZP_07950855.1| flagellar basal-body rod protein FlgG [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919765|gb|EFV41095.1| flagellar basal-body rod protein FlgG [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 260

 Score =  236 bits (601), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLYIAKTGLEAQQTNMDVIANNLANVSTNGFKRQRAVFEDLMYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTDNSRDVAIKGQGFFQVQQPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  +VP I IP    ++ + R G +       +    VGQL +  FI
Sbjct: 120 FQVDQNGQLVTSSGFQVVPAITIPANATKLTIGRDGIVSVNQQGQTATTQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESVGENLYQETESSGAPTESTPGLNGAGMLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVTTSDQMLQRLTQL 260


>gi|94500243|ref|ZP_01306776.1| flagellar basal-body rod protein FlgG [Oceanobacter sp. RED65]
 gi|94427542|gb|EAT12519.1| flagellar basal-body rod protein FlgG [Oceanobacter sp. RED65]
          Length = 261

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 166/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   L  I+NN+AN++TTG+K+ RA F D +YQ ++  G  + S+  + 
Sbjct: 4   ALWVSKTGLNAQDHGLTTISNNLANVSTTGFKKDRAVFEDLIYQIQRQPG--ALSSQDSR 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+++  + ++T G +  T   LDLA+ GRG+FQ+  PD  + YTR G+F+
Sbjct: 62  LPSGLQLGTGVKVAGTQKIHTTGSLEETSQPLDLAINGRGFFQIALPDGQIAYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +D++G +V + G  L P I IP++T  + +SR G +      ++  Q +GQ+ + +FIN 
Sbjct: 122 MDAEGNIVNSQGYLLEPNITIPDQTNTMTISRDGIVSVTQFGDTTPQEIGQIDVVDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ +G NL   T+ SG P I    + GF  ++QG+LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 TGLQAVGGNLFLETAASGAPEIGVASEDGFGSIEQGFLENSNVKVVEEMVKMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+ +AD+M   + +
Sbjct: 242 MNSKVVSSADQMLQYLAQ 259


>gi|71906393|ref|YP_283980.1| flagellar basal body rod protein FlgG [Dechloromonas aromatica RCB]
 gi|71846014|gb|AAZ45510.1| Protein of unknown function DUF1078 [Dechloromonas aromatica RCB]
          Length = 260

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT L++I+NN+AN++T G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWIARTGLDAQQTQLDVISNNLANVSTNGFKRSRAVFEDLLYQTLRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S  +++TQG +  T N LD+A+ G G+FQ+  PD T  YTR GS
Sbjct: 60  TQIPTGLQLGTGVRPVSTAHIFTQGNLQKTDNTLDIAVQGNGFFQILLPDGTTGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D++GQ+VT+DG  L P I IP     + V   G +      ++    +G + +A FI
Sbjct: 120 FQKDNQGQIVTSDGYPLQPNITIPSNALSVSVGTDGTVSVTQSGSAATTQIGSIQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL++ G NL   T+ SG P  + P   G   V QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NPAGLQSAGQNLFLETAASGTPTPNTPGSNGAGIVNQGYVETSNVNVAEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSKV+  +D M   +T++
Sbjct: 240 YELNSKVVSTSDAMLGRLTQL 260


>gi|83594175|ref|YP_427927.1| flagellar basal body rod protein FlgG [Rhodospirillum rubrum ATCC
           11170]
 gi|83577089|gb|ABC23640.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 261

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 124/262 (47%), Positives = 167/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  I A GM AQQTN+E+I+NNIAN+NTT Y R RAEF D LYQ  + AGS S S   
Sbjct: 1   MRALNIGATGMLAQQTNVEVISNNIANMNTTAYTRRRAEFHDLLYQNLRRAGSNS-SDTG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ ++V  +  QG V  T N LDLA+ G+G+FQ++ P     YTR G+
Sbjct: 60  TIVPTGVQLGLGVKTAAVYRITEQGSVTSTNNALDLAIQGKGYFQIDLPSGETAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +   G++VT DG  +     IP     I ++ +G++L      +     GQ+  A F 
Sbjct: 120 FQLSPNGEIVTHDGYRVTGLGAIPTNAESITINPTGEVLYKIDGQTALVNAGQIQTAIFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IGDN L  T+ SG P +  P  +GF  + QGYLE+SNV+ V EI+E+ISAQRA
Sbjct: 180 NDAGLNAIGDNYLTETAGSGAPTVGVPGSVGFGTILQGYLESSNVNVVSEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  +DEM S I++M+
Sbjct: 240 YEMNSKVITTSDEMLSTISRMK 261


>gi|118589981|ref|ZP_01547385.1| Flagellar basal-body rod FlgG [Stappia aggregata IAM 12614]
 gi|118437478|gb|EAV44115.1| Flagellar basal-body rod FlgG [Stappia aggregata IAM 12614]
          Length = 262

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 132/260 (50%), Positives = 184/260 (70%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQ N+E++ANNIAN+NTT +KR++AEF+D LYQAE++ G P++  + 
Sbjct: 1   MKALAIAATGMSAQQMNVEVVANNIANMNTTSFKRSQAEFSDLLYQAERLQGVPNRGGED 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V PEG  +G GV+ + +R ++ QG + +TGN  D+AL GRGWF++  PD   ++TRAGS
Sbjct: 61  PV-PEGAQLGLGVRTAGIRKLHAQGSLTNTGNQFDVALDGRGWFEITGPDDETLFTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G+LVT DG  + P I++P+ET E+ V+ SGQ+ A        + +GQL ++NF 
Sbjct: 120 FNKNADGRLVTIDGYPVEPAIIVPQETIEVVVNESGQVFAKVDGEMAPRELGQLTLSNFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL  +G NL   T  SG P+     D GF  ++QGYLE+SNVD VKEI+ +ISAQR 
Sbjct: 180 NDVGLEPVGGNLFRETEASGSPVSGVAGDPGFGVIRQGYLESSNVDPVKEITALISAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKV++AADEM+  +T 
Sbjct: 240 YEMNSKVMKAADEMAGTVTN 259


>gi|121596119|ref|YP_988015.1| flagellar basal-body rod protein FlgG [Acidovorax sp. JS42]
 gi|222112274|ref|YP_002554538.1| flagellar basal-body rod protein flgg [Acidovorax ebreus TPSY]
 gi|120608199|gb|ABM43939.1| flagellar basal-body rod protein FlgG [Acidovorax sp. JS42]
 gi|221731718|gb|ACM34538.1| flagellar basal-body rod protein FlgG [Acidovorax ebreus TPSY]
          Length = 260

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M +  IA  GM+AQQT L++I++N+AN++TTG+KR  A F D +YQ  +  G  SQ+ ++
Sbjct: 2   MNSLWIAKTGMTAQQTQLDVISHNLANVSTTGFKRNNAVFEDLIYQNLRQVG--SQTTEE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV + +    +TQG +  +GN+LD+A+ G G+F+V+ PD T  YTR G+
Sbjct: 60  NQLPTGLHLGLGVNVVATSRNFTQGSLQQSGNSLDVAIDGNGFFEVQLPDGTTGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G++VT+ G  + PGI +P + + I +S  G +      N + Q +GQL +++FI
Sbjct: 120 FKLDSQGRVVTSSGLPVAPGITVPADAKSISISERGMVSVTVAGNPNPQQIGQLGMSSFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +G NL   ++ SG P  + P   G   +KQG+LE SNV+ V+E+  MI  QRA
Sbjct: 180 NSAGLEPVGQNLYRESAASGAPQQAEPGTNGLGIIKQGFLENSNVNVVEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + ++++
Sbjct: 240 YEMNSKAIQTSDQMLAKLSQL 260


>gi|77165836|ref|YP_344361.1| hypothetical protein Noc_2373 [Nitrosococcus oceani ATCC 19707]
 gi|254434083|ref|ZP_05047591.1| flagellar basal-body rod protein FlgG [Nitrosococcus oceani AFC27]
 gi|76884150|gb|ABA58831.1| conserved hypothetical protein [Nitrosococcus oceani ATCC 19707]
 gi|207090416|gb|EDZ67687.1| flagellar basal-body rod protein FlgG [Nitrosococcus oceani AFC27]
          Length = 261

 Score =  235 bits (600), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 112/259 (43%), Positives = 159/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  IA  G+ AQQT +  I+NN+AN+NTTG+KR RA F D LYQ  +  G  +QS+   
Sbjct: 3   QALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPG--AQSSQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           ++P G+ +G+GV+  +   ++TQG +  TGN+LD+A+ GRG+FQ+  PD ++ YTR G+F
Sbjct: 61  LLPSGLMLGTGVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQILMPDGSLAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            ID+ GQLVT+ G  + PGI IPE    + V   G +  +   +      G L +A+FIN
Sbjct: 121 QIDANGQLVTSSGYPVQPGITIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+  G+NL   T+ SG      P   G   + QG LE +NV+ V+E+  MI  QRAY
Sbjct: 181 PAGLQPTGNNLFKETASSGVAQTGIPGLNGIGTLVQGALEGANVNVVEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I + DEM    T+
Sbjct: 241 EMNSKAISSTDEMLRFATQ 259


>gi|222084865|ref|YP_002543394.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84]
 gi|221722313|gb|ACM25469.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84]
          Length = 262

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 153/263 (58%), Positives = 201/263 (76%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTGYKR+RAEF+D LYQ E+  G  +   ++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRSRAEFSDLLYQTERAKG-IANRPNQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AVVPEG +IG GVQ ++VRN+  QGE+  T N+LD+ALVGRGWFQ++ PD T  YTRAGS
Sbjct: 60  AVVPEGANIGLGVQTTAVRNIQIQGELSQTSNDLDVALVGRGWFQIQMPDGTTAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN    GQ+VT DGN L PGI IP     + +++SGQ+ A  G  +    +GQL IANF+
Sbjct: 120 FNKSDTGQMVTPDGNVLQPGITIPSNASNVVINQSGQVSATIGTATTPTVLGQLQIANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +G NL  +T  SGDP++S+P++ GFA++KQGYLE+SNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLQPMGSNLFTQTPASGDPVVSDPNENGFAYMKQGYLESSNVDPVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  AD+M+ +++  ++
Sbjct: 240 YEMNSKVITTADDMAQIVSKNLK 262


>gi|296127366|ref|YP_003634618.1| flagellar basal-body rod protein FlgG [Brachyspira murdochii DSM
           12563]
 gi|296019182|gb|ADG72419.1| flagellar basal-body rod protein FlgG [Brachyspira murdochii DSM
           12563]
          Length = 264

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 115/263 (43%), Positives = 164/263 (62%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA+GM+  Q   + IANN+AN+NT GYK+ RA+F D +YQ  K+ G+P  + +  
Sbjct: 3   RSLWTAASGMNGMQFKTDTIANNLANVNTIGYKKVRADFEDLIYQNLKIQGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           V P G+  G GV+ +S + ++ QG +  TGN LDLAL G G+FQV  PD +V YTR GSF
Sbjct: 61  VRPVGLQTGLGVKSASTQKMFDQGSLQATGNKLDLALEGEGFFQVLMPDGSVSYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            ID+ GQ+VT++G  LVP IV PE     +I +SR G +    G  +D   +GQ+ +  F
Sbjct: 121 KIDANGQMVTSNGYRLVPEIVFPENFLVEQISISREGVVSVKIGDENDPVEIGQITLHRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN+ GL +IGDNL   T  SG      P   GF  + QG++E SNV  V E+ +MI AQR
Sbjct: 181 INQPGLLSIGDNLYKETIASGPAFEGEPGANGFPRIHQGFVEMSNVKVVDEMVDMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYEMNSK ++ +D + + +  ++
Sbjct: 241 AYEMNSKAVQTSDNLLATVVNLK 263


>gi|149194278|ref|ZP_01871375.1| flagellar basal-body rod protein distal rod protein [Caminibacter
           mediatlanticus TB-2]
 gi|149135453|gb|EDM23932.1| flagellar basal-body rod protein distal rod protein [Caminibacter
           mediatlanticus TB-2]
          Length = 262

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM AQQT +++++NNI+N+NT GYK+ RAEFAD  YQ  + AG+ + +    
Sbjct: 3   RSLYTAATGMMAQQTQIDVVSNNISNVNTIGYKKQRAEFADLFYQTMEYAGTATSTT--T 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P GI++G GV+ +++  ++TQG +  T NNLDLA+ G G+FQV+ PD  + YTR G+F
Sbjct: 61  KSPTGINVGLGVRPTAITKIFTQGNLKQTNNNLDLAIQGDGFFQVQLPDGRIGYTRDGAF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +D+ G +VT+DG  L+P I +P +T ++ +   G +  +    +  Q +GQ+ +A FIN
Sbjct: 121 KLDADGNIVTSDGYKLIPNITLPPDTVQVSIGTDGTVSILQAGQTQMQQIGQIQLAKFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL ++G NL   TS SGDPI+  P   G   ++QG++E SNV  V+E++++I+ QRAY
Sbjct: 181 PAGLHSLGSNLYINTSASGDPIVDVPGQTGLGEIRQGFIEMSNVQLVEEMTDLITGQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           +  SK I  +DEM   +  ++
Sbjct: 241 DAASKAIMTSDEMLQTVNNLK 261


>gi|58426792|gb|AAW75829.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 341

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 151/259 (58%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + +I+NN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 83  QALWVAKTGLDAQQTRMSVISNNLANTNTTGFKRDRAAFEDLLYQQVRAPG--GSTSAQT 140

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V+ PD T  YTR G+F
Sbjct: 141 QLPTGLQLGTGVRVVSTFKGFDQGSQQQTGRALDVMVNGRGFFEVQMPDGTSAYTRDGTF 200

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+++GQLVT  G  L PGI +PE  + + +   G I       +  Q +G L + +FIN
Sbjct: 201 QINAQGQLVTNSGYPLQPGIQVPEGAQSLTIGNDGTISVTLAGQAAAQEIGALTLTDFIN 260

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL++ G+NL   T+ SG      P   G  +  QG LE SNV+ V+E+  MI  QRAY
Sbjct: 261 PSGLQSKGENLFVETTASGPAQNGTPGLNGLGNTVQGALEGSNVNTVEELVSMIETQRAY 320

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 321 EMNAKAISTTDAMLGYLNN 339


>gi|332161324|ref|YP_004297901.1| flagellar basal-body rod protein FlgG [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318605244|emb|CBY26742.1| flagellar basal-body rod protein FlgG [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325665554|gb|ADZ42198.1| flagellar basal-body rod protein FlgG [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330860604|emb|CBX70901.1| flagellar basal-body rod protein flgG [Yersinia enterocolitica
           W22703]
          Length = 260

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N  D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNTKDVAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT+ G  + P I IP     + V R G +       +  Q VGQL +A FI
Sbjct: 120 FQTDQNGQLVTSGGFQIQPAITIPANAMSMTVGRDGIVSVTLPGQTATQQVGQLTLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESVGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|170741836|ref|YP_001770491.1| flagellar basal body rod protein FlgG [Methylobacterium sp. 4-46]
 gi|168196110|gb|ACA18057.1| flagellar basal-body rod protein FlgG [Methylobacterium sp. 4-46]
          Length = 262

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 141/260 (54%), Positives = 188/260 (72%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ NLE+IANN+AN+NTTG+K ARAEF D LYQAE+  G P+Q+  +
Sbjct: 1   MRALAIAATGMNAQQLNLEVIANNVANLNTTGFKGARAEFTDLLYQAERQQGVPNQTGQE 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV PEG  +G GV+ +++RN++ QG +  T NNLDLA+ GRG+FQV  P+  V YTRAGS
Sbjct: 61  AV-PEGALLGLGVRAAAIRNLHRQGPLAQTSNNLDLAINGRGYFQVTNPNGEVNYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN  S GQLVT +G  + P I+ P  T ++ +++SGQ+ A     +  Q +GQL IANF 
Sbjct: 120 FNKSSTGQLVTLEGYVVEPAILFPANTVDVVINQSGQVYAKVDGQATPQLLGQLSIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL  +G+ L   T+ SG P+     D GF  V+QGYLE+SNVD VKEI+ +I+AQRA
Sbjct: 180 NESGLEPLGNGLYRETAASGAPVTGVAGDTGFGKVQQGYLESSNVDPVKEITSLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +EMNSKVI+AADEM+  ++K
Sbjct: 240 FEMNSKVIQAADEMAGTVSK 259


>gi|192361762|ref|YP_001982398.1| flagellar basal body rod protein FlgG [Cellvibrio japonicus
           Ueda107]
 gi|190687927|gb|ACE85605.1| flagellar basal-body rod protein FlgG [Cellvibrio japonicus
           Ueda107]
          Length = 261

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   L  I+NN+AN+ T G+KR RA F D LYQ ++  G  +Q   +  
Sbjct: 4   ALYVSKTGLAAQDRQLATISNNLANVATVGFKRDRAIFEDLLYQNQRQPG--AQETQETQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++ + +  +T+G +  T   LD+A+ GRG+ QV  PD T+ YTR G   
Sbjct: 62  LPSGLQLGTGVRVVATQKEFTEGNIQVTEQALDVAIDGRGFLQVLLPDGTIAYTRNGQLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++ +GQ+V ADG  L P I++PE   +I +  +G + A     +D Q +G + + +FIN 
Sbjct: 122 LNGEGQVVNADGYLLEPAIIVPEGVNKITIGSNGTVNAFAPGVADPQQLGDITLTDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL+ IG NL   T  SG+P+   P + G   +KQG LE+SNVD V+E+  MI+ QRAYE
Sbjct: 182 SGLQAIGGNLFLETPASGNPVQGIPGENGMGSLKQGMLESSNVDIVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+  AD+M   IT+
Sbjct: 242 MNSKVVSTADQMLQYITQ 259


>gi|227112523|ref|ZP_03826179.1| flagellar basal body rod protein FlgG [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 260

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G+GV+  S   ++TQG    TGN+ D+A+ G+G+FQV+ PD T  YTR G+
Sbjct: 60  TMLPSGLQLGTGVRPVSTERIHTQGTFSETGNSKDVAIKGQGFFQVQLPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I +P    E+ + R G +       +    +GQL +  FI
Sbjct: 120 FQLDGNGQLVTSSGYQVQPAITVPANATELNIGRDGIVSVKVQGQAATNQIGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL +IG+NL   T+ SG P  +NP   G   + Q Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESIGENLYLETASSGAPNETNPGLNGAGLLYQKYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I ++D+M   +T++
Sbjct: 240 YEINSKAISSSDQMLQKLTQL 260


>gi|251789170|ref|YP_003003891.1| flagellar basal-body rod protein FlgG [Dickeya zeae Ech1591]
 gi|247537791|gb|ACT06412.1| flagellar basal-body rod protein FlgG [Dickeya zeae Ech1591]
          Length = 260

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 112/261 (42%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG    TGN  DLA+ G G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVATERIHTQGSFSETGNVKDLAIKGAGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS GQLVT+ G  + P I IP  +  + V R G +       +    +GQL +A FI
Sbjct: 120 FQQDSNGQLVTSSGFQVQPVITIPANSSNLTVGRDGVVTVTQQGQAAPVQIGQLNLAMFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL N+G+NL A T+ SG P  S P   G   + Q ++E SNV+  +E+  MI  QRA
Sbjct: 180 NEAGLENLGENLYAETASSGAPTQSTPGLNGAGLIYQKFVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I + D+M   +T++
Sbjct: 240 YEINSKAISSTDQMLQKLTQL 260


>gi|258592560|emb|CBE68869.1| Flagellar basal-body rod protein flgG (Distal rod protein) [NC10
           bacterium 'Dutch sediment']
          Length = 262

 Score =  235 bits (599), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   A AGM AQQ NL+ IANN+AN+NTTG+KR+R +F D  YQ  + AG  + +A  
Sbjct: 2   IRALFSAVAGMQAQQLNLDNIANNLANVNTTGFKRSRLDFQDLFYQTYRPAG--ASTASG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A +P GI +G G +  + + +Y QG+   T N LDL + G G+FQV  PD T+ YTRAGS
Sbjct: 60  AEIPVGIQVGHGSKPIASQRIYIQGDPQQTENPLDLMIEGDGFFQVLRPDGTIAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G++VT+DG  L P + IP +   I V   G + A     +  Q +G + ++ FI
Sbjct: 120 FKRDANGRVVTSDGFALQPEVSIPAQAMTIHVGSDGVVSATIPGQTASQQIGTIELSRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+++G NL   TS SGDP    P   G   + QG+LE SNV  V+E+  +I +QRA
Sbjct: 180 NPAGLQSVGRNLSLPTSASGDPTSGAPGTQGLGTIGQGFLELSNVKVVEEMVNLIMSQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE  SK ++AADEM  +   +R
Sbjct: 240 YEAGSKAVQAADEMLQVSNNIR 261


>gi|328545505|ref|YP_004305614.1| flagellar basal-body rod protein FlgG [polymorphum gilvum
           SL003B-26A1]
 gi|326415246|gb|ADZ72309.1| Flagellar basal-body rod protein FlgG [Polymorphum gilvum
           SL003B-26A1]
          Length = 262

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 137/260 (52%), Positives = 184/260 (70%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQ N+E+IANNIAN+NTT YKRARAEF+D LYQAE++ G P++  + 
Sbjct: 1   MKALAIAATGMSAQQLNVEVIANNIANMNTTAYKRARAEFSDLLYQAERLQGVPNRGGED 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V PEG  +G GV+ +++R ++ QG + +T N LDLA+ GRGWFQV  P+   +YTRAGS
Sbjct: 61  PV-PEGAQLGLGVKTAAIRKLHMQGTLTNTDNKLDLAIDGRGWFQVTGPEGETLYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN +++G+LVT DG  + P I+ P +T +I ++ SGQ+ A      + + +GQL + NF 
Sbjct: 120 FNKNAEGRLVTLDGYGIEPAILFPPDTVDIIINESGQVFAQVAGELNPRELGQLALTNFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL  +G NL   T  SG  +     D GF  ++QGY EASNVD VKEI+E+ISAQR 
Sbjct: 180 NDVGLEPVGGNLFRETPASGIGLDGVAGDPGFGVIRQGYQEASNVDPVKEITELISAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI+AAD+M+  +TK
Sbjct: 240 YEMNSKVIQAADDMAGTVTK 259


>gi|238794000|ref|ZP_04637618.1| Flagellar basal-body rod protein flgG [Yersinia intermedia ATCC
           29909]
 gi|238726632|gb|EEQ18168.1| Flagellar basal-body rod protein flgG [Yersinia intermedia ATCC
           29909]
          Length = 260

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N  D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNTKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTSGGFQVQPAITIPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL +IG+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESIGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|296103609|ref|YP_003613755.1| Flagellar basal-body rod protein, FlgG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058068|gb|ADF62806.1| Flagellar basal-body rod protein, FlgG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 260

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQ N+++I+NN+AN+NT G+KR RA F D LYQ  +  G  +QS ++
Sbjct: 2   IRSLWIAKTGLEAQQLNMDVISNNLANVNTNGFKRQRAVFQDLLYQNMRQPG--AQSTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S + V+TQG +  TG+  D+A+ G G+FQV+ PD +  YTR G 
Sbjct: 60  NTLPSGLQLGTGVRPVSTQRVHTQGGMNQTGDEYDVAIEGEGFFQVQMPDGSTAYTRDGH 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+    GQLV A+G  + PGIVIP++  ++ +   G +       ++ Q +GQL +  F+
Sbjct: 120 FSKSPDGQLVNAEGYPIQPGIVIPQDATKLNIGSDGIVSVKVPGQAEEQQIGQLTLTTFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL +IG NL   T  SG P   NP       +KQ Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NNAGLESIGGNLYKETQSSGAPNELNPGMESAGTLKQSYVEISNVNVAEELVTMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   ++++
Sbjct: 240 YEINSKAVSASDQMLQRLSQL 260


>gi|297616912|ref|YP_003702071.1| flagellar basal-body rod protein FlgG [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144749|gb|ADI01506.1| flagellar basal-body rod protein FlgG [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 261

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 104/263 (39%), Positives = 160/263 (60%), Gaps = 5/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   ++ GM AQQ N++ IA+NIAN+NTTGYK++R EF D +YQ  +       + D 
Sbjct: 2   LRALYTSSTGMFAQQLNIDNIAHNIANVNTTGYKKSRVEFQDLIYQMLRRP----VANDT 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVM-YTRAG 119
            V P G+ +G GV+ S+ + +++QG +  T N LD+A+ G+ +F+V++P      YTR G
Sbjct: 58  TVQPSGLWVGLGVKPSATQTIFSQGNLTPTDNPLDVAIQGQAFFRVQSPTNEEYLYTRDG 117

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
           SF +DS+G LVT DG  +V    I  E  ++ ++  G +        +    GQ+ +A F
Sbjct: 118 SFKLDSEGNLVTTDGYYVVGVDTIDPEGYDVTIAPDGTVTYKMPGQDEPVEAGQVELAKF 177

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
            N AGL  IG NL   T+ SG+ I  +P+      +  GYLEA+N+  V+E+  +I+AQR
Sbjct: 178 TNPAGLEKIGGNLYRPTASSGEAIDWDPEADTTVSLHAGYLEAANIQIVEEMVNLITAQR 237

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE+NSKVI++ADEM  +   +R
Sbjct: 238 AYEINSKVIQSADEMLGMAANLR 260


>gi|302390533|ref|YP_003826354.1| flagellar basal-body rod protein FlgG [Thermosediminibacter oceani
           DSM 16646]
 gi|302201161|gb|ADL08731.1| flagellar basal-body rod protein FlgG [Thermosediminibacter oceani
           DSM 16646]
          Length = 268

 Score =  235 bits (598), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 105/270 (38%), Positives = 160/270 (59%), Gaps = 12/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A++GM AQQ N+++I+NN+AN+NTTGYK++R EF D LY+  +    P      
Sbjct: 2   MRALWSASSGMLAQQLNVDVISNNLANVNTTGYKKSRVEFKDLLYETLRR---PDVFQPG 58

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ +G GV+ +S    +T+G +  TGN  DLA+ G G+F VE PD +  +TR GS
Sbjct: 59  QGNPVGLQVGHGVRPASTTRFFTEGNLQQTGNTFDLAIEGEGFFVVERPDGSRAFTRDGS 118

Query: 121 FNIDSKG---QLVTADGNTL----VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQ 173
           F +   G    LVT++G  +       I IPE+  +I +S +G I        + + +G 
Sbjct: 119 FKVSIDGDDRYLVTSEGYYVLDTDEDYISIPEDLTDINISANGTITGRDADG-NIEEIGT 177

Query: 174 LLIANFINEAGLRNIGDNLLARTSVSGDPIIS-NPDDIGFAHVKQGYLEASNVDAVKEIS 232
           + +A F+N  GL  +G+NL  +T+ SG+  +  +P++ GF  + QG+LE SNV  V E+ 
Sbjct: 178 IALARFLNPEGLLAVGNNLFEQTAASGEYQLKEDPNEPGFGTILQGFLEMSNVQVVDEMV 237

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
            +I AQRAYE+N+K I+ ADEM      +R
Sbjct: 238 NLIVAQRAYEINTKAIQTADEMLGQANNLR 267


>gi|187918627|ref|YP_001884192.1| flagellar basal body rod protein FlgG [Borrelia hermsii DAH]
 gi|119861475|gb|AAX17270.1| flagellar basal-body rod protein FlgG [Borrelia hermsii DAH]
          Length = 265

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 107/264 (40%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ ++ AG+P  + + 
Sbjct: 2   MRALWTAASGMKAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQRRAGTP--ATED 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G  +G G ++S+   ++ QG +  T  N D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TVSPLGNQVGHGTKVSATHRIFEQGNLQATNLNTDVAIEGNGFYKILLPDGTYGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F ID+ G LVT+ G  L+P I  PE   +    +S+ G I     ++ +   +GQ+ I  
Sbjct: 120 FKIDANGALVTSQGYKLLPDISFPEGYIKDSITISQEGIISVKVDESPEPIELGQMEIVR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG+N+   T  SG+ I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLNAIGNNIFKETIGSGEEISGTPGSDGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|114706771|ref|ZP_01439671.1| flagellar basal-body rod protein [Fulvimarina pelagi HTCC2506]
 gi|114537719|gb|EAU40843.1| flagellar basal-body rod protein [Fulvimarina pelagi HTCC2506]
          Length = 260

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 186/260 (71%), Gaps = 3/260 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQ+TN+E+IANNIAN+NTTG+KRARAEF D LYQ E+  G  +  A+ 
Sbjct: 1   MRALAIAATGMNAQETNVEVIANNIANVNTTGFKRARAEFTDLLYQVERAKGVAAAGAEG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVPEG  +G GV+++++RNV+ QG +  TGN LDLAL G GWFQ++ P   + YTR G+
Sbjct: 61  -VVPEGAQLGLGVRLAAIRNVHLQGALKETGNKLDLALNGEGWFQIQGPGGAIRYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN +++GQ+VT DG  + P + +P  T EI V+ +GQ+ A      + Q VGQL +A F 
Sbjct: 120 FNTNAEGQIVTLDGYLVDPELTVPANTSEIVVNEAGQVYARVEG--ELQDVGQLTLATFA 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL + T  SG P++  P D G+  V QGYLE SNVD VKEISE+ISAQRA
Sbjct: 178 NNAGLHAEGGNLFSETVASGAPVVGVPGDPGYGVVHQGYLEDSNVDPVKEISELISAQRA 237

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSK+I AADEM+S+++K
Sbjct: 238 YEMNSKIISAADEMASVVSK 257


>gi|254458078|ref|ZP_05071505.1| flagellar basal-body rod protein FlgG [Campylobacterales bacterium
           GD 1]
 gi|207085471|gb|EDZ62756.1| flagellar basal-body rod protein FlgG [Campylobacterales bacterium
           GD 1]
          Length = 262

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A+ GM   QT ++  ANNIAN+NT G+K++RAEF+D +Y+    AG  + ++D 
Sbjct: 2   MQSLYTASTGMLGMQTQIDTTANNIANVNTIGFKKSRAEFSDLMYKVMSYAG--TATSDV 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +++  ++++G +  T N LD+A+ GRG+F++E PD T +Y+R G+
Sbjct: 60  TKSPTGIEVGLGVRPTAINKIFSEGSLKQTDNQLDVAITGRGFFKLELPDGTEVYSRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  G +V +DG  LVP IVIP +  +I +   G +  V    +    +GQ+ + NFI
Sbjct: 120 FKVDDNGSMVNSDGYKLVPEIVIPPDATDISIGTDGTVTVVQPGQTQATQIGQITLTNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + GDNL   T  SG P+   P   G   ++QG++E SNV+ V E++++I+ QRA
Sbjct: 180 NPAGLHSRGDNLYLETDSSGQPVEGTPGVDGLGVLRQGFVELSNVELVVELTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           Y+ NSKVI  +DEM      ++
Sbjct: 240 YDSNSKVITTSDEMLQTTNNLK 261


>gi|327480022|gb|AEA83332.1| flagellar basal body rod protein FlgG [Pseudomonas stutzeri DSM
           4166]
          Length = 261

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 120/258 (46%), Positives = 164/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ  NL  I+NN+AN++TTG+KR RAEF D LYQ  +  G   QS+  + 
Sbjct: 4   ALWVSKTGLSAQDMNLTTISNNLANVSTTGFKRDRAEFQDLLYQIRRQPG--GQSSQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I+  + ++T G +  T   LD+A+ GRG+FQV  PD TV YTR GSF+
Sbjct: 62  LPSGLQLGTGVRITGTQKIFTTGSLQTTEQPLDMAINGRGFFQVLLPDGTVSYTRDGSFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           + S GQLVT++G  L P IV+P ET+   V   G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LSSDGQLVTSNGYALEPAIVVPPETQTFTVGEDGTVSVTTVGNPQPQIIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G NL   T+ SG P +S P   G   V Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAMGSNLFLETAASGAPQVSTPGLNGLGTVLQNTLENSNVSVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|322380502|ref|ZP_08054691.1| flagellar basal body rod protein FlgG [Helicobacter suis HS5]
 gi|321147069|gb|EFX41780.1| flagellar basal body rod protein FlgG [Helicobacter suis HS5]
          Length = 262

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 172/262 (65%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A  GM  QQT+++  +NNIAN+NT G+KR RA+F D  YQA + AG  + ++D 
Sbjct: 2   LRSLYSATTGMLGQQTHIDTTSNNIANVNTVGFKRQRADFNDLFYQALQYAG--TSTSDT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +SV  +++QG    T NNLD+A+ G+G+FQ++ PD +  YTRAG+
Sbjct: 60  TRSPNGIEVGLGVRTASVTKMFSQGSPKETENNLDIAITGKGFFQIQMPDGSTAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID +G +VT +G  L+P I  P++T +I +   G +    G  S    +GQ+ +ANFI
Sbjct: 120 FKIDDQGNMVTTEGYLLIPQITFPQDTTQISIGVDGTVSVTQGNASTSNVIGQITLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNLLA TS SG  I+ N +  G+  ++QG+LE SNV  V+E++++I+AQRA
Sbjct: 180 NPAGLHALGDNLLAVTSASGPAIVGNANSDGYGQLRQGFLELSNVRLVEEMTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKTIQTADNMLQTVNSLK 261


>gi|242238971|ref|YP_002987152.1| flagellar basal-body rod protein FlgG [Dickeya dadantii Ech703]
 gi|242131028|gb|ACS85330.1| flagellar basal-body rod protein FlgG [Dickeya dadantii Ech703]
          Length = 260

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN++T G+KR RA F D LYQ  +  G  +QS+D+
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVISNNLANVSTNGFKRQRAVFEDLLYQTVRQPG--AQSSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S   +++QG +  T N  D+A+ G+G+F+V  PD T  YTR GS
Sbjct: 60  TNLPSGLQLGTGVRPVSTERLHSQGNLEQTENTKDIAINGQGFFEVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ GQLVTA G T+ P I IP   + + V+R G +       +    VGQL ++ FI
Sbjct: 120 FQLDANGQLVTASGYTVQPAITIPTTAQTMTVARDGTVSVTLQGQTASTQVGQLTLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NPAGLQSLGENLYQETQSSGAPTQSTPGQNGAGVLYQGYVETSNVNVAEELVSMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D M   +T++
Sbjct: 240 YEINSKAVSTSDSMLQRLTQI 260


>gi|238785495|ref|ZP_04629478.1| Flagellar basal-body rod protein flgG [Yersinia bercovieri ATCC
           43970]
 gi|238713597|gb|EEQ05626.1| Flagellar basal-body rod protein flgG [Yersinia bercovieri ATCC
           43970]
          Length = 260

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N  D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLAKTDNTKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTASGFPVQPAITIPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESMGENLYQETASSGAPNDTTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|302343757|ref|YP_003808286.1| flagellar basal-body rod protein FlgG [Desulfarculus baarsii DSM
           2075]
 gi|301640370|gb|ADK85692.1| flagellar basal-body rod protein FlgG [Desulfarculus baarsii DSM
           2075]
          Length = 260

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 96/262 (36%), Positives = 162/262 (61%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM+AQQ NL++I+NN+AN+NTTG+K++RA+F D +YQ  +  G  +Q A  
Sbjct: 2   MRSLYTAATGMTAQQLNLDVISNNLANVNTTGFKKSRADFEDLMYQTLRQPG--AQQAGG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G  +G GV+  +++ +++QG+   T N LD+A+ G+G+F+++  ++ V  TR GS
Sbjct: 60  QMIPTGKQVGMGVRPVAIQKIWSQGDYQQTDNQLDVAIEGQGFFRIQKDNEDVY-TRDGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +++   +V ++GN LVP + +PE    + +  +G + A+T  + +   +G++ +  F 
Sbjct: 119 FKLNNNRDIVDSNGNLLVPQMTVPENATSVVIDPNGLVTALTADD-EAVELGRIQLYTFP 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL  IG N    +  SG  +  +P    F  + QG+LE SNV  V E+  MI AQRA
Sbjct: 178 NPSGLMAIGRNYFRESPASGVAVPGDPGADQFGTLAQGFLEMSNVSVVDEMVNMIVAQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +D+M     +++
Sbjct: 238 YEANSKSITTSDQMLQTANQVK 259


>gi|290474974|ref|YP_003467858.1| flagellar basal body rod cell-distal protein [Xenorhabdus bovienii
           SS-2004]
 gi|289174291|emb|CBJ81081.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Xenorhabdus bovienii SS-2004]
          Length = 260

 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ E+  G  + S+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTERQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQ++ PD T  YTR GS
Sbjct: 60  TNLPSGLQIGTGVRPVATERLHSQGNLAQTNNSNDVAIKGQGFFQIQMPDGTTGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVTA G  +VP I+IP+   ++ ++R G +       +  Q VGQL +  FI
Sbjct: 120 FQKDQNGQLVTAGGFQVVPAIIIPDNATKMSIARDGIVSINVQGQNAPQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL +IG+NL   T+ SG P+ + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NESGLESIGENLYLETNSSGVPVENAPGINGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|238799109|ref|ZP_04642565.1| Flagellar basal-body rod protein flgG [Yersinia mollaretii ATCC
           43969]
 gi|238717056|gb|EEQ08916.1| Flagellar basal-body rod protein flgG [Yersinia mollaretii ATCC
           43969]
          Length = 260

 Score =  234 bits (597), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N  D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNTKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I +P     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTSGGFQVQPAITVPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL +IG+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESIGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|307131607|ref|YP_003883623.1| flagellar basal-body rod protein flgG [Dickeya dadantii 3937]
 gi|306529136|gb|ADM99066.1| Flagellar basal-body rod protein flgG [Dickeya dadantii 3937]
          Length = 260

 Score =  234 bits (597), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 112/261 (42%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG    TGN  DLA+ G G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVATERIHTQGSFSETGNVKDLAIKGAGFFQVLMPDGTTSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS GQLVT+ G  + P I IP  +  + V R G +       +    +GQL +A FI
Sbjct: 120 FQQDSNGQLVTSSGFQVQPAITIPANSSNLTVGRDGVVTVTQQGQTAPVQIGQLNLAMFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL N+G+NL A T+ SG P  S P   G   + Q ++E SNV+  +E+  MI  QRA
Sbjct: 180 NEAGLENLGENLYAETASSGAPTQSTPGLNGAGLIYQKFVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I + D+M   +T++
Sbjct: 240 YEINSKAISSTDQMLQKLTQL 260


>gi|226939372|ref|YP_002794445.1| flgG [Laribacter hongkongensis HLHK9]
 gi|226714298|gb|ACO73436.1| flgG [Laribacter hongkongensis HLHK9]
          Length = 260

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 169/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM + Q  L++I NN+AN+NTTG+K+ RA F D +YQ  +  G  +QS+  
Sbjct: 2   LRSLYISKTGMDSSQFRLDVITNNLANVNTTGFKKGRAVFEDLMYQTIRQPG--AQSSQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G+G    +V   ++ G +  T N LD+A+ GRG+F ++ PD T+ YTR G+
Sbjct: 60  TMLPTGLLVGTGAAPVAVDRQFSPGNLQQTNNALDMAINGRGFFTIQMPDGTIGYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D +GQLVT+ G  + P I +P+  + I VS+ G +  V    +  Q +GQ+ +A+FI
Sbjct: 120 FKLDDQGQLVTSQGFLVDPQITVPQGAKSISVSKDGIVSVVLPGQTQPQQIGQMQLADFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T+ SG P ++NP + G   ++Q +LEASNV+  +E+ EMI AQRA
Sbjct: 180 NPQGLEPIGGNLYLETAASGAPTVANPTNDGTGAIQQTFLEASNVNVTEELVEMIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NS+ I+ +D+M + ++++
Sbjct: 240 YELNSRGIKTSDDMLARLSQL 260


>gi|158422258|ref|YP_001523550.1| flagellar basal body rod protein FlgG [Azorhizobium caulinodans ORS
           571]
 gi|158329147|dbj|BAF86632.1| flagellar basal-body rod FlgG protein [Azorhizobium caulinodans ORS
           571]
          Length = 262

 Score =  234 bits (597), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 143/259 (55%), Positives = 190/259 (73%), Gaps = 1/259 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQTN+E+IANNIANINTTG+KRARAEF+D LYQ+E+  G P++   +
Sbjct: 1   MRALAIAATGMNAQQTNVEVIANNIANINTTGFKRARAEFSDLLYQSERTQGIPNRDGGQ 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+ PEG  +G GV+   +RN++TQG +  TGN LDLA+ GRG F++ TPD   +YTRAGS
Sbjct: 61  AI-PEGAMLGLGVRTVGIRNLHTQGPLTQTGNTLDLAVNGRGMFEITTPDGQTVYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN  + GQLVT+DG  + P I  P    EI+V+ SGQ+ A     ++ Q +GQL + NF 
Sbjct: 120 FNRSATGQLVTSDGYVINPAIQFPNNATEIQVNESGQVYATIPNQTNPQLLGQLTLVNFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+G+  +G+NL   T  SG PI+    D+GF  ++QGYLEASNVD VKEI+E+I+AQR+
Sbjct: 180 NESGMEPLGNNLYRETLASGQPIVGVAGDVGFGKIQQGYLEASNVDPVKEITELIAAQRS 239

Query: 241 YEMNSKVIEAADEMSSLIT 259
           YEMNSKVI+AADEMS  ++
Sbjct: 240 YEMNSKVIQAADEMSKTVS 258


>gi|224372657|ref|YP_002607029.1| flagellar basal body rod protein FlgG [Nautilia profundicola AmH]
 gi|223588586|gb|ACM92322.1| flagellar basal-body rod protein FlgG [Nautilia profundicola AmH]
          Length = 262

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM AQQ  +++++NNI+N+NT GYK+ RAEFAD  YQ  + AG+ + +  ++
Sbjct: 3   RSLYTAATGMMAQQMQIDVVSNNISNVNTIGYKKQRAEFADLFYQTMEYAGTSTSTTTQS 62

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
               GI++G GV+ ++V  +++QG    TGNNLD+A+ G G+FQV+ PD  + YTR G+F
Sbjct: 63  PT--GINVGLGVRPTAVTKIFSQGNFKETGNNLDVAIQGDGFFQVQLPDGRIAYTRDGAF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +D+ G +VT+DG  L+P I +P +T ++ +   G +  +    +  Q +GQ+ IA FIN
Sbjct: 121 KLDADGNIVTSDGYKLIPNITLPADTVQVSIGTDGTVSVLEAGQTQMQQIGQIEIAKFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL ++G NL   T+ SGDPI+S P   G   ++QG++E SNV  V+E++++I+ QRAY
Sbjct: 181 PAGLHSLGSNLYIDTTASGDPIVSTPGLDGTGELRQGFVEMSNVQLVEEMTDLITGQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           +  SK I  +DEM   +  ++
Sbjct: 241 DAASKAIVTSDEMLQTVNNLK 261


>gi|15639944|ref|NP_219397.1| flagellar basal body rod protein FlgG [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189026183|ref|YP_001933955.1| flagellar basal body rod protein FlgG [Treponema pallidum subsp.
           pallidum SS14]
 gi|3323281|gb|AAC65915.1| flagellar basal-body rod protein (flgG-1) [Treponema pallidum
           subsp. pallidum str. Nichols]
 gi|189018758|gb|ACD71376.1| flagellar basal-body rod protein [Treponema pallidum subsp.
           pallidum SS14]
 gi|291060315|gb|ADD73050.1| flagellar basal-body rod protein FlgG [Treponema pallidum subsp.
           pallidum str. Chicago]
          Length = 264

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 110/263 (41%), Positives = 161/263 (61%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM+ QQ N++ +ANN+AN+NT+G+KR RAEF D LYQ  + AG+P  + +  
Sbjct: 3   RSLWTAATGMNGQQANIDTVANNLANVNTSGFKRQRAEFEDLLYQTIRTAGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           + P G+ +G GV++++ + ++ QG + HTG + D+A+ G G+F+V   D T  YTR GSF
Sbjct: 61  LTPVGVRMGHGVKLAATQRLFEQGSLQHTGVSGDVAIAGEGFFRVLQYDGTYAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            +D++ QLVT++G  LVP I+ PE      I +S+ G++    G+  D   VGQL +  F
Sbjct: 121 KVDAERQLVTSNGLRLVPEIIFPENYVEHSIAISKDGRVTVRVGEQGDPVEVGQLELYRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
            N AGL   G N+  +T  SG PI   P   GF  V+  +LE SNV  V E+  MI AQR
Sbjct: 181 ANNAGLAAEGGNVFTQTPASGQPIPGRPGFEGFGKVEHKFLEMSNVSTVSEMVNMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE NSK I+ +D M      ++
Sbjct: 241 AYEFNSKAIQTSDNMLGTAVALK 263


>gi|186895116|ref|YP_001872228.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           PB1/+]
 gi|186698142|gb|ACC88771.1| flagellar basal-body rod protein FlgG [Yersinia pseudotuberculosis
           PB1/+]
          Length = 260

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTIFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESVGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   + ++
Sbjct: 240 YEINSKAVSTSDQMLQKLAQL 260


>gi|227328340|ref|ZP_03832364.1| flagellar basal body rod protein FlgG [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|253688970|ref|YP_003018160.1| flagellar basal-body rod protein FlgG [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755548|gb|ACT13624.1| flagellar basal-body rod protein FlgG [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G+GV+  S   ++TQG    TGN+ D+A+ G+G+FQV+ PD T  YTR G+
Sbjct: 60  TMLPSGLQLGTGVRPVSTERIHTQGTFSETGNSKDVAIKGQGFFQVQLPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I +P    E+ + R G +       +    +GQL +  FI
Sbjct: 120 FQLDGNGQLVTSSGYQVQPAITVPANATELNIGRDGIVSVKVQGQAATNQIGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T+ SG P  +NP   G   + Q Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESMGENLYLETASSGAPNETNPGLNGAGLLYQKYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I ++D+M   +T++
Sbjct: 240 YEINSKAISSSDQMLQKLTQL 260


>gi|300716220|ref|YP_003741023.1| flagellar basal-body rod protein [Erwinia billingiae Eb661]
 gi|299062056|emb|CAX59172.1| Flagellar basal-body rod protein [Erwinia billingiae Eb661]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG +  T ++ D+A+ G+G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQLGTGVRPVATERLHTQGNLNKTDSSKDVAISGQGYFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT  G  + P I +P     + + R G +       +    VGQL ++ FI
Sbjct: 120 FQTDQNGQLVTNGGFPVQPAITVPANALSMTIGRDGVVSVTQQGQTQPVQVGQLTLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL + G+NL   T  SG P  S P + G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESKGENLYQETQASGAPTDSTPGNNGAGLLYQGYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + +T++
Sbjct: 240 YEINSKAISTSDQMLAKLTQL 260


>gi|238751764|ref|ZP_04613252.1| Flagellar basal-body rod protein flgG [Yersinia rohdei ATCC 43380]
 gi|238710035|gb|EEQ02265.1| Flagellar basal-body rod protein flgG [Yersinia rohdei ATCC 43380]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNSKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTSGGFQVQPAITIPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESMGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|238919261|ref|YP_002932776.1| flagellar basal body rod protein FlgG [Edwardsiella ictaluri
           93-146]
 gi|238868830|gb|ACR68541.1| flagellar basal-body rod protein FlgG, putative [Edwardsiella
           ictaluri 93-146]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLYIAKTGLEAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TNLPSGLQLGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVTLPDGSQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     + + R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTASGFQITPAITIPANATSMTIGRDGIVSVTLQGQAAPQQVGQLTLNTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T+ SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESMGENLYQETASSGSPTESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAISTSDQMLQRLTQL 260


>gi|238788317|ref|ZP_04632111.1| Flagellar basal-body rod protein flgG [Yersinia frederiksenii ATCC
           33641]
 gi|238723563|gb|EEQ15209.1| Flagellar basal-body rod protein flgG [Yersinia frederiksenii ATCC
           33641]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNSKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTSGGFQIQPAITIPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESVGENLYQETASSGAPNDSTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|50120641|ref|YP_049808.1| flagellar basal body rod protein FlgG [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611167|emb|CAG74613.1| flagellar basal-body rod protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G+GV+  S   ++TQG    TGN+ D+A+ G+G+FQV+ PD T  YTR G+
Sbjct: 60  TMLPSGLQLGTGVRPVSTERIHTQGTFSETGNSKDVAIKGQGFFQVQLPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I +P    E+ + R G +       +    +GQL +  FI
Sbjct: 120 FQLDGNGQLVTSSGYQVQPAITVPANATELNIGRDGIVSVKVQGQAATNQIGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T+ SG P  +NP   G   + Q Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESMGENLYLETASSGAPNETNPGLNGAGLLYQKYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I ++D+M   +T++
Sbjct: 240 YEINSKAISSSDQMLQKLTQL 260


>gi|90418392|ref|ZP_01226304.1| basal body rod protein flgG [Aurantimonas manganoxydans SI85-9A1]
 gi|90338064|gb|EAS51715.1| basal body rod protein flgG [Aurantimonas manganoxydans SI85-9A1]
          Length = 262

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 145/260 (55%), Positives = 184/260 (70%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQTN+E+IANNIANINTTG+KRARAEF D LYQ E+  G  ++    
Sbjct: 1   MRALAIAATGMNAQQTNVEVIANNIANINTTGFKRARAEFTDLLYQVERAQGVAARGGQG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVPEG  +G G +++++RN++ QG +  TGN LDLAL G GWFQV+ P   ++YTR G+
Sbjct: 61  -VVPEGAQLGLGTRLAAIRNLHIQGTLNQTGNKLDLALNGEGWFQVQGPGGEILYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN +  GQLVT DG  + P I +P  T E+ V+ SGQ+ A  G  +D + +GQL +A F 
Sbjct: 120 FNTNGDGQLVTLDGLLVDPAITMPANTSEVIVNESGQVFARVGGAADLEELGQLTLATFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T  SG P    P D G+A ++QGYLE SNVD VKEISE+ISAQRA
Sbjct: 180 NNAGLAAQGGNLFRETIASGAPTAGVPGDEGYATLQQGYLEDSNVDPVKEISELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI AADEM+S+++K
Sbjct: 240 YEMNSKVISAADEMASVVSK 259


>gi|171059410|ref|YP_001791759.1| flagellar basal-body rod protein FlgG [Leptothrix cholodnii SP-6]
 gi|170776855|gb|ACB34994.1| flagellar basal-body rod protein FlgG [Leptothrix cholodnii SP-6]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  I+  GM AQQT L++++NN+AN+ T GYK++ A F D +YQ  + +G  + S+++
Sbjct: 2   MRALWISKTGMEAQQTQLDVVSNNLANVATNGYKKSHAVFEDLMYQTLRQSG--AASSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    +TQG +  +GN LD+A+ G G+F ++ PD T  YTR G+
Sbjct: 60  TQLPTGLQVGLGVRTVATSRQFTQGNLQQSGNTLDVAIKGNGFFPIQMPDGTTGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F + + GQLVT+ G  + PGI IP + + + ++  G +       +  Q +GQL +ANFI
Sbjct: 120 FQVSATGQLVTSAGYAVQPGITIPADAQTVTIAPDGVVSVALPGQTAPQVLGQLQVANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T+ SG P    P   G   + QG+LE SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLEAKGGNLYTETASSGTPNGGAPGSNGLGSLSQGFLETSNVNVVEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   + ++
Sbjct: 240 YELNSKAISTSDQMLQKLGQL 260


>gi|261821155|ref|YP_003259261.1| flagellar basal body rod protein FlgG [Pectobacterium wasabiae
           WPP163]
 gi|261605168|gb|ACX87654.1| flagellar basal-body rod protein FlgG [Pectobacterium wasabiae
           WPP163]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G+GV+  S   ++TQG    TGN+ D+A+ G+G+FQV+ PD T  YTR G+
Sbjct: 60  TMLPSGLQLGTGVRPVSTERIHTQGTFSETGNSKDVAIKGQGFFQVQLPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I +P    E+ + R G +       +    +GQL +  FI
Sbjct: 120 FQLDGNGQLVTSSGYQVQPAITVPANATELNIGRDGIVSVKLQGQAATNQIGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T+ SG P  SNP   G   + Q Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESMGENLYLETASSGAPNESNPGLNGAGLLFQKYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I ++D+M   +T++
Sbjct: 240 YEINSKAISSSDQMLQKLTQL 260


>gi|146281773|ref|YP_001171926.1| flagellar basal body rod protein FlgG [Pseudomonas stutzeri A1501]
 gi|145569978|gb|ABP79084.1| flagellar basal-body rod protein FlgG [Pseudomonas stutzeri A1501]
          Length = 261

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 166/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ  NL  I+NN+AN++TTG+KR RAEF D LYQ  +  G   QS+  + 
Sbjct: 4   ALWVSKTGLSAQDMNLTTISNNLANVSTTGFKRDRAEFQDLLYQIRRQPG--GQSSQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+++  + ++T G +  T   LD+A+ GRG+FQV  PD TV YTR GSF+
Sbjct: 62  LPSGLQLGTGVRVTGTQKIFTTGSLQTTEQPLDMAINGRGFFQVLLPDGTVSYTRDGSFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +DS GQ+VT++G  L P IV+P ET+   V   G +   T  N+  Q +G +  A+FIN 
Sbjct: 122 LDSDGQVVTSNGYALEPAIVVPAETQTFTVGEDGTVSVTTLGNAQPQIIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G NL   T+ SG P +S P   G   V Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAMGSNLFLETAASGAPQVSTPGLNGLGTVLQNTLENSNVSVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|154253003|ref|YP_001413827.1| flagellar basal body rod protein FlgG [Parvibaculum lavamentivorans
           DS-1]
 gi|154156953|gb|ABS64170.1| flagellar basal-body rod protein FlgG [Parvibaculum lavamentivorans
           DS-1]
          Length = 261

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 129/262 (49%), Positives = 175/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GM AQQ N+E+I+NNIAN++TTG+KR RAEF D LYQ  +  G+ S S   
Sbjct: 1   MQSLSIAATGMMAQQLNVEVISNNIANMSTTGFKRGRAEFQDLLYQNLRRVGANS-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ ++V  + TQG + +T N LD+A+ GRG+F++E P     YTRAG+
Sbjct: 60  TIVPSGVQVGLGVKTAAVNRIMTQGNMNNTENKLDVAIQGRGYFRIELPSGDDAYTRAGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+I   GQL+TADG TL PGI IP E  +I +S  GQ+       +  Q VGQ+ +  F 
Sbjct: 120 FDIGPDGQLITADGYTLAPGITIPPEATDIAISADGQVQVAIPGQTAPQIVGQMELVAFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  +G NL A T  SG P I  P + G   V QG+LE SNV+AV EI+ +I+AQRA
Sbjct: 180 NEGGLDPLGGNLFAETPASGAPTIGTPGNDGLGSVLQGFLETSNVNAVSEITSLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+K+I A+DEM S+ + M+
Sbjct: 240 YEMNAKIITASDEMMSVTSNMK 261


>gi|224825166|ref|ZP_03698272.1| flagellar basal-body rod protein FlgG [Lutiella nitroferrum 2002]
 gi|224602837|gb|EEG09014.1| flagellar basal-body rod protein FlgG [Lutiella nitroferrum 2002]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 98/261 (37%), Positives = 151/261 (57%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IA  GM + Q  L++++NN+AN NT G+K+  A F D  YQ  +  G  SQ  + 
Sbjct: 2   MRALYIAKTGMDSSQFQLDVVSNNLANSNTKGFKKGHAVFEDLYYQTLRQPG--SQLTNG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G  + +   +++QG +  T   LDLA+ G G+F+V+ PD T+ YTR G 
Sbjct: 60  NSLPTGLQVGTGSTVVATARIHSQGNLESTEQPLDLAINGDGFFRVQQPDGTIAYTRNGE 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  +  G +V + G  L P I IP     I +S +G +      ++     G + +  FI
Sbjct: 120 FRRNENGDIVNSSGYLLDPAINIPANATGITISEAGVVQYTQPNSTAPTTAGTIQLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL++IG NL  +T  SGDP   +P+  G   V+ G+LE SNV+  +E+  MI+AQR+
Sbjct: 180 NPQGLQSIGQNLYLQTQASGDPQDGDPNTDGRGSVRSGFLEDSNVNVTEELVNMITAQRS 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           +EMNS+ I+ ADEM   I ++
Sbjct: 240 FEMNSRAIKTADEMLQRIAQL 260


>gi|163850063|ref|YP_001638106.1| flagellar basal body rod protein FlgG [Methylobacterium extorquens
           PA1]
 gi|218528666|ref|YP_002419482.1| flagellar basal body rod protein FlgG [Methylobacterium
           chloromethanicum CM4]
 gi|240137197|ref|YP_002961666.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Methylobacterium extorquens AM1]
 gi|254559209|ref|YP_003066304.1| cell-distal portion of basal-body rod biosynthesis protein
           [Methylobacterium extorquens DM4]
 gi|163661668|gb|ABY29035.1| flagellar basal-body rod protein FlgG [Methylobacterium extorquens
           PA1]
 gi|218520969|gb|ACK81554.1| flagellar basal-body rod protein FlgG [Methylobacterium
           chloromethanicum CM4]
 gi|240007163|gb|ACS38389.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Methylobacterium extorquens AM1]
 gi|254266487|emb|CAX22251.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Methylobacterium extorquens DM4]
          Length = 262

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 139/260 (53%), Positives = 191/260 (73%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ NLE+IANNIAN+NTTG+K ARAEF D LYQAE+  G P+Q+  +
Sbjct: 1   MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQE 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV PEG  +G GV+ +++RN++ QG + +TGN LDLA+ GRG+FQ+ +P   + YTRAGS
Sbjct: 61  AV-PEGAMLGLGVRAAAIRNLHRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT +G  + P I+IP+ T ++ ++ SGQ+ A        Q VGQL +ANF 
Sbjct: 120 FNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAKIDGQVALQNVGQLTLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL  +G+ L   T  SG P++ NP D+ +  ++QGYLE SNVD VKEI+ +I+AQRA
Sbjct: 180 NDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +EMNSKVI+AADEM+  ++K
Sbjct: 240 FEMNSKVIQAADEMAGTVSK 259


>gi|51596013|ref|YP_070204.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           IP 32953]
 gi|153947499|ref|YP_001401288.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           IP 31758]
 gi|170024645|ref|YP_001721150.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           YPIII]
 gi|51589295|emb|CAH20916.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Yersinia pseudotuberculosis IP 32953]
 gi|152958994|gb|ABS46455.1| flagellar basal-body rod protein FlgG [Yersinia pseudotuberculosis
           IP 31758]
 gi|169751179|gb|ACA68697.1| flagellar basal-body rod protein FlgG [Yersinia pseudotuberculosis
           YPIII]
          Length = 260

 Score =  233 bits (595), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     + V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSMTVGRDGIVSVTLQGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESVGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   + ++
Sbjct: 240 YEINSKAVSTSDQMLQKLAQL 260


>gi|322832566|ref|YP_004212593.1| flagellar basal-body rod protein FlgG [Rahnella sp. Y9602]
 gi|321167767|gb|ADW73466.1| flagellar basal-body rod protein FlgG [Rahnella sp. Y9602]
          Length = 260

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IPSLYIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  S   +++QG +  T N+ D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TNLPSGLQIGTGVRPVSTERLFSQGNLSQTSNSKDIAVKGEGFFQVQLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  ++P I +P     + V R G +   T   +  Q VGQL ++ FI
Sbjct: 120 FQVDQNGQLVTSSGYQVIPAITVPANALSMTVGRDGIVSVTTQGQTAAQQVGQLTLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESLGENLYQETQSSGAPTESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +DEM   ++++
Sbjct: 240 YEINSKAVSTSDEMLQKLSQL 260


>gi|78358198|ref|YP_389647.1| flagellar basal body rod protein FlgG [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220603|gb|ABB39952.1| Flagellar basal body rod protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 261

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 161/262 (61%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ N++ I+NN+AN+NT G+K++RAEF D +YQ  K+AG  S + + 
Sbjct: 2   MRSLWTAATGMIAQQLNIDTISNNLANVNTLGFKKSRAEFEDLMYQNMKIAG--SVTGND 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+ ++V   +TQG+  +TGN LDLA+ G G+FQV T +    YTRAG+
Sbjct: 60  QRIPTGIQVGLGVRPTTVHKFFTQGDYSNTGNPLDLAIEGDGFFQV-TVNGEPAYTRAGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G  L P   +P ET+ + V+ +G I A+     +      + +  FI
Sbjct: 119 FKLNQDGTVVTANGYPLEPEFTVPPETKNVVVTENGHIAALDKNGEELAAA-DIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+  G NL   +  SG  +   P +     + QG+LE SNV+ V E+  MI  QRA
Sbjct: 178 NPAGLQAAGRNLYLASEASGVAVEGVPGEDNVGTIAQGFLEMSNVEVVDEMVNMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK I+A+D M    T+++
Sbjct: 238 YEMNSKAIQASDNMLQTATQLK 259


>gi|254785374|ref|YP_003072803.1| flagellar basal body rod protein FlgG [Teredinibacter turnerae
           T7901]
 gi|237683455|gb|ACR10719.1| flagellar basal-body rod protein FlgG [Teredinibacter turnerae
           T7901]
          Length = 261

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T L  +ANN+AN +T G+KR RA F D LYQ ++  G  +Q+ +   
Sbjct: 4   ALYVSKTGLAAQDTKLTTVANNLANASTVGFKRDRAVFEDLLYQIQRQPG--AQNTEDTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   +  +  G +  T   LD+A+ GRG+FQ+  PD T+ YTRAG F+
Sbjct: 62  LPSGLQLGTGVRVVGTQKQFDYGSLQVTNQPLDVAIDGRGFFQILQPDGTIGYTRAGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           + ++G++V   G  L P I IP+    + +   G + A     +    +G +   +F+N 
Sbjct: 122 LSNQGEIVDPTGLLLQPAITIPDNAESVTIGTDGTVSARIAGVAAPAILGNIQTVDFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG NL   T+ SG+PI   P   G   V+QG LE SNVD V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGGNLFLETAASGNPIQGIPGQNGLGQVEQGMLENSNVDIVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSK++  AD+M   +T+
Sbjct: 242 MNSKIVSTADQMLQFVTQ 259


>gi|291276427|ref|YP_003516199.1| flagellar basal-body rod protein [Helicobacter mustelae 12198]
 gi|290963621|emb|CBG39453.1| flagellar basal-body rod protein [Helicobacter mustelae 12198]
          Length = 262

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A  GM  QQ  ++  +NNIAN+NT GYKR RAEF D  YQ  + AG  + +++ 
Sbjct: 2   MRSLYSATTGMLGQQLQIDTTSNNIANVNTVGYKRQRAEFNDLFYQNLQYAG--TATSET 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G GV+  ++  +++QG    T NNLD+A+ G+G+FQV  PD T  YTR+G+
Sbjct: 60  TLSPTGIEVGLGVRPGAIAKMFSQGSPKETENNLDMAITGKGFFQVRLPDGTTAYTRSGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  G +VT++G  L+P I +P++  +I +   G +  V G N     +GQ+ +A+FI
Sbjct: 120 FKLDDNGNVVTSEGYALIPQITVPQDATQINIGNDGTVSVVQGNNGGSNTIGQIELADFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   TS SG PI       G   +KQG+LE SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSLGDNLYLNTSASGAPITGVAGTNGMGQIKQGFLELSNVRLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M   +  ++
Sbjct: 240 YEANSKSIQTADAMLQTVNGLK 261


>gi|242278484|ref|YP_002990613.1| flagellar basal body rod protein FlgG [Desulfovibrio salexigens DSM
           2638]
 gi|242121378|gb|ACS79074.1| flagellar basal-body rod protein FlgG [Desulfovibrio salexigens DSM
           2638]
          Length = 260

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 157/262 (59%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT++++++NN+AN+NT G+K++R EF D +YQ  ++AGS ++  ++
Sbjct: 2   MRSLWTAATGMVAQQTHIDVLSNNLANVNTQGFKKSRVEFEDLMYQTMRIAGSETEGGNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG GV+  S+   ++QG    TGN LD+A+ G G+F +   +    YTR+G+
Sbjct: 62  --LPTGMQIGMGVKEVSIHKFFSQGSFESTGNPLDIAIEGNGFF-LVDRNGEDAYTRSGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS G+LVT++G  L P   +P E   + VS  G I A+    ++      + I +FI
Sbjct: 119 FKLDSDGRLVTSNGYPLQPEFTVPAEAVNVVVSEDGHIAALDKNGTELSSA-DITIYDFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T  SG  I   P +  F  + QGYLE SNV+ V E+  +I  QRA
Sbjct: 178 NEAGLNAVGKNLYVETEASGAAIQGTPGEDNFGTLAQGYLEGSNVELVDEMVGLIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +D M      ++
Sbjct: 238 YETNSKAITTSDSMLQTAINVK 259


>gi|95929874|ref|ZP_01312615.1| Flagellar basal-body rod FlgG [Desulfuromonas acetoxidans DSM 684]
 gi|95134170|gb|EAT15828.1| Flagellar basal-body rod FlgG [Desulfuromonas acetoxidans DSM 684]
          Length = 261

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 114/261 (43%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA GM +QQTN+++IANN+AN+NT+G+K++RA+F + LYQ  K  G  S ++  
Sbjct: 2   IRALWTAATGMDSQQTNIDVIANNLANVNTSGFKKSRADFQELLYQVSKTPG--SSTSAD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P GI +G G + ++V+ V++ G+++ T N LDLA+ GRG+FQVE PD T  YTR+G+
Sbjct: 60  TVSPTGIQVGLGSRTAAVQKVFSTGDMMQTENELDLAIEGRGFFQVEMPDGTTAYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              D  G+L T++G  L P IVIPE T  I + + G +       S    +G + +A F 
Sbjct: 120 LKKDGDGRLTTSEGYLLTPQIVIPENTTSISIGQDGTVDVFLDGESTSTEIGVIEMAIFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GLR++G NL A T  SG      P + G   + QGYLE SNV  ++E+  MI+ QRA
Sbjct: 180 NESGLRSLGRNLFAETLSSGVANTGIPGENGLGTLSQGYLEGSNVSVMEEMVNMIAGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I+ ADEM  +   +
Sbjct: 240 YEVNSKAIQTADEMLQMTNNL 260


>gi|188579867|ref|YP_001923312.1| flagellar basal body rod protein FlgG [Methylobacterium populi
           BJ001]
 gi|179343365|gb|ACB78777.1| flagellar basal-body rod protein FlgG [Methylobacterium populi
           BJ001]
          Length = 262

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 140/260 (53%), Positives = 192/260 (73%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ NLE+IANNIAN+NTTG+K ARAEF D LYQAE+  G+P+Q+  +
Sbjct: 1   MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGAPNQAGQE 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV PEG  +G GV+ +++RN++ QG + +TGN LDLA+ GRG+FQ+ +P   + YTRAGS
Sbjct: 61  AV-PEGAMLGLGVRAAAIRNLHRQGSLANTGNQLDLAVNGRGYFQITSPAGEINYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT +G  + P I+IP  T ++ ++ SGQ+ A T      Q +GQL +ANF 
Sbjct: 120 FNKNNAGQLVTMEGYAVDPAILIPANTTQVTINESGQVFAKTDGQVALQNIGQLTLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL  +G+ L   T  SG P++ NP D+ +  ++QGYLE SNVD VKEI+ +I+AQRA
Sbjct: 180 NESGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +EMNSKVI+AADEM+  ++K
Sbjct: 240 FEMNSKVIQAADEMAGTVSK 259


>gi|311694363|gb|ADP97236.1| flagellar basal-body rod protein FlgG [marine bacterium HP15]
          Length = 262

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ TN+  I+NN+AN+NTTG+KR RA F D LYQ  +  G    +   + 
Sbjct: 4   ALWVSKTGLSAQDTNMSTISNNLANVNTTGFKRDRAVFQDLLYQINRQPG--GLTTQNSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++      ++QG +  T   LD+A+ GRG+ QV+ PD  + YTR G F 
Sbjct: 62  LPSGLQLGTGVRVVGTAKQFSQGNLQITEQPLDMAINGRGFLQVQLPDGQIAYTRDGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +++ G +V  DG  L P I +PE    I + + G + AVT   +    +GQ+ + +FIN 
Sbjct: 122 LNADGDVVNPDGYPLEPAINVPENATNITIGKDGTVTAVTDDQAAPVNLGQITLVDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG+NL   T+ SGDP    P   G   ++QG +E+SNV+ V+E+  MI+ QRAYE
Sbjct: 182 QGLQAIGNNLFKATNASGDPAEGEPGLAGLGSIEQGSVESSNVEVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+   D+M   IT+
Sbjct: 242 MNSKVVSTTDQMLQFITQ 259


>gi|238758108|ref|ZP_04619288.1| Flagellar basal-body rod protein flgG [Yersinia aldovae ATCC 35236]
 gi|238703646|gb|EEP96183.1| Flagellar basal-body rod protein flgG [Yersinia aldovae ATCC 35236]
          Length = 260

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IPSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSKTDNSKDIAIKGEGFFQVQMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP    ++ V R G +       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTSGGFQIQPAITIPANALKMTVGRDGIVSVTLPGQTATQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T+ SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESVGENLYQETASSGAPNETTPGLNGGGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|144897832|emb|CAM74696.1| flagellar basal body distal rod protein; FlgG [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 261

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 169/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GM AQQTN+E+I+NNIAN+NTT Y + R EF+D LYQ  +  G+ S S   
Sbjct: 1   MRSLNIAATGMLAQQTNVEVISNNIANMNTTAYTKRRPEFSDLLYQNLRRVGAAS-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ ++V  +  QG V  T N LD+A+ G+G+ Q+  P     YTR GS
Sbjct: 60  TIVPTGVQLGLGVKTTAVYRITEQGSVQSTDNTLDVAIQGKGYLQIRLPSGDTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +   GQ+VT +G T++PGI +P     I ++ SGQ++     + D   VGQL +ANF 
Sbjct: 120 FQLSEAGQIVTHEGYTVLPGITVPNNAVGISINASGQVMVKVDGSIDQTVVGQLQLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL   GDNL   T  SG  +  NP   G+  + QG+LE SNV+ V E++ +ISAQRA
Sbjct: 180 NEAGLEARGDNLFLETPASGGVLAGNPGSPGYGTLLQGFLETSNVNVVAEVTNLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+ +DEM S I +++
Sbjct: 240 YEMNSKVIQTSDEMMSTINQLK 261


>gi|37525843|ref|NP_929187.1| flagellar basal-body rod protein FlgG (Distal rod protein)
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785272|emb|CAE14213.1| Flagellar basal-body rod protein FlgG (Distal rod protein)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 260

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  + S+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAIFEDLLYQNIRQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ ++A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TRLPSGLQIGTGVRPVATERIHSQGNLSETNNSHNVAIRGKGFFQVQLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQL TA+G  + P I IP+   ++ +S  G +       S  Q VGQ  +  FI
Sbjct: 120 FQEDQNGQLTTANGFLIFPTITIPDNATDLTISSDGIVSVKVQGQSVPQQVGQFTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL +IG+NL   TS SG PI + P   G   ++  Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESIGENLYVETSSSGVPIENTPGINGAGLLQHKYVETSNVNIAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEVNSKAVSTSDQMLQKLTQL 260


>gi|295111397|emb|CBL28147.1| flagellar basal-body rod protein FlgG, Gram-negative bacteria
           [Synergistetes bacterium SGP1]
          Length = 268

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 112/268 (41%), Positives = 168/268 (62%), Gaps = 8/268 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQTNL+++++N+AN+NT GYK+ RA+F D LYQ  +  G+P +    
Sbjct: 2   LRALWSSASGMIAQQTNLDVVSHNLANVNTQGYKKRRADFEDLLYQVWREPGTPVEPNS- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRG------WFQVETPDKTVM 114
             VP G+ +G G ++++  +  TQG    T N +D A+ G+       +FQV   D T+ 
Sbjct: 61  -TVPTGVQVGLGTRVTATPSFMTQGHFQITDNKMDWAIAGQTMAGENAFFQVTQQDGTIA 119

Query: 115 YTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQL 174
           YTRAG++ ID  GQ+V+ DG  L P +V+PE    ++++R+G+++      ++ Q +GQL
Sbjct: 120 YTRAGAWEIDGDGQIVSEDGLLLEPAMVVPENATSVQLTRTGRVMVTIPGQTEPQEIGQL 179

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            +A FIN AGLR +GD L   TS SG PI+  P   G   V+QG LE SNV  V+E+  M
Sbjct: 180 ELARFINPAGLRALGDRLFLETSASGAPIVGQPGQNGMPTVRQGVLEMSNVQVVEEMVGM 239

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I AQRAYE NSK I+ ADE+  +   ++
Sbjct: 240 IIAQRAYEANSKGIQTADELLRIANGLK 267


>gi|255021356|ref|ZP_05293404.1| Flagellar basal-body rod protein flgG [Acidithiobacillus caldus
           ATCC 51756]
 gi|254969219|gb|EET26733.1| Flagellar basal-body rod protein flgG [Acidithiobacillus caldus
           ATCC 51756]
          Length = 261

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 111/260 (42%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  +AA G+  +QT +++IANN+AN+NTTG+K++RA F D LYQ  +  G  +QS+  
Sbjct: 2   MRSLYVAATGLEGEQTKMDVIANNLANVNTTGFKQSRAVFQDLLYQNLRQPG--AQSSQT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ +G+GV++ +   + TQG +  TGN LDL + G+G+FQ+  PD T+ YTR G+
Sbjct: 60  TQYPSGLQLGTGVRVVATERLMTQGNLTSTGNALDLGINGQGFFQIMQPDGTIAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++++GQLVT++G  L P + IP   + I +   G +  V    S  Q VG + +ANFI
Sbjct: 120 FQLNNQGQLVTSNGYLLQPPVTIPPNAQSITIGTDGTVSVVLPGQSQPQQVGSIQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL++IGDNL  +T  SG P    P   G   V+QGYLE+SNV+ V E+ +MI+ QRA
Sbjct: 180 NPTGLQSIGDNLYLQTGSSGAPQTGQPTLNGLGSVQQGYLESSNVNVVSELVDMIATQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YE+NSK +  +D M     +
Sbjct: 240 YEINSKAVSTSDSMLGYAIQ 259


>gi|329901232|ref|ZP_08272757.1| Flagellar basal-body rod protein flgG [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549164|gb|EGF33756.1| Flagellar basal-body rod protein flgG [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 260

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++I+NN+AN++T+G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLEAQQTQMDVISNNLANVSTSGFKRSRAVFEDLLYQTLRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TQLPSGLQLGTGVRPVATERIFTQGNLQQTSNDKDVAIQGQGFFQVLLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F IDS+GQ+VT+ G  + P I IP   + + V R G I       +    +G L +A FI
Sbjct: 120 FQIDSQGQMVTSSGFVIQPAITIPAAAQSLTVGRDGTISITLQGTAAATQIGALQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G+NL   T  SG    + P   G   + QGY+E SNV  V+E+  MI  QRA
Sbjct: 180 NPAGLESKGENLYVETGASGTANTNTPGTNGAGILSQGYVETSNVSVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + ++++
Sbjct: 240 YEINSKAISTSDQMLAKLSQL 260


>gi|294828153|ref|NP_712848.2| flagellar basal body rod protein FlgG [Leptospira interrogans
           serovar Lai str. 56601]
 gi|293386000|gb|AAN49866.2| endoflagellar distal basal body rod protein [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 264

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 107/265 (40%), Positives = 165/265 (62%), Gaps = 5/265 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ +++ I+NN+AN+NTTG+K+ RA+F D +YQ + +AG+P+ S   
Sbjct: 1   MRSLWTAATGMIAQQFHIDTISNNLANVNTTGFKKNRADFEDLVYQHQVLAGTPATSVS- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVG-RGWFQVETPDKTVMYTRAG 119
             +P G+++G GV+ ++ + ++  G    TGN LD+A+ G  G+F+++ PD +  +TR G
Sbjct: 60  -EIPTGVNVGHGVRAAASQKLFEIGSFQATGNKLDMAITGEMGFFKIQMPDGSFAFTRDG 118

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
           SF IDS  Q+VT++G  L P +++PE      + +S  G++    G +     +GQ+ + 
Sbjct: 119 SFKIDSNQQVVTSNGYLLEPPLILPEGAILNTLMISEQGEVTVKVGADIRPIVIGQVELY 178

Query: 178 NFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISA 237
            F+N AGL+ IG NL   T  SG  I   P   GF +V QG+LE SNV  V+E+  MI A
Sbjct: 179 RFVNPAGLQAIGKNLFQETVASGPEIPGTPGMEGFGNVLQGFLEMSNVKIVEEMVAMIVA 238

Query: 238 QRAYEMNSKVIEAADEMSSLITKMR 262
           QRAYE NSK I+ +D M S    ++
Sbjct: 239 QRAYESNSKAIQTSDNMLSTAISLK 263


>gi|307546966|ref|YP_003899445.1| flagellar basal body rod protein FlgG [Halomonas elongata DSM 2581]
 gi|307218990|emb|CBV44260.1| flagellar basal body rod protein FlgG [Halomonas elongata DSM 2581]
          Length = 260

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +   A  G+ +QQ  L++I+NN+AN+NT G+KR+RA F D LYQ  +  G+ +   ++
Sbjct: 2   INSLWTAKTGLESQQVKLDVISNNLANVNTNGFKRSRAVFEDLLYQNLRQPGAQNNVQNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG + +TGN+ DLA+ G+G+FQV  PD T  YTR GS
Sbjct: 62  --LPSGMQVGTGVRPVATERLHTQGGLENTGNSRDLAINGKGFFQVRMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQ+VTA+G  L P I+IP+    + +   G +      +S+   VGQ+ +++F+
Sbjct: 120 FQLDENGQMVTANGYPLEPAIIIPQNALSVSIGEDGIVSITEPGSSESNEVGQISVSSFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL +IG NL   T+ SG      P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPTGLESIGGNLYRETTASGPRNEGIPGMNGAGRLSQGYVETSNVNVVEEMVGMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +DEM + +T++
Sbjct: 240 YEINSKAVQTSDEMLARLTQL 260


>gi|253998486|ref|YP_003050549.1| flagellar basal-body rod protein FlgG [Methylovorus sp. SIP3-4]
 gi|313200561|ref|YP_004039219.1| flagellar basal-body rod protein flgg [Methylovorus sp. MP688]
 gi|253985165|gb|ACT50022.1| flagellar basal-body rod protein FlgG [Methylovorus sp. SIP3-4]
 gi|312439877|gb|ADQ83983.1| flagellar basal-body rod protein FlgG [Methylovorus sp. MP688]
          Length = 260

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++IANN+AN++T G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLDAQQTQMDVIANNLANVSTNGFKRSRAVFEDLLYQNIRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   +++QG +  T N  DLA+ G G+FQV  PD +  YTR GS
Sbjct: 60  TQLPSGMQLGTGVKPVATERIFSQGNLQQTENAKDLAINGEGFFQVLLPDGSTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++GQ+VTA G T+ P I IP   + I V R G +      +     +G + +A FI
Sbjct: 120 FQVDNQGQMVTASGYTIQPAITIPANAQSITVGRDGTVSVTLPNSVATTQIGTIQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL++ G+NL   TS SG    + P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQSKGENLYVETSASGTASTNTPGANGAGVLNQGYVETSNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   ++++
Sbjct: 240 YEINSKAITTSDQMLQRLSQL 260


>gi|226944494|ref|YP_002799567.1| flagellar basal-body rod protein [Azotobacter vinelandii DJ]
 gi|226719421|gb|ACO78592.1| flagellar basal-body rod protein [Azotobacter vinelandii DJ]
          Length = 260

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A  G+ +QQ  +++IANN+AN+ T G+KR RA F D LYQ  +  G+ + +  +
Sbjct: 2   IRSLWTAKTGLESQQVQMDVIANNLANVATNGFKRTRAVFEDLLYQNLRQPGADNTT--Q 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ DLA+ G+G+FQVE PD T  YTR GS
Sbjct: 60  TKLPSGLQIGTGVRPVATERLHSQGNLQGTENSNDLAINGKGFFQVELPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQ+VT+ G  L+ GI IPE    + VS+ G +      N+    VGQL +A FI
Sbjct: 120 FQLDENGQMVTSSGYLLMGGITIPENALSVTVSQDGIVSVTQPGNAQANQVGQLNLALFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+++G+NL   T+ SG P  + P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQSVGENLYLETASSGAPNENIPGTNGAGRLYQGYVETSNVNVVEEMVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +E +DEM + +T++
Sbjct: 240 YEINSKAVETSDEMLARLTQL 260


>gi|88811803|ref|ZP_01127057.1| hypothetical protein NB231_05340 [Nitrococcus mobilis Nb-231]
 gi|88791194|gb|EAR22307.1| hypothetical protein NB231_05340 [Nitrococcus mobilis Nb-231]
          Length = 261

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 110/258 (42%), Positives = 160/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQQT +  +ANN+AN+NTTG+K+ RA+F D +YQ  + AG   QS+    
Sbjct: 4   ALWVAKTGLDAQQTRMSTVANNLANVNTTGFKKDRAKFEDLVYQTVRQAG--GQSSQNNR 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++++ + ++TQG +V TGN LDLA+ GRG+F++  PD T+ YTR GSF 
Sbjct: 62  LPSGLMLGTGVRVAATQKMFTQGNIVQTGNALDLAINGRGFFEILQPDGTLAYTRDGSFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ID +GQ+VTADG  L P I IP   + + +   G +      +     VG L + +FIN 
Sbjct: 122 IDDQGQVVTADGLPLQPAINIPPNAQSVTIGTDGTVSVQLPGSPAPTQVGNLRLTDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG NL  +T  SG P    P   G   V+ G LE+SNV+  +E+  MI  QR +E
Sbjct: 182 AGLKPIGRNLFVQTGASGAPQPGTPGLNGLGLVQAGALESSNVNIAEELVNMIETQRGFE 241

Query: 243 MNSKVIEAADEMSSLITK 260
            N++ I+ AD+M   IT 
Sbjct: 242 TNTRAIQTADQMLQFITN 259


>gi|121602345|ref|YP_989400.1| flagellar basal body rod protein FlgG [Bartonella bacilliformis
           KC583]
 gi|120614522|gb|ABM45123.1| flagellar basal-body rod protein FlgG [Bartonella bacilliformis
           KC583]
          Length = 264

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 133/263 (50%), Positives = 187/263 (71%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GM+AQQTNL++IANN+ANINTTGYKRARAEFAD +Y  ++  G P+   ++
Sbjct: 3   MRSLSIAATGMAAQQTNLDVIANNLANINTTGYKRARAEFADLMYVTDRAVGVPNM-MNQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG+ +G GV+ ++VR V TQG  + TGN LDLA+ G GWF+++ P+  V YTR+G+
Sbjct: 62  AIVPEGVMVGMGVRTAAVRTVNTQGAFIQTGNALDLAINGNGWFEIQDPNGNVFYTRSGA 121

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN+   GQ+VT DGN + P I IP  ++ I VS  G +     + +D    G+L + NF+
Sbjct: 122 FNLSETGQVVTLDGNVVQPAITIPIGSKSITVSPDGTVFYKPAEEADPVEAGRLNLVNFV 181

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  +GDNL   T  SG P+  NP + G+  + Q  LEASNVD VKEI+E+I+AQR+
Sbjct: 182 NEVGLEPVGDNLFRETPASGAPVPGNPKEDGYGSIMQATLEASNVDPVKEITELITAQRS 241

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEM SKVI+A+DEM+++++  +R
Sbjct: 242 YEMTSKVIQASDEMAAVVSKNLR 264


>gi|170748107|ref|YP_001754367.1| flagellar basal body rod protein FlgG [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654629|gb|ACB23684.1| flagellar basal-body rod protein FlgG [Methylobacterium
           radiotolerans JCM 2831]
          Length = 262

 Score =  233 bits (593), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 133/260 (51%), Positives = 188/260 (72%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ N+E+IANNI+N+NTT +K ARAEF D +YQAE+ AG P Q+ + 
Sbjct: 1   MRALAIAATGMNAQQLNVEVIANNISNLNTTAFKAARAEFKDLIYQAERPAGVPIQAGES 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+ PEG  +G GV+ +++RN++ QG + +T N LDLA+ GRGWFQV  P+  + YTRAGS
Sbjct: 61  AI-PEGAMLGLGVRNTAIRNLHRQGPLNNTTNPLDLAINGRGWFQVTMPNGEINYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G+LVTA+G ++ P I+IP+   ++ ++ +GQ++         Q +GQL +ANF 
Sbjct: 120 FNKNADGRLVTAEGYSVDPAIIIPQNAIDVVINETGQVMVKVDGQQLPQTIGQLQLANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  +G+ L   T+ SG P+     D GF  ++QGYLE SNVD V+EI+ +ISAQRA
Sbjct: 180 NDAGLEPLGNGLYRETAASGLPVTGFAADPGFGKIQQGYLETSNVDPVREITNLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +EMNSKVI+AADEM+  I+K
Sbjct: 240 FEMNSKVIQAADEMAGTISK 259


>gi|149927800|ref|ZP_01916051.1| flagellar basal body rod protein FlgG [Limnobacter sp. MED105]
 gi|149823422|gb|EDM82653.1| flagellar basal body rod protein FlgG [Limnobacter sp. MED105]
          Length = 260

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+ AQQT L++I+NN+AN  T G+KR+RA F D LYQ  +  G  +Q+ ++
Sbjct: 2   MRSLWIAKTGLDAQQTQLDVISNNLANTATNGFKRSRAVFEDLLYQTLRQPG--AQTTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ IG+GV+  S    + QG +  TGN LD+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TQVPSGLQIGTGVKPVSTVRNFAQGNLQQTGNTLDVAINGQGFFQVQMPDGTTSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
             ID+ G LVT++G  ++  + IP+  +EI +S+ G + AV       Q +GQ+ +A+F+
Sbjct: 120 IQIDANGTLVTSNGYPVLGPVTIPQGVQEISISQDGVVSAVVQGQVQPQELGQIQLASFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G NL + T+ SG P  +     G   V QG++E SNV+ V+E+  +I AQRA
Sbjct: 180 NPAGLFSMGQNLYSETAASGAPTQAVAGTNGVGFVSQGFVETSNVNVVEELVGLIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   ++++
Sbjct: 240 YEINSKAISTSDQMLQRLSQL 260


>gi|317050615|ref|YP_004111731.1| flagellar basal-body rod protein FlgG [Desulfurispirillum indicum
           S5]
 gi|316945699|gb|ADU65175.1| flagellar basal-body rod protein FlgG [Desulfurispirillum indicum
           S5]
          Length = 262

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 166/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   A+ GM AQQT+++ I+NN+AN+NT G+K++R EF D +YQ  K AG  + +A  
Sbjct: 2   IRALWTASTGMMAQQTHIDNISNNLANVNTGGFKKSRVEFQDLMYQTIKPAG--ASTAAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G  +G GV+++ +  ++TQG ++ TGN LD+ +   G+FQ++ PD T  YTR G+
Sbjct: 60  ITRPVGEQLGLGVKVAGITKMHTQGSIIQTGNQLDMTIEKDGYFQIQMPDGTTGYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  ++ G++VT +G  L PGI IP++  EI V R G +    G  +  Q +GQ+  A FI
Sbjct: 120 FTKNNNGEIVTVEGFLLEPGIQIPDDAVEIYVGRDGTVSVQIGNQNQMQELGQITTAKFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G N+   TS SG P +  P +  F  + QG+LE SNV  V+E+  MISAQRA
Sbjct: 180 NPAGLESVGGNIFKETSASGAPQVGIPGEDSFGAIAQGFLEQSNVQLVEEMVNMISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I   DEM    T+++
Sbjct: 240 YEINSKAITTGDEMLQTATQLK 261


>gi|302383956|ref|YP_003819779.1| flagellar basal-body rod protein FlgG [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194584|gb|ADL02156.1| flagellar basal-body rod protein FlgG [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 262

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 130/262 (49%), Positives = 177/262 (67%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+E+I+NNIAN+NT GYKR RAEF D +YQ  +  G+ S S+  
Sbjct: 1   MRALRTAASGMAAQQLNVEVISNNIANMNTVGYKRQRAEFQDLIYQNVERMGAQS-SSQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP GI +G GV+  SV  +  QG    TG++ D+A+ G+G+FQ+  P   + YTRAG+
Sbjct: 60  TVVPTGIQVGLGVKAGSVYRITEQGTPTQTGSDYDVAIDGQGYFQITMPSGEIGYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++  +GQLVT DG  + P I IP++  ++ +S++GQ+  +T  + +   VGQL +A F 
Sbjct: 120 FSLSGEGQLVTEDGYAVEPAISIPQDAIDVTISKTGQVQVITAGSPEPAIVGQLELATFF 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNLL  T+ SG      P + GF  + QGY EASNVDAV EIS +I AQRA
Sbjct: 180 NEAGLEAIGDNLLLETAASGPATTGTPGETGFGQLLQGYTEASNVDAVTEISALIIAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  ADEM S+  +++
Sbjct: 240 YEMNSKVITTADEMMSVSAQVK 261


>gi|256830176|ref|YP_003158904.1| flagellar basal-body rod protein FlgG [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579352|gb|ACU90488.1| flagellar basal-body rod protein FlgG [Desulfomicrobium baculatum
           DSM 4028]
          Length = 260

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 165/262 (62%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A+GM AQQ NL++ ANN+AN+NTTG+K+ RAEF D +YQ  K+AGS +Q  D+
Sbjct: 2   IRALWTSASGMIAQQLNLDVTANNLANVNTTGFKKNRAEFEDLMYQNMKIAGSSNQEGDR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  SV  ++TQG+  +TGN LDL + G G+F+V        YTR+G+
Sbjct: 62  --LPVGMQVGMGVRPVSVHKIFTQGDFQNTGNQLDLVIEGDGFFRV-DRGGEESYTRSGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS G++VT +G+ L P  ++P ET+ I V+  G++  V    ++      + +  F+
Sbjct: 119 FKLDSDGRIVTDNGHPLQPEFIVPPETQNIVVTEDGRLTCVDKAGAEI-AGTDIPVYTFV 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ +G NL  +T  SG+ + S P +     + QG+LE SNV+ V+E+  MI  QRA
Sbjct: 178 NPAGLKAMGRNLYVQTDGSGEAVESVPGENNAGTLAQGFLEMSNVEIVEEMVNMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  AD M     +++
Sbjct: 238 YEANSKSITTADMMLQTANQLK 259


>gi|39998142|ref|NP_954093.1| flagellar basal body rod protein FlgG [Geobacter sulfurreducens
           PCA]
 gi|39985088|gb|AAR36443.1| flagellar basal-body rod protein FlgG [Geobacter sulfurreducens
           PCA]
 gi|298507079|gb|ADI85802.1| flagellar basal body rod protein FlgG [Geobacter sulfurreducens
           KN400]
          Length = 262

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 165/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQTN++++ANN+AN+NT G+K++RA+F D +YQ  K +G+PS S+  
Sbjct: 2   IRALWTAASGMQAQQTNIDVVANNLANVNTAGFKKSRADFQDLMYQNLKTSGAPSTSS-- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG G ++++V  ++++G +  TGN LD+A+ G G+FQ++ PD T  Y+RAGS
Sbjct: 60  TQVPSGIQIGLGAKLAAVTKLFSEGNINQTGNELDIAIEGDGFFQIQMPDGTTTYSRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D +G++VT+DG  ++P +V+P     I V   G +       +    +G + +A F 
Sbjct: 120 FKRDDQGRVVTSDGYPMLPELVVPSNATSISVGNDGTVSVTQAGQTSPTNIGNIQLATFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL  +G NL   +  SG P    P   G   + QG+LE SNV  ++E+  MI  QRA
Sbjct: 180 NPSGLTALGRNLFQESDSSGTPTTGTPGQNGIGTLAQGFLEMSNVSVMEEMVNMIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK ++AADEM      +R
Sbjct: 240 YEVNSKAVQAADEMLQQANNLR 261


>gi|300693340|ref|YP_003749313.1| flgg: flagellar basal-body rod protein [Ralstonia solanacearum
           PSI07]
 gi|299075377|emb|CBJ34672.1| FlgG: Flagellar basal-body rod protein [Ralstonia solanacearum
           PSI07]
          Length = 260

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQ+ L++I+NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLLYQNVREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +I +   ++TQG +  TGN+ D A+ G G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQIGTGTRIVATERLHTQGNLQQTGNSTDAAINGNGFFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I+++GQLVT+ G  + P I +P+    + +++ G +   T  + +   VG   +ANFI
Sbjct: 120 FQINAQGQLVTSSGYPVQPAITVPQNATSLTIAKDGVVTVTTPGSVNSTQVGTFQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++ P   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLRSMGENLYAETEASGTANLAAPGANGIGVLNQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   + ++
Sbjct: 240 YEINSKAVQTSDQMLEKLAQL 260


>gi|289577407|ref|YP_003476034.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter italicus
           Ab9]
 gi|289527120|gb|ADD01472.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter italicus
           Ab9]
          Length = 266

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 105/268 (39%), Positives = 150/268 (55%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAASGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQRENI----YGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +T+G +  T N LDLAL G G+F V  PD TV YTR GS
Sbjct: 58  QGRPVNMQVGVGVRPSAIVKDFTEGSLQQTDNPLDLALDGEGFFAVLGPDGTVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVP------GIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQL 174
           F + + G  +        P        ++ + T +        +++V   N   + V  L
Sbjct: 118 FKLSADGNTLMLVTADGYPVLDDRGNPIVFDRTEKDISVSPLGVISVKNANGTTREVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G+NL   T  SG P   +  +     V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFVNPQGLLSVGNNLYEPTEASGQPGTRDDFEGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|17548568|ref|NP_521908.1| flagellar basal-body rod protein FlgG [Ralstonia solanacearum
           GMI1000]
 gi|17430816|emb|CAD17498.1| probable flagellar basal-body rod protein flgg (distal rod protein)
           [Ralstonia solanacearum GMI1000]
          Length = 260

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQ+ L++I+NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLLYQNVREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +I +   ++TQG +  TGN+ D+A+ G G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQIGTGTRIVATERLHTQGNLQQTGNSTDVAINGNGFFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I+++GQLVT+ G  + P I +P+    + V++ G +   T    +   VG   +ANFI
Sbjct: 120 FQINAQGQLVTSSGYPVQPAITVPQNATSLTVAKDGTVTVTTPGAVNSTQVGTFQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++ P   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLRSMGENLYAETEASGTANLAAPGSNGIGVLNQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   + ++
Sbjct: 240 YEINSKAVQTSDQMLEKLAQL 260


>gi|83747652|ref|ZP_00944688.1| FlgG [Ralstonia solanacearum UW551]
 gi|207728348|ref|YP_002256742.1| flagellar basal-body rod protein flgg (distal rod protein)
           [Ralstonia solanacearum MolK2]
 gi|207739735|ref|YP_002258128.1| flagellar basal-body rod protein flgg (distal rod protein)
           [Ralstonia solanacearum IPO1609]
 gi|300696915|ref|YP_003747576.1| FlgG: flagellar basal-body rod protein [Ralstonia solanacearum
           CFBP2957]
 gi|83725704|gb|EAP72846.1| FlgG [Ralstonia solanacearum UW551]
 gi|206591594|emb|CAQ57206.1| flagellar basal-body rod protein flgg (distal rod protein)
           [Ralstonia solanacearum MolK2]
 gi|206593117|emb|CAQ60023.1| flagellar basal-body rod protein flgg (distal rod protein)
           [Ralstonia solanacearum IPO1609]
 gi|299073639|emb|CBJ53159.1| FlgG: Flagellar basal-body rod protein [Ralstonia solanacearum
           CFBP2957]
          Length = 260

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQ+ L++I+NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLLYQNVREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +I +   ++TQG +  TGN+ D+A+ G G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQIGTGTRIVATERLHTQGNLQQTGNSTDVAINGNGFFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I+++GQLVT+ G  + P + +P+    + +++ G +   T    +   VG   +ANFI
Sbjct: 120 FQINAQGQLVTSSGYPVQPAVTVPQNATSLTIAKDGTVTVTTPGAVNSTQVGTFQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++ P   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLRSMGENLYAETEASGTANLAAPGANGVGVLNQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   + ++
Sbjct: 240 YEINSKAVQTSDQMLEKLAQL 260


>gi|118475132|ref|YP_891713.1| flagellar basal body rod protein FlgG [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414358|gb|ABK82778.1| flagellar basal-body rod protein FlgG [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 262

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 166/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQT ++  ++NIAN+NT GYK+ RAEFAD +YQ  + AG+P+ +   
Sbjct: 2   IRSLYTAATGMVAQQTQIDTTSHNIANVNTIGYKKNRAEFADLMYQTMQYAGTPTSTTTM 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +    G+ +G GV+ +++  V+ QG    TGNNLD+ + G G+FQ++ PD T  YTR G+
Sbjct: 62  SPT--GMEVGLGVRPTAITKVFGQGYFKETGNNLDMVIAGNGFFQIQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  G +V +DG  L+P + IP +  +I V   G +  +   N +   +GQ+ +ANFI
Sbjct: 120 FKLDGDGNIVNSDGYRLLPEMNIPADATQISVGVDGTVSVLQPGNQEMTQIGQIELANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL  +GDN    T+ SG P I N    GF  +KQG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPSGLHAMGDNNFLETAASGAPNIGNGGTDGFGQIKQGFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  ADEM   + +++
Sbjct: 240 YEANSKAITTADEMLQTVNQLK 261


>gi|319764541|ref|YP_004128478.1| flagellar basal-body rod protein flgg [Alicycliphilus denitrificans
           BC]
 gi|317119102|gb|ADV01591.1| flagellar basal-body rod protein FlgG [Alicycliphilus denitrificans
           BC]
          Length = 260

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  GMSAQQT L++I++N+AN++TTG+KR  A F D +YQ  +  G  +Q+ ++
Sbjct: 2   INSLWIAKTGMSAQQTQLDVISHNLANVSTTGFKRNSAVFEDLIYQNLRQVG--AQTTEE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    +TQG +  + N+LD+A+ G G+F+V+ PD T+ YTR GS
Sbjct: 60  NQLPTGLHLGLGVRTVATSRHFTQGSLQQSSNSLDVAINGNGFFEVQLPDGTIGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VT+ G  +  GI +P+    I +S +G + A    N+  Q +GQL +++FI
Sbjct: 120 FQLDAQGRMVTSGGLPVANGITVPQGATSISISETGVVSATIAGNAQPQQLGQLAMSSFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ +G N+   ++ SG P    P   G   +KQG+LE SNV+ V+E+  MI  QRA
Sbjct: 180 NAAGLQPVGQNMYKESAASGPPQQGQPGTNGLGVIKQGFLETSNVNVVEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + ++++
Sbjct: 240 YEMNSKAIQTSDQMLAKLSQL 260


>gi|294679031|ref|YP_003579646.1| flagellar basal-body rod protein FlgG [Rhodobacter capsulatus SB
           1003]
 gi|294477851|gb|ADE87239.1| flagellar basal-body rod protein FlgG [Rhodobacter capsulatus SB
           1003]
          Length = 261

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 120/262 (45%), Positives = 166/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN+AN++TTGY   RAEFAD +YQ     G+ + + D 
Sbjct: 1   MRALQIAATGMSAQQMRVEVISNNLANMSTTGYNARRAEFADLMYQQATRPGTIT-ANDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ IG GV+ ++V     QG +  TG +LDLA+ G G+ +V  P     YTR G 
Sbjct: 60  TIVPAGVQIGLGVRSTAVSITLAQGPLASTGGDLDLAIDGYGFLEVTLPSGASAYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               + GQ+VT+DG  +VPGI +P++   I ++ +G++ A        Q +GQ+ +A F 
Sbjct: 120 LKRSADGQIVTSDGYPVVPGITLPDDATTISINAAGEVYAYFTNQVQPQLLGQITLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG NL   T  SG P ++ P   G   +KQGYLE S+VDAV+EI+E+I AQR 
Sbjct: 180 NEKGLEAIGSNLFLETEASGAPTVAAPGTDGLGVIKQGYLEESSVDAVREITELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI AADEM    T++R
Sbjct: 240 YEMNAKVITAADEMLQATTQVR 261


>gi|329888226|ref|ZP_08266824.1| flagellar basal-body rod protein FlgG [Brevundimonas diminuta ATCC
           11568]
 gi|328846782|gb|EGF96344.1| flagellar basal-body rod protein FlgG [Brevundimonas diminuta ATCC
           11568]
          Length = 262

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 132/262 (50%), Positives = 178/262 (67%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+E+I+NNIAN+NT G+KR RAEF D LYQ  +  G+ S S+  
Sbjct: 1   MRALRTAATGMAAQQLNVEVISNNIANMNTVGFKRQRAEFQDLLYQNVERMGAQS-SSQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP GI IGSGV+  SV  +  QG    TGN  D+A+ G+G+FQ+  P   + YTRAG+
Sbjct: 60  TVVPTGIQIGSGVKAGSVYRITEQGSPNRTGNTYDIAIQGKGYFQITLPSGELAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++ +GQLVT DG  + P I IP++  ++ +S+SGQ+   T   ++ Q VGQL +A F 
Sbjct: 120 FTVNGEGQLVTDDGYAVEPAIAIPQDALDVSISKSGQVQVTTAGQTEPQVVGQLELATFF 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNLL  T+ SG   +  P ++G+ ++ Q Y EASNVDAV EI+ +I AQRA
Sbjct: 180 NEAGLEAIGDNLLLETAASGPATVGAPGEVGYGNLLQHYTEASNVDAVSEITALIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  ADEM S+  +++
Sbjct: 240 YEMNSKVITTADEMLSVSAQVK 261


>gi|261886055|ref|ZP_06010094.1| flagellar basal body rod protein FlgG [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 262

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 166/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQT ++  ++NIAN+NT GYK+ RAEFAD +YQ  + AG+P+ +   
Sbjct: 2   IRSLYTAATGMVAQQTQIDTTSHNIANVNTIGYKKNRAEFADLMYQTMQYAGTPTSTTTM 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +    G+ +G GV+ +++  V+ QG    TGNNLD+ + G G+FQ++ PD T  YTR G+
Sbjct: 62  SPT--GMEVGLGVRPTAITKVFGQGYFKETGNNLDMVIAGNGFFQIQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  G +V +DG  L+P + IP +  +I V   G +  +   N +   +GQ+ +ANFI
Sbjct: 120 FKLDGDGSIVNSDGYRLLPEMNIPADATQISVGVDGTVSVLQPGNQEMTQIGQIELANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL  +GDN    T+ SG P I N    GF  +KQG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPSGLHAMGDNNFLETAASGAPNIGNGGTDGFGQIKQGFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  ADEM   + +++
Sbjct: 240 YEANSKAITTADEMLQTVNQLK 261


>gi|57505521|ref|ZP_00371448.1| flagellar basal-body rod protein (flgG) [Campylobacter upsaliensis
           RM3195]
 gi|57016068|gb|EAL52855.1| flagellar basal-body rod protein (flgG) [Campylobacter upsaliensis
           RM3195]
          Length = 263

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 100/263 (38%), Positives = 163/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNI+N+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNISNVNTVGFKKSRAEFADLMYQTMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNN-LDLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  ++T G    T  +  D+A+ G G+FQ++ PD T  YTR G
Sbjct: 60  TLSPSGIEVGLGVRPTAVTKIFTPGSYKSTSTDSFDMAIEGNGFFQIQLPDGTTAYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V ADG  L+P + +PE    I +++ G +  +     +   +GQ+ +  F
Sbjct: 120 QFTRDNEGNVVNADGYRLIPEMTVPEGATNISIAKDGTVSVMLAGEQEETQIGQIELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G  +++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGNIRHGFVELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +DEM  ++ +++
Sbjct: 240 AYEAGSKAITTSDEMLGIVNQLK 262


>gi|319898637|ref|YP_004158730.1| flagellar basal-body rod protein flgG (Distal rod protein)
           [Bartonella clarridgeiae 73]
 gi|319402601|emb|CBI76146.1| Flagellar basal-body rod protein flgG (Distal rod protein)
           [Bartonella clarridgeiae 73]
          Length = 264

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 133/263 (50%), Positives = 186/263 (70%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MK+  IAA GM+AQQTNL++IANN+ANINTTG+KR RAEFAD +Y A++  G P+   ++
Sbjct: 3   MKSLSIAATGMAAQQTNLDVIANNMANINTTGFKRGRAEFADLMYVADRAVGIPNM-LNQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A++PEG  IG GV+ ++VR V TQG  V TGN LDLA+ G GWF+++ P+  V YTR+G+
Sbjct: 62  AIIPEGAMIGMGVRTAAVRTVNTQGAFVQTGNALDLAINGNGWFEIQDPNGNVFYTRSGA 121

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN+   GQ++T DGN + P I IP  ++ + VS  G +   T  +      G+L + NF+
Sbjct: 122 FNLSETGQIITLDGNLVQPVITIPIGSKNVTVSPDGTVYYQTDADPSAVEAGRLRLVNFV 181

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDNL   T  SG P+  +P D G+  + Q  LE+SNVD VKE++E+I+AQR+
Sbjct: 182 NEVGLEPIGDNLFRETQASGAPVPGDPKDDGYGSIMQAMLESSNVDPVKEMTELIAAQRS 241

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+A+DEM+++I+  +R
Sbjct: 242 YEMNSKVIQASDEMAAVISKNLR 264


>gi|299068734|emb|CBJ39973.1| FlgG: Flagellar basal-body rod protein [Ralstonia solanacearum
           CMR15]
          Length = 260

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQ+ L++I+NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLLYQNVREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +I +   ++TQG +  TGN+ D+A+ G G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQIGTGTRIVATERLHTQGNLQQTGNSTDVAINGNGFFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I+++GQLVT+ G  + P + +P+    + V++ G +   T    +   VG   +ANFI
Sbjct: 120 FQINAQGQLVTSSGYPVQPAVTVPQNATSLTVAKDGTVTVTTPGAVNSTQVGTFQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++ P   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLRSMGENLYAETEASGTANLAAPGANGVGVLNQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   + ++
Sbjct: 240 YEINSKAVQTSDQMLEKLAQL 260


>gi|315637964|ref|ZP_07893150.1| flagellar basal-body rod protein FlgG [Campylobacter upsaliensis
           JV21]
 gi|315481999|gb|EFU72617.1| flagellar basal-body rod protein FlgG [Campylobacter upsaliensis
           JV21]
          Length = 263

 Score =  232 bits (591), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 101/263 (38%), Positives = 163/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNI+N+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNISNVNTVGFKKSRAEFADLMYQTMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNN-LDLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T G    T  +  D+A+ G G+FQ++ PD T  YTR G
Sbjct: 60  TLSPSGIEVGLGVRPTAVTKVFTPGSYKSTSTDSFDMAIEGNGFFQIQLPDGTTAYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V ADG  L+P + +PE    I +++ G +  +     +   +GQ+ +  F
Sbjct: 120 QFTRDNEGNVVNADGYRLIPEMTVPEGATNISIAKDGTVSVMLAGEQEETQIGQIELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G  +++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGNIRHGFVELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +DEM  ++ +++
Sbjct: 240 AYEAGSKAITTSDEMLGIVNQLK 262


>gi|218778846|ref|YP_002430164.1| flagellar basal body rod protein FlgG [Desulfatibacillum
           alkenivorans AK-01]
 gi|218760230|gb|ACL02696.1| Flagellar basal-body rod protein FlgG [Desulfatibacillum
           alkenivorans AK-01]
          Length = 260

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 158/262 (60%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++    AA GM AQQ N+++++NN+ANINTT +KR+R +F D +YQ  +VAG  + +   
Sbjct: 2   LRGLWTAATGMEAQQLNIDVVSNNLANINTTAFKRSRPDFQDLMYQTIRVAG--ATTTGG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G G + + V+ ++ QG+   TGN+LD A+ G G+F+V + ++ V  TRAGS
Sbjct: 60  TQLPTGLQVGMGSKPTGVQKIFVQGDYSQTGNDLDWAIEGNGFFKVLSNNEEVY-TRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F IDS+G + TA G  L P   +P +   I V   G++ A    N +      + + +F 
Sbjct: 119 FKIDSEGYITTAAGERLQPEFAVPADAVLISVDSGGKLTAFGPANEEV-ATYDITLYDFA 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G NL   T  SG+ +   P D GF  + QG+LE SNV+ V+E+  MI AQRA
Sbjct: 178 NPAGLYSMGRNLYKTTEASGEEVEGTPGDEGFGTISQGFLEMSNVNVVEEMVTMIIAQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+ AD M  +   ++
Sbjct: 238 YEANSKAIQTADSMLQIANNVK 259


>gi|283953936|ref|ZP_06371465.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794541|gb|EFC33281.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 262

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 102/263 (38%), Positives = 163/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 1   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKSRAEFADLMYQVMKYAG--TSTSAT 58

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 59  TLSPSGIEVGVGVRPTAVTKVFTEGNLKSTSTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 118

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 119 QFTKDNEGNIVNSDGYRLLPEMTIPEGAIAINVATDGTVSVMLPGEQQETQIGQVELVQF 178

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 179 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 238

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 239 AYEAGSKAITTSDDMLGIVNQLK 261


>gi|187926952|ref|YP_001893297.1| flagellar basal-body rod protein FlgG [Ralstonia pickettii 12J]
 gi|241665281|ref|YP_002983640.1| flagellar basal-body rod protein FlgG [Ralstonia pickettii 12D]
 gi|187728706|gb|ACD29870.1| flagellar basal-body rod protein FlgG [Ralstonia pickettii 12J]
 gi|240867308|gb|ACS64968.1| flagellar basal-body rod protein FlgG [Ralstonia pickettii 12D]
          Length = 260

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQ+ L++I+NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLLYQNVREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+I +   ++TQG +  TGN  D+A+ G G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQIGTGVRIVATERLHTQGNLQQTGNATDVAINGNGFFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++++GQLVT+ G  + P I +P+      V + G +   T  + +   VG   +ANFI
Sbjct: 120 FQVNAQGQLVTSSGYPIQPAITVPQNATSFSVGKDGVVTVTTPGSVNNTQVGTFQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++NP   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLRSMGENLYAETEASGTANLANPGSNGVGVLNQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   ++++
Sbjct: 240 YEINSKSVQTSDQMLEKLSQL 260


>gi|319409187|emb|CBI82831.1| Flagellar basal-body rod protein flgG [Bartonella schoenbuchensis
           R1]
          Length = 264

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 133/263 (50%), Positives = 183/263 (69%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IAA GM+AQQTNL++IANN+ANINTTG+KRARAEFAD +Y A++  G P+   ++
Sbjct: 3   MRSLSIAATGMAAQQTNLDVIANNLANINTTGFKRARAEFADLMYVADRAVGVPNM-LNQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG  IG GV+ ++VR V  QG  V TGN LDLA+ G GWF+V+ P+  V YTR+G+
Sbjct: 62  AIVPEGAMIGMGVRTAAVRKVNMQGAFVQTGNALDLAINGNGWFEVQDPNGNVFYTRSGA 121

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN+   GQ+ T DGN + P I IP  ++ I VS  G +   T  +      G+L + NF+
Sbjct: 122 FNLSETGQIETLDGNLVQPAITIPIGSKNITVSPDGTVYYQTDMDPTPVEAGRLNLVNFV 181

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +GDNL   T  SG P+   P D G+  + Q  LE+SNVD VKEI+E+I+AQR+
Sbjct: 182 NAVGLEAVGDNLFRETPASGAPVPGFPKDDGYGGIMQAMLESSNVDPVKEITELIAAQRS 241

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+A+DEM+++++  +R
Sbjct: 242 YEMNSKVIQASDEMAAVVSKNLR 264


>gi|117926379|ref|YP_866996.1| flagellar basal-body rod protein FlgG [Magnetococcus sp. MC-1]
 gi|117610135|gb|ABK45590.1| flagellar basal-body rod protein FlgG [Magnetococcus sp. MC-1]
          Length = 263

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 118/262 (45%), Positives = 171/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A GM AQQTN+++IANN+AN NT G+KR+RA+F D LYQ  + AG+ + S   
Sbjct: 2   IRALWTSATGMQAQQTNIDVIANNLANTNTAGFKRSRADFQDLLYQNMRAAGAAT-SQAG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI +G GV+  SV  ++TQG+ V TGN LD+A+ G+G+FQ++ PD +  YTR G+
Sbjct: 61  NQVPVGIQLGHGVRTVSVSKMFTQGDYVQTGNELDMAIEGKGFFQIQMPDGSTAYTRDGT 120

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ GQ+VTADG  L PG+ +P+    + V   G +   T   +D   VGQ+ +A FI
Sbjct: 121 FKLDNSGQIVTADGYVLDPGLTLPQNATNVAVGPDGTVAVKTPDQADLTQVGQIQLAQFI 180

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   +  SG P++    + G   V+Q YLE SNV+ V+E+  MI++QRA
Sbjct: 181 NPAGLNAIGRNLYTESGASGAPVVGTAGEDGLGTVQQQYLELSNVNMVEEMVNMIASQRA 240

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK ++ AD+M   +  M+
Sbjct: 241 YEINSKTVQTADDMLGKVASMK 262


>gi|332525064|ref|ZP_08401244.1| flagellar basal-body rod protein FlgG [Rubrivivax benzoatilyticus
           JA2]
 gi|332108353|gb|EGJ09577.1| flagellar basal-body rod protein FlgG [Rubrivivax benzoatilyticus
           JA2]
          Length = 260

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  GM  QQT L++I+NN+AN+ T G+KR   +F D +YQ  + AG  + S+++
Sbjct: 2   LRSLWIAKTGMEGQQTKLDVISNNLANVGTNGFKRGGVQFEDLIYQNLRQAG--AASSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + +P G+ +G GV+ +     ++QG +  TGN+ D+A+ G G+FQ++ PD T  YTR G 
Sbjct: 60  STLPTGLQVGLGVRAAGTTRNFSQGNLQQTGNSYDIAIKGNGFFQIQMPDGTTGYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ GQLVT  G  + PGI IP + + + V+  G +   T  N+    VGQL +ANFI
Sbjct: 120 FQVDNAGQLVTNQGYPVQPGITIPADAKTVTVADDGTVQVTTAGNATPTTVGQLQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G NL A T+ SG P    P       ++QG++E SNV+ V+E+  MI+ QRA
Sbjct: 180 NPAGLESLGGNLYAETAASGTPNTGTPGTNELGALQQGFVETSNVNVVEELVNMIATQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I+ +D+M   + ++
Sbjct: 240 YELNSKAIQTSDQMLQKLGQL 260


>gi|45657204|ref|YP_001290.1| flagellar basal body rod protein FlgG [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45600442|gb|AAS69927.1| FlgG [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
          Length = 265

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 107/265 (40%), Positives = 165/265 (62%), Gaps = 5/265 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ +++ I+NN+AN+NTTG+K+ RA+F D +YQ + +AG+P+ S   
Sbjct: 2   MRSLWTAATGMIAQQFHIDTISNNLANVNTTGFKKNRADFEDLVYQHQVLAGTPATSVS- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVG-RGWFQVETPDKTVMYTRAG 119
             +P G+++G GV+ ++ + ++  G    TGN LD+A+ G  G+F+++ PD +  +TR G
Sbjct: 61  -EIPTGVNVGHGVRAAASQKLFEIGSFQATGNKLDMAITGEMGFFKIQMPDGSFAFTRDG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
           SF IDS  Q+VT++G  L P +++PE      + +S  G++    G +     +GQ+ + 
Sbjct: 120 SFKIDSNQQVVTSNGYLLEPPLILPEGAILNTLMISEQGEVTVKVGADIRPIVIGQVELY 179

Query: 178 NFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISA 237
            F+N AGL+ IG NL   T  SG  I   P   GF +V QG+LE SNV  V+E+  MI A
Sbjct: 180 RFVNPAGLQAIGKNLFQETVASGPEIPGTPGMEGFGNVLQGFLEMSNVKIVEEMVAMIVA 239

Query: 238 QRAYEMNSKVIEAADEMSSLITKMR 262
           QRAYE NSK I+ +D M S    ++
Sbjct: 240 QRAYESNSKAIQTSDNMLSTAISLK 264


>gi|255261552|ref|ZP_05340894.1| flagellar basal-body rod protein FlgG [Thalassiobium sp. R2A62]
 gi|255103887|gb|EET46561.1| flagellar basal-body rod protein FlgG [Thalassiobium sp. R2A62]
          Length = 261

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 165/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ  +E+I+NN+AN+NTTGY   RAEFAD  YQ     G+ + +AD 
Sbjct: 1   MRALQIAATGMAAQQMRVEVISNNLANMNTTGYNARRAEFADLHYQQIARPGTIN-AADG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V  + +QG +  TG +LD+A+ G G+ +V  P+    YTR G 
Sbjct: 60  TVLPTGVQLGLGVRPTAVSMILSQGALSATGGDLDVAIEGEGYLEVTLPNGNAAYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                 G +VT+DG  +VP I IP + R I ++  G+I        + + +GQ  ++ F 
Sbjct: 120 LKRTGDGLIVTSDGFPVVPDITIPRDARSISINAEGEIYGYFTDRVEPELLGQFTLSGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG+NL   TS SG  I++ P   G   ++QGYLE S+VD VKE++++I AQR 
Sbjct: 180 NPRGLEAIGNNLFLETSASGPSIVTEPGQDGLGVLRQGYLEDSSVDPVKEVTDLIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M S + ++R
Sbjct: 240 YELNSKVITAADQMLSSMVQIR 261


>gi|297182936|gb|ADI19085.1| flagellar basal body rod protein [uncultured delta proteobacterium
           HF0070_15B21]
          Length = 262

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 113/261 (43%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N++  ANN+AN+NTTGYK+++  F D LY  E+ AG PS  +  
Sbjct: 2   MRALYTAATGMAAQQRNIDTTANNLANVNTTGYKKSKVHFQDLLYHNERTAGVPSSVS-- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ +G GV+      ++TQG + +TGN+LDL++ G G+FQ+  P+  V Y+R G 
Sbjct: 60  TQVPVGLHVGHGVKFIGTEKIHTQGNLENTGNDLDLSIDGHGFFQILQPNGIVGYSRDGH 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FNID  G+LVT DG  L P I IP++TR+I+V   G +       +  + +G + +A F 
Sbjct: 120 FNIDGMGRLVTNDGMLLDPEINIPQDTRKIEVGFDGTVTVFLRDETMPEAIGSIQLARFQ 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +G NL   T  SG+ I+  P       + QG+LE SNV  V+E+  MI++QRA
Sbjct: 180 NPAGLTPLGKNLYVSTPASGNAIVDAPGASSMGTLTQGFLERSNVSLVEEMVNMITSQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I++ADEM      +
Sbjct: 240 YEVNSKAIQSADEMLKNTNNL 260


>gi|311280015|ref|YP_003942246.1| flagellar basal-body rod protein FlgG [Enterobacter cloacae SCF1]
 gi|308749210|gb|ADO48962.1| flagellar basal-body rod protein FlgG [Enterobacter cloacae SCF1]
          Length = 260

 Score =  232 bits (590), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQ+  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQILLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP  T  I + R G +       ++   VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGYQVQPAITIPANTLSITIGRDGVVSVTQQGQTNPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL +IG+NL   T  SG P  + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESIGENLYTETQASGAPNDTTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVTTTDQMLQKLTQL 260


>gi|307823533|ref|ZP_07653762.1| flagellar basal-body rod protein FlgG [Methylobacter tundripaludum
           SV96]
 gi|307735518|gb|EFO06366.1| flagellar basal-body rod protein FlgG [Methylobacter tundripaludum
           SV96]
          Length = 262

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 159/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A +G+ AQQT + +I+NN+AN+NTTG+KR RA F D +YQ  +  G  +QS    
Sbjct: 4   RALWVAKSGLDAQQTRMAVISNNLANVNTTGFKRGRAVFEDLMYQNIRQVG--AQSTQNT 61

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV+  +   ++TQG V  T N LD+A+ GRG+ Q+  P+    YTR GS 
Sbjct: 62  QLPTGLQLGTGVRTVATEKLHTQGNVQPTENALDVAINGRGFLQILMPNGDTNYTRDGSL 121

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +D+ GQLVT+ G TL P I +P++   + +   G + A+    +    +GQ+  ANFIN
Sbjct: 122 KLDATGQLVTSGGLTLNPAITVPQDALSVTIGTDGTVSALQPGVAAPTVLGQIQTANFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  +G+NL   ++ SG PI+  P    +  + QG LE SNV+ V+E+  MI  QRAY
Sbjct: 182 PTGLEAVGENLYRESAASGAPIVGTPGQAEYGTLTQGSLETSNVNVVEELVNMIETQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I   D+M S +T+
Sbjct: 242 EMNSKAISTTDQMLSFVTQ 260


>gi|91776311|ref|YP_546067.1| flagellar basal-body rod FlgG [Methylobacillus flagellatus KT]
 gi|91710298|gb|ABE50226.1| Flagellar basal-body rod FlgG [Methylobacillus flagellatus KT]
          Length = 261

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 159/262 (60%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQ  +++IANN+AN++T G+K+ RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWIAKTGLDAQQMQMDVIANNLANVSTNGFKKTRAVFEDLLYQNIRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++ QG +  TGNN D+A+ G G+FQV  PD +  YTR G+
Sbjct: 60  TQLPSGLQLGTGVRPVATERIHIQGNLQQTGNNKDVAISGEGFFQVLLPDGSTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
           F +D++GQLVTA G T+ P I++P     + V R G +  V   N +         +A F
Sbjct: 120 FQLDNQGQLVTASGFTVQPAIIVPPNALSLTVGRDGTVSVVLPDNPNNAVQIGTFQLATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL++ G+NL   T+ SG   I+ P   G   +   YLE SNV+  +E+  MI  QR
Sbjct: 180 INPAGLQSRGENLYIETAASGPANINQPGLNGTGLLVHQYLETSNVNVAEELVSMIQTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYE+NSK I  +D+M   ++++
Sbjct: 240 AYEINSKAISTSDQMLQRLSQL 261


>gi|89069818|ref|ZP_01157153.1| flagellar basal-body rod protein FlgG [Oceanicola granulosus
           HTCC2516]
 gi|89044619|gb|EAR50735.1| flagellar basal-body rod protein FlgG [Oceanicola granulosus
           HTCC2516]
          Length = 261

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 159/262 (60%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN+AN+NTTGY   RAEFAD  YQ     G+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQMRVEVISNNLANMNTTGYNARRAEFADLHYQQMMRPGTIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ +SV  +  QG +  TG +LD+A+ G G+ +V  PD    YTR G 
Sbjct: 60  TVLPTGVQLGLGVRPTSVSMMLAQGSLSSTGGDLDIAIEGSGYLEVALPDGRPGYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                 G +VTADG  + P I IP +   I ++  G++ A      + Q +GQ  IA F 
Sbjct: 120 LKRSGDGLIVTADGFPVAPEITIPRDALSISINPEGEVYAYFSDRVEAQLLGQFDIAGFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL   T  SG   ++ P   G   ++QG+LE S+VDAVKE++++I AQR 
Sbjct: 180 NPRGLEAVGSNLFVETEASGPANVTTPGQDGLGTLRQGFLEDSSVDAVKEVTDLIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M     ++R
Sbjct: 240 YELNSKVISAADQMLGATVQVR 261


>gi|254473318|ref|ZP_05086715.1| flagellar basal-body rod protein FlgG [Pseudovibrio sp. JE062]
 gi|211957434|gb|EEA92637.1| flagellar basal-body rod protein FlgG [Pseudovibrio sp. JE062]
          Length = 262

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 129/260 (49%), Positives = 178/260 (68%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQ NLE+I+NNIAN+NTT +K +RAEF+D LYQ ++ AG  S     
Sbjct: 1   MKALAIAATGMSAQQKNLEVISNNIANMNTTAFKASRAEFSDLLYQMDRAAGV-SNRGGA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A VPEGI  G GV+ +++R ++++G + HT N  DLA+ G+GWF+V  PD   +YTRAG+
Sbjct: 60  APVPEGIQQGLGVKTAAIRELHSKGPLNHTTNTFDLAIDGQGWFEVVGPDGEALYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN++ +G LVT DG  + PGI +P +  +I V+ SG++ A     +    +GQL + +F+
Sbjct: 120 FNVNGEGALVTLDGYEVQPGITVPIDAVKITVNESGEVFATYADGNPATSIGQLSLTSFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGLR IG NL   T  SG P      +     ++QGYLE +NVD VKEI+ +ISAQR 
Sbjct: 180 NDAGLRAIGGNLFRETEASGAPNTGIAGEGPLGVIRQGYLEGANVDPVKEITSLISAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI+AAD+M+  ++K
Sbjct: 240 YEMNSKVIQAADDMAGTVSK 259


>gi|119503646|ref|ZP_01625729.1| hypothetical protein MGP2080_03865 [marine gamma proteobacterium
           HTCC2080]
 gi|119460708|gb|EAW41800.1| hypothetical protein MGP2080_03865 [marine gamma proteobacterium
           HTCC2080]
          Length = 261

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 154/259 (59%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IA  G+ AQQT +  I+NN+AN  T G+KR R  F D LYQ  +  G  +QS+   
Sbjct: 3   QSLWIAKTGLDAQQTKMATISNNLANAGTNGFKRGRVIFEDLLYQNVRQVG--AQSSQDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           V+P G+ +G+G ++ +   ++TQG +  T N LDLA+ GRG+ +V  PD +  +TR GSF
Sbjct: 61  VLPSGLQVGTGARVVATERLFTQGNLSQTDNPLDLAIQGRGFVEVLMPDGSQGFTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+ +G +VTA G  + P I IP++   I ++  G +            VG + + +F+N
Sbjct: 121 QINDQGVMVTAAGYQVQPPITIPQDALSISIAPDGTVSVQQPGTPQATQVGVIQLTDFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+  G+NL   T  SG P+  NP   G   ++QG++E SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQARGENLFLETGASGAPLPGNPGLNGLGTLQQGFVEGSNVNVVEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I  AD+M   +++
Sbjct: 241 EMNSKAISTADQMLQYVSQ 259


>gi|116331368|ref|YP_801086.1| flagellar basal body rod protein FlgG [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116125057|gb|ABJ76328.1| Endoflagellar distal basal body rod protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 264

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 106/265 (40%), Positives = 165/265 (62%), Gaps = 5/265 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ +++ I+NN+AN+NTTG+K+ RA+F D +YQ + +AG+P+ S   
Sbjct: 1   MRSLWTAATGMIAQQFHIDTISNNLANVNTTGFKKNRADFEDLVYQHQVLAGTPATSVS- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVG-RGWFQVETPDKTVMYTRAG 119
             +P G+++G GV+ ++ + ++  G    TGN LD+A+ G  G+F+++ PD +  ++R G
Sbjct: 60  -EIPTGVNVGHGVRAAASQKLFEIGSFQATGNKLDMAITGEMGFFKIQMPDGSFAFSRDG 118

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
           SF IDS  Q+VT++G  L P +++PE      + +S  G++    G +     +GQ+ + 
Sbjct: 119 SFKIDSNQQVVTSNGYLLEPPLILPEGAILNTLMISEQGEVTVKVGADIRPIVIGQVELY 178

Query: 178 NFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISA 237
            F+N AGL+ IG NL   T  SG  I   P   GF +V QG+LE SNV  V+E+  MI A
Sbjct: 179 RFVNPAGLQAIGKNLFQETVASGPEIPGTPGMEGFGNVLQGFLEMSNVKIVEEMVAMIVA 238

Query: 238 QRAYEMNSKVIEAADEMSSLITKMR 262
           QRAYE NSK I+ +D M S    ++
Sbjct: 239 QRAYESNSKAIQTSDNMLSTAISLK 263


>gi|159045792|ref|YP_001534586.1| flagellar basal body rod protein FlgG [Dinoroseobacter shibae DFL
           12]
 gi|157913552|gb|ABV94985.1| flagellar basal-body rod protein FlgG [Dinoroseobacter shibae DFL
           12]
          Length = 261

 Score =  231 bits (589), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 118/262 (45%), Positives = 168/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN+AN+NTTGY   RAEFAD  YQ  K  G+ + ++D 
Sbjct: 1   MRALTIAATGMSAQQMRVEVISNNLANMNTTGYNARRAEFADLHYQQVKAPGTIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++V    +QG +  TG +LDLA+ G+G+ +V  P     YTR GS
Sbjct: 60  TALPTGVQLGLGVRAAAVTVELSQGSLSQTGGDLDLAIEGKGYLEVTLPSGASAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG  +VP IVIPE T  I V   G++ A      + + +GQ  +A F 
Sbjct: 120 LKRSAEGLIVTSDGYPVVPEIVIPEGTMRISVDAEGEVYAYFRDTVEPELLGQFSLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   ++ SG P+I  P + G    +QGYLEAS+VDAV+E++E+I AQR 
Sbjct: 180 NAKGLEAIGSNLFMESNASGPPLIGVPGEDGLGTFRQGYLEASSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKV+ AAD+M    +++R
Sbjct: 240 YELNSKVMTAADQMMGATSQIR 261


>gi|94987183|ref|YP_595116.1| flagellar basal body rod protein FlgG [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731432|emb|CAJ54795.1| Flagellar basal body L-ring protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 261

 Score =  231 bits (589), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 106/262 (40%), Positives = 164/262 (62%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ N+++I+NN+AN NT+G+K++RAEF D +YQ  K+AGS +   ++
Sbjct: 2   MRSLWTAATGMVAQQLNIDVISNNLANTNTSGFKKSRAEFEDLMYQTMKIAGSATDGDNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+ ++V   +TQG+  +TGN LD+A+ G G+FQV   D  +MYTRAG+
Sbjct: 62  --IPVGIQVGMGVRPTAVHKFFTQGDFQNTGNPLDMAIEGEGFFQVLVGD-QLMYTRAGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G LVTA+G  L P   +P + + + +S  G+I A+     +     ++ + +F+
Sbjct: 119 FKLNQDGTLVTANGYPLQPEFTVPPDAKSVAISERGRITALDANGQEIAAG-EIPLYSFV 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T  SG+ +   P +     + QG+LE SNV+ V E+ +MI  QRA
Sbjct: 178 NPAGLDAKGRNLYIPTEASGEAVEGVPGEENLGTIAQGFLEMSNVEVVDEMVQMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK I+ +D M     +++
Sbjct: 238 YEMNSKAIQTSDNMLQTAVQLK 259


>gi|1086561|gb|AAB68968.1| FlgG [Agrobacterium tumefaciens]
 gi|2459714|gb|AAB71790.1| FlgG [Agrobacterium tumefaciens]
          Length = 262

 Score =  231 bits (589), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 148/263 (56%), Positives = 199/263 (75%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTNLE+IANNIANINTTGYKRARAEF D LYQ E++ G P++ A++
Sbjct: 1   MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLYQTERMQGVPNR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VPEG +IG GVQ S+VRN++TQG ++ TGN LD+A++G+GWF            RAG+
Sbjct: 60  AIVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFPDRGRRWFDALQRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ G LVT DG  ++P I IP + ++I ++R+GQ+ A  G  +DF  +GQL IANF 
Sbjct: 120 FNKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGNAADFTQLGQLTIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL ++T  SG P++  PDD  + +VKQ YLE SNVDAVKEI+++I+AQRA
Sbjct: 180 NEAGLKPLGDNLFSQTPASGAPVVGVPDDPSYGYVKQSYLEGSNVDAVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI  ADEM+S+++  ++
Sbjct: 240 YEMNSKVITTADEMASIVSKNLK 262


>gi|126734107|ref|ZP_01749854.1| flagellar basal-body rod protein FlgG [Roseobacter sp. CCS2]
 gi|126716973|gb|EBA13837.1| flagellar basal-body rod protein FlgG [Roseobacter sp. CCS2]
          Length = 261

 Score =  231 bits (589), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 165/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAAAGM+AQQ  +E+I+NN+AN+NTTGY   RAEFAD  YQ     G+ + ++D 
Sbjct: 1   MRALKIAAAGMTAQQMRVEVISNNLANMNTTGYNPRRAEFADLHYQQLVRPGTIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P GI +G GV+ S++  + +QG +  TG +LDLA+ G G+ +V  P     YTR G+
Sbjct: 60  TVLPTGIQLGLGVRPSAISVMLSQGALGATGGDLDLAIEGDGYLEVTLPSGASAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
             +   G +VT+DG  +VP + +P +TR + ++  G++          Q +GQ  +A F 
Sbjct: 120 LKLTGDGLIVTSDGYPVVPDLTVPRDTRSLSINAEGEVFGYFIDEIQPQLLGQFSLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG  ++  P + G   ++QGYLE S+VD V+E++++I AQR 
Sbjct: 180 NAKGLEAIGSNLFLETPASGPSVVGTPGEDGLGVLRQGYLEDSSVDPVREVTDLIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M S + ++R
Sbjct: 240 YELNSKVITAADQMLSAMVQLR 261


>gi|270262399|ref|ZP_06190670.1| flagellar basal-body rod protein FlgG [Serratia odorifera 4Rx13]
 gi|270043083|gb|EFA16176.1| flagellar basal-body rod protein FlgG [Serratia odorifera 4Rx13]
          Length = 260

 Score =  231 bits (589), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IPSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  GQLVTA G  + P I IP     I V R G +       +  Q VGQL +  FI
Sbjct: 120 FQIDQNGQLVTASGFQVQPAITIPANALSITVGRDGIVSVTQQGQTAAQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESVGENLYQETESSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|297570291|ref|YP_003691635.1| flagellar basal-body rod protein FlgG [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296926206|gb|ADH87016.1| flagellar basal-body rod protein FlgG [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 260

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 152/262 (58%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A      GM  QQ  L+ I+NN+AN+NT G+K++R +F D  YQ  +  G   ++ D 
Sbjct: 2   IRALYSGTTGMRGQQLQLDTISNNLANVNTAGFKKSRVQFEDLYYQEMRAVGV--ETVDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI +G GV  +S + ++TQG +  TGN+LDLA+ GRG+FQV        YTR+G+
Sbjct: 60  GQVPSGIQVGLGVIATSTQKLFTQGSIHETGNDLDLAVEGRGFFQVIRD-GEEFYTRSGN 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G +VT +G+ L P   IP +T  + V   G I A      +    GQL + NFI
Sbjct: 119 FTRDADGFIVTQNGDRLQPEFAIPADTVTLSVGTDGLIQAKNAAQ-EIIAEGQLTLHNFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GLR  G NL   T  SGDPI S+P   G   + Q ++E SNVD  +E+  +I  QRA
Sbjct: 178 NPGGLRAEGGNLFRPTEASGDPIESDPGTDGAGVILQNFIEVSNVDVTEELVNLIITQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           +EMNSK ++ AD++  +   ++
Sbjct: 238 FEMNSKSVQTADQLLEVANTLK 259


>gi|70729006|ref|YP_258740.1| flagellar basal body rod protein FlgG [Pseudomonas fluorescens
           Pf-5]
 gi|68343305|gb|AAY90911.1| flagellar basal-body rod protein FlgG [Pseudomonas fluorescens
           Pf-5]
          Length = 261

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 163/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T   LDLA+ GRG+FQ+  PD T  YTR G+F+
Sbjct: 62  LPTGLQVGTGVRIVGTQKNFTAGSLQTTEQPLDLAINGRGFFQILQPDGTTAYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VTA G  L P +V+P + +   V + G +      N   Q +G L  A+FIN 
Sbjct: 122 LNSDGQIVTASGFALEPAVVVPNDAQTFTVGQDGTVSITIAGNPASQVIGNLQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+  G+NL   T+ SG P I  P   GF    Q  LEASNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAQGNNLFLETAASGAPQIGTPGLNGFGTTLQNTLEASNVSTVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S IT+
Sbjct: 242 MNSKVISTADQMLSFITQ 259


>gi|260466619|ref|ZP_05812807.1| flagellar basal-body rod protein FlgG [Mesorhizobium opportunistum
           WSM2075]
 gi|259029625|gb|EEW30913.1| flagellar basal-body rod protein FlgG [Mesorhizobium opportunistum
           WSM2075]
          Length = 262

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 155/263 (58%), Positives = 205/263 (77%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQTNLE+IANNIANINTTGYKRARAEF+D LYQ ++  G P++S + 
Sbjct: 1   MKALAIAATGMNAQQTNLEVIANNIANINTTGYKRARAEFSDLLYQVDRTQGVPNRS-NA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           ++VPEG+SIG GV+ ++VRNV+TQGE+  TGN+ D+AL GRGWFQ+E  D   +Y+RAG+
Sbjct: 60  SLVPEGVSIGLGVKTTAVRNVHTQGELTSTGNSFDMALTGRGWFQIEGADGGTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG +++P I +P +  E+ V+++GQ+ A     +D Q +GQL IANF 
Sbjct: 120 FNTNATGQLVTVDGASVIPAINVPVDAVEVIVNKTGQVFARIDGQTDLQNLGQLQIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +GDNL   T+ SG   +  P D GFA ++QGYLEASNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLAPLGDNLFQETTASGPANVGVPGDPGFATIQQGYLEASNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AAD+M+S+++  +R
Sbjct: 240 YEMNSKVIQAADDMASVVSKNIR 262


>gi|261344140|ref|ZP_05971784.1| flagellar basal-body rod protein FlgG [Providencia rustigianii DSM
           4541]
 gi|282567732|gb|EFB73267.1| flagellar basal-body rod protein FlgG [Providencia rustigianii DSM
           4541]
          Length = 260

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTNL++I+NN+AN++T G+KR RA F D LYQ  +  G  + S+D+
Sbjct: 2   IRSLWIAKTGLDAQQTNLDVISNNLANVSTNGFKRQRAVFEDLLYQNIRQPG--AMSSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G +  +   +++QG +  TG   D+A+ G+G+  V+ PD T  YTR G+
Sbjct: 60  TSLPSGLQMGTGARPVATMRIHSQGNLNKTGTTTDIAIKGQGFLHVQMPDGTDAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              +  GQLVT+ G  +VP I+IPE    + ++R G +      ++  Q +GQ+ +  FI
Sbjct: 120 LQPNQDGQLVTSSGYQVVPAIMIPENANSLSIARDGTVSVTVYGDNQPQQIGQITLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T+ SG P  S P   G   + QG LE SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESMGENLYMETASSGAPKESAPGTNGAGLLYQGMLETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   +T++
Sbjct: 240 YEINSKAVSASDQMLQRLTQL 260


>gi|330818583|ref|YP_004362288.1| flagellar basal-body rod protein FlgG [Burkholderia gladioli BSR3]
 gi|327370976|gb|AEA62332.1| flagellar basal-body rod protein FlgG [Burkholderia gladioli BSR3]
          Length = 262

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGALTQTGNSRDIAIDGSGFFQVLMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           + +++GQLVT+ G  ++P I +P+  + + +   G +      +++   +G + IA FIN
Sbjct: 121 HPNNQGQLVTSSGYQVLPAITVPQNAQSLTIGTDGVVTVTQPGSTNAVQIGAMQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ +G NL A T+ SG P ++ P   G   + QGY+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PEGLQALGQNLFAETTSSGVPNVTTPGLNGAGSLNQGYVESSNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|307721135|ref|YP_003892275.1| flagellar basal-body rod protein FlgG [Sulfurimonas autotrophica
           DSM 16294]
 gi|306979228|gb|ADN09263.1| flagellar basal-body rod protein FlgG [Sulfurimonas autotrophica
           DSM 16294]
          Length = 262

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A+ GM   QT ++  ANNIAN+NT G+K++RAEFAD +Y   + AG  + ++D 
Sbjct: 2   MQSLYTASTGMLGMQTQIDTTANNIANVNTIGFKKSRAEFADLMYHVMEYAG--TSTSDT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +++  ++++G +  T NNLDLA+ G+G+F++E PD T +Y++ G+
Sbjct: 60  TKSPTGIEVGLGVRPTAINKIFSEGSLKQTDNNLDLAITGKGFFKMELPDGTEVYSKNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  G +V +DG TL+P IVIP +   I +   G +  +    +    +GQ+   NFI
Sbjct: 120 FKIDQDGTVVNSDGYTLIPQIVIPPDATNINIGTDGTVTVIQPGQTQATQIGQIQTTNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T  SG P+   P   G   ++QG++E SNV+ V E++++I+ QRA
Sbjct: 180 NPAGLHAMGDNLYIETDSSGQPVEGIPGVDGLGTIRQGFVELSNVELVVELTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           Y+ NSK+I  +DEM      ++
Sbjct: 240 YDANSKIITTSDEMLQTTNNLK 261


>gi|297543694|ref|YP_003675996.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296841469|gb|ADH59985.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 266

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 104/268 (38%), Positives = 147/268 (54%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAASGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQRENI----YGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +T+G +  T N LDLAL G G+F V  PD TV YTR GS
Sbjct: 58  QGRPVNMQVGVGVRPSAIVKDFTEGSLQQTDNPLDLALDGEGFFAVLGPDGTVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVS------RSGQILAVTGKNSDFQPVGQL 174
           F + + G  +        P +           +          +++V   +   Q V  L
Sbjct: 118 FKLSADGNTLMLVTADGYPVLDDSGNPIVFDSTGKDISVSPMGVISVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G+NL   T  SG P   +  +     V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFVNPQGLLSVGNNLYEPTEASGQPGTRDDFEGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|291613040|ref|YP_003523197.1| flagellar basal-body rod protein FlgG [Sideroxydans lithotrophicus
           ES-1]
 gi|291583152|gb|ADE10810.1| flagellar basal-body rod protein FlgG [Sideroxydans lithotrophicus
           ES-1]
          Length = 260

 Score =  231 bits (589), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT +++I+NN+AN++T G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLEAQQTQMDVISNNLANVSTNGFKRSRAVFEDLLYQNLRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  T N LD+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  TQIPSGLQIGTGVRPVATERIHTQGNLQQTSNQLDVAIQGAGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS+GQ+VT++G  + P I IP     + + + G +       +    VG + +A FI
Sbjct: 120 FQTDSQGQIVTSNGFVVQPAITIPANATTVTIGQDGVVTVTQPGATAPVQVGSMQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL ++G N+   T+ SG P  + P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPTGLESMGQNMYLETASSGTPSTNVPGTNGTGSISQGYVETSNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   + +M
Sbjct: 240 YEINSKAITVSDQMLQKLAQM 260


>gi|319781681|ref|YP_004141157.1| flagellar basal-body rod protein FlgG [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167569|gb|ADV11107.1| flagellar basal-body rod protein FlgG [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 262

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 155/263 (58%), Positives = 203/263 (77%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQTNLE+IANNIANINTTGYKRARAEF+D LYQ ++  G P++S + 
Sbjct: 1   MKALAIAATGMNAQQTNLEVIANNIANINTTGYKRARAEFSDLLYQVDRTQGVPNRS-NA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           ++VPEG+SIG GV+ ++VRNV+TQGE+  TGN+ DLAL GRGWFQ+E  D   +Y+RAG+
Sbjct: 60  SLVPEGVSIGLGVKTTAVRNVHTQGELTSTGNSFDLALTGRGWFQIEGADGGTLYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
            N ++ GQLVT DG  ++P I +P +  E+ V+++GQ+ A     +D Q +GQL IANF 
Sbjct: 120 LNTNATGQLVTVDGAAVIPAINVPVDAVEVIVNKTGQVFARIDGQTDLQNLGQLQIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +GDNL   T+ SG   +  P D GFA ++QGYLEASNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLAPLGDNLFQETTASGPANVGVPGDPGFATIQQGYLEASNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AAD+M+S+++  +R
Sbjct: 240 YEMNSKVIQAADDMASVVSKNIR 262


>gi|114765244|ref|ZP_01444376.1| Flagellar basal body rod protein [Pelagibaca bermudensis HTCC2601]
 gi|114542379|gb|EAU45407.1| Flagellar basal body rod protein [Roseovarius sp. HTCC2601]
          Length = 261

 Score =  231 bits (588), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 119/262 (45%), Positives = 171/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQQTN+++I+NNIAN NTTG+K ARA F D +Y+ +   G+ + + + 
Sbjct: 1   MKALGIAATGMMAQQTNVDVISNNIANANTTGFKSARASFTDLIYENQSREGAVT-AEEG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ IG GV+      + TQG +  T + LDLA+ GRG+F V  PD    YTR GS
Sbjct: 60  TTRPIGLDIGLGVRSVGTLRLNTQGGLTQTESQLDLAIDGRGYFTVNLPDGDQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F + ++GQ+V   G  + PG+V+P+ T  +++S +G + A    +     VGQL +  F+
Sbjct: 120 FRLSAEGQIVNHQGFEIDPGVVLPDNTTAVEISETGIVSAYVEGDPIPVEVGQLTLTTFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AG+R +G+NLL  T  SGD I + P D G   ++QGYLEASNVD +++I+++I AQRA
Sbjct: 180 NDAGMRPLGNNLLEATVASGDAIPALPGDAGVGILRQGYLEASNVDIIRQITDLIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK IE AD+M S   +++
Sbjct: 240 YEMNSKAIETADQMMSAANQIK 261


>gi|116694221|ref|YP_728432.1| flagellar basal body rod protein FlgG [Ralstonia eutropha H16]
 gi|113528720|emb|CAJ95067.1| flagellar basal body rod protein [Ralstonia eutropha H16]
          Length = 261

 Score =  231 bits (588), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I+NN+AN++T G+KR RA F + +YQ  +  G  + S+D+
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISNNLANVSTNGFKRGRAVFEELMYQTIRQPG--ALSSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG    TGN  D+A++G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGMQLGTGVRPVATERIHTQGNPQQTGNAKDVAILGQGFFQVALPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP  T  + ++R G +      +S    VGQL +A F+
Sbjct: 120 FQVDQNGQLVTSSGFVIQPAITIPANTLSMTIARDGTVSVTQPGSSANVQVGQLQLATFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G+NL  +T  SG P  + P   G   V+Q Y+EASNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLESMGENLYVQTDASGAPNTTVPGLNGAGVVQQNYVEASNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++A+D+M   ++++
Sbjct: 240 YEINSKAVQASDQMLQRLSQL 260


>gi|188592119|ref|YP_001796717.1| flagellar basal body rod protein flgg [Cupriavidus taiwanensis LMG
           19424]
 gi|170938493|emb|CAP63480.1| FlgG: Flagellar basal-body rod protein [Cupriavidus taiwanensis LMG
           19424]
          Length = 261

 Score =  231 bits (588), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I+NN+AN++T G+KR RA F + +YQ  +  G  + S+D+
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISNNLANVSTNGFKRGRAVFEELMYQTIRQPG--ALSSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG    TGN  D+A++G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGMQLGTGVRPVATERIHTQGNPQQTGNAKDVAILGQGFFQVALPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP  T  + + R G +      +S    VGQL +A F+
Sbjct: 120 FQVDQNGQLVTSSGFVIQPAITIPANTLSMTIGRDGTVSVTQPGSSANVQVGQLQLATFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G+NL  +T  SG P  + P   G   V+Q Y+EASNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLESMGENLYVQTDASGAPNTTVPGLNGAGVVQQNYVEASNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++A+D+M   + ++
Sbjct: 240 YEINSKAVQASDQMLQRLAQL 260


>gi|204930805|ref|ZP_03221678.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204320264|gb|EDZ05468.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 260

 Score =  231 bits (588), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVILPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|188534168|ref|YP_001907965.1| Flagellar basal-body rod protein [Erwinia tasmaniensis Et1/99]
 gi|188029210|emb|CAO97082.1| Flagellar basal-body rod protein [Erwinia tasmaniensis Et1/99]
          Length = 260

 Score =  231 bits (588), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLMYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +  +   ++ QG +  T ++ D+A+ G+G+F V+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGTRPVATERLHNQGNLSQTDSSKDVAINGQGFFSVQMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT  G  + P IVIP  +  + +SR G +       ++   VGQL ++ FI
Sbjct: 120 FQTDQNGQLVTNAGFPVQPAIVIPPNSLSMTISRDGVVSVTQQGQANPVQVGQLTLSTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  SNP + G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLSSMGENLYQETQASGAPNESNPGNNGAGTLYQGYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + +T++
Sbjct: 240 YEINSKAISTSDQMLAKLTQI 260


>gi|241589578|ref|YP_002979603.1| flagellar basal-body rod protein FlgG [Ralstonia pickettii 12D]
 gi|240868290|gb|ACS65949.1| flagellar basal-body rod protein FlgG [Ralstonia pickettii 12D]
          Length = 261

 Score =  231 bits (588), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 168/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQT L++++NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMEAQQTQLDVVSNNLANVNTTGFKRSRAVFEDLLYQNAREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +I +   +++QG +  TGN  D+A+ G G+FQV+ PD T+ YTR G+
Sbjct: 60  TALPSGMQIGTGTRIVATSRLHSQGNLSKTGNATDVAINGNGFFQVQRPDGTLAYTRDGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I ++GQLVT+ G  + P +++P     + + + G +   T    +   VG   +ANF+
Sbjct: 120 FQISAQGQLVTSSGYLVQPAMMVPRNATSLMIGKDGVVTVTTPGMVNRTQVGAFQLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++ P   G   + Q Y+E SNV+ V+E+ ++I  QRA
Sbjct: 180 NPAGLRSLGENLYAETEASGGANLAVPGGNGLGMLHQNYVETSNVNVVEEMIQLIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK ++ AD M   I +++
Sbjct: 240 YEINSKAVQTADRMLEKIAQLK 261


>gi|218887604|ref|YP_002436925.1| flagellar basal body rod protein FlgG [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758558|gb|ACL09457.1| flagellar basal-body rod protein FlgG [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 260

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 162/262 (61%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ N+++I+NN+AN+NTT +K++RAEF D +YQ  ++AG+ ++  ++
Sbjct: 2   MRSLWTAATGMVAQQLNIDVISNNLANVNTTSFKKSRAEFEDLMYQNMRIAGAATEGDNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+ ++V   +TQG+  +TGN+LDLA+ G G+F V+       YTRAG+
Sbjct: 62  --IPTGIQVGMGVRPTTVHKFFTQGDYSNTGNSLDLAIEGDGFFLVQVN-GEDAYTRAGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G TL P   +P ET+ I V+ +G I A+    +       + +  FI
Sbjct: 119 FKLNQDGVVVTANGYTLQPEFTVPAETKNITVTENGHISALDSNGAALAEA-DIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   +  SG+ +   P +     + QG+LE SNV+ V E+  MI  QRA
Sbjct: 178 NPAGLEARGRNLYVPSEASGEAVEGVPGENQVGTIAQGFLEMSNVEVVDEMVNMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK I+ +D M     +++
Sbjct: 238 YEMNSKAIQTSDTMLQTAVQLK 259


>gi|319403961|emb|CBI77549.1| Flagellar basal-body rod protein flgG [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319406976|emb|CBI80613.1| Flagellar basal-body rod protein flgG [Bartonella sp. 1-1C]
          Length = 264

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 131/263 (49%), Positives = 186/263 (70%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MK+  IAA GM+AQQTNL++IANN+ANINTTG+KR RAEFAD +Y A++  G P+   ++
Sbjct: 3   MKSLSIAATGMAAQQTNLDVIANNMANINTTGFKRGRAEFADLMYVADRAVGVPNM-LNQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV+PEG  IG GV+ ++VR + TQG  V TGN LDLA+ G GWF+++ P+  V YTR+G+
Sbjct: 62  AVIPEGAMIGMGVRTAAVRTINTQGAFVQTGNALDLAINGNGWFEIQDPNGNVFYTRSGA 121

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN+   GQ+VT +GN + P I IP  ++ + VS  G +   T  + +    G+  + NF+
Sbjct: 122 FNLSETGQIVTLEGNLVQPVITIPIGSKNVTVSPDGTVYYQTDTDPNAVEAGRFRLVNFV 181

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDNL   T  SG P+  +P + G+  + Q  LEASNVD VKE++E+I+AQR+
Sbjct: 182 NEVGLEPIGDNLFRETQASGAPVPGDPKEDGYGSIMQAMLEASNVDPVKEMTELIAAQRS 241

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+A+DEM+++++  +R
Sbjct: 242 YEMNSKVIQASDEMAAVVSKNLR 264


>gi|121997317|ref|YP_001002104.1| flagellar basal-body rod protein FlgG [Halorhodospira halophila
           SL1]
 gi|121588722|gb|ABM61302.1| flagellar basal-body rod protein FlgG [Halorhodospira halophila
           SL1]
          Length = 261

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQQ ++++ +NN+AN+NT G+K+ RA F D  YQ  +  G  S+++   +
Sbjct: 4   ALWVAKTGLDAQQKSMQVTSNNLANVNTNGFKKDRANFEDLFYQTVRQPG--SRASQDNL 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++     +++QG V  T  +LD+A+ G+G+ QV  PD  V YTR G+  
Sbjct: 62  LPSGLMLGTGSRVMGTEKIHSQGNVQQTERSLDVAIEGKGFLQVLRPDGQVGYTRDGALQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++  G++VT+ G  L PGI +PEE   I +   G + A    + + + +GQ+ +A+FIN 
Sbjct: 122 LNENGEIVTSGGYLLEPGIQVPEEAETISIGSDGTVSAKIPGDEEPEEIGQIELADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL  +G+N+   T+ SG P +  P +    +V QG LE SNV+  +E+  MI  QR +E
Sbjct: 182 SGLEPVGENMFLETAASGAPEVGAPGEGALGNVMQGALETSNVNIAEELVNMIENQRGFE 241

Query: 243 MNSKVIEAADEMSSLITK 260
            N++ I   DEM   + +
Sbjct: 242 TNTRAISTTDEMLQFLNQ 259


>gi|157371205|ref|YP_001479194.1| flagellar basal body rod protein FlgG [Serratia proteamaculans 568]
 gi|157322969|gb|ABV42066.1| flagellar basal-body rod protein FlgG [Serratia proteamaculans 568]
          Length = 260

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IPSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T+ YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDIAIKGQGFFQVMMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVTA G  + P I+IP     I V R G +       +  Q VGQL +  FI
Sbjct: 120 FQRDQNGQLVTASGFQVQPAIIIPANALSITVGRDGIVSVTQQGQTAAQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESMGENLYQETESSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|315124200|ref|YP_004066204.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315017922|gb|ADT66015.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 263

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 102/263 (38%), Positives = 163/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKSRAEFADLMYQVMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 60  TLSPSGIEVGVGVRPTAVTKVFTEGNLKSTSTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 120 QFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVRF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 240 AYEAGSKAITTSDDMLGIVNQLK 262


>gi|13472576|ref|NP_104143.1| flagellar basal body rod protein FlgG [Mesorhizobium loti
           MAFF303099]
 gi|14023322|dbj|BAB49929.1| flagellar basal body distal rod protein; FlgG [Mesorhizobium loti
           MAFF303099]
          Length = 262

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 154/263 (58%), Positives = 202/263 (76%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQQTNLE+IANNIANINTTGYKRARAEF+D LYQ ++  G P++S + 
Sbjct: 1   MKALAIAATGMNAQQTNLEVIANNIANINTTGYKRARAEFSDLLYQVDRTQGVPNRS-NA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           ++VPEG+SIG GV+ ++VRNV+TQGE+  TGN+ D+AL GRGWFQ+E  D   +YTRAG+
Sbjct: 60  SLVPEGVSIGLGVKTTAVRNVHTQGELTSTGNSFDMALTGRGWFQIEGADGGTLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT DG  ++P I +P +  E+ V+++GQ+ A     ++ Q +GQL I NF 
Sbjct: 120 FNTNATGQLVTVDGANVIPAITVPTDAVEVIVNKTGQVFARIDGQTNLQTLGQLQIVNFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +GDNL   T+ SG      P D GFA ++QGYLEASNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLAPLGDNLFQETTASGPANAGVPGDPGFATIQQGYLEASNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AAD+M+S+++  +R
Sbjct: 240 YEMNSKVIQAADDMASVVSKNIR 262


>gi|304310887|ref|YP_003810485.1| Flagellar basal-body rod protein [gamma proteobacterium HdN1]
 gi|301796620|emb|CBL44832.1| Flagellar basal-body rod protein [gamma proteobacterium HdN1]
          Length = 261

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 162/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+ +G+SAQ   L  I+NN+AN++TTG+KR  A F D LYQ ++  G   QS+    
Sbjct: 4   ALWISKSGLSAQDLRLSTISNNLANVSTTGFKRDIAVFQDLLYQVQRQPG--GQSSQDTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+  + +  +T+G +  TG  LD+A++GRG+FQV  PD  + YTR G+F 
Sbjct: 62  LPSGLQVGTGVKTVATKKQHTEGTIQTTGQALDVAIMGRGFFQVLMPDGAIAYTRDGAFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           + ++G LVTA+G +L P I +PE ++ + +   G + AV G+      +G + +A+F+N 
Sbjct: 122 LSAEGDLVTAEGLSLEPAINVPEGSQSVTIGNDGTVTAVDGQTKQQIEIGNIQLADFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL ++G NL   T  SG P  + P   G   ++Q  LEASNV+ V+E+  MI  QRAYE
Sbjct: 182 AGLESVGSNLYRETVASGAPTEAQPGTDGTGTLQQNALEASNVNVVEELVNMIETQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI   D+M S + +
Sbjct: 242 MNSKVISTVDQMLSYVGQ 259


>gi|148266116|ref|YP_001232822.1| flagellar basal body rod protein FlgG [Geobacter uraniireducens
           Rf4]
 gi|146399616|gb|ABQ28249.1| flagellar basal-body rod protein FlgG [Geobacter uraniireducens
           Rf4]
          Length = 262

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 164/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQ N++++ANN+AN+NTTG+K++RA+F D +YQ  K +G+PS +A  
Sbjct: 2   IRALWTAASGMQAQQLNIDVVANNLANVNTTGFKKSRADFQDLMYQNLKTSGAPSTNA-- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G G + ++V  ++T G +  TGN +DLA+ G G+FQ++ PD +  Y+RAGS
Sbjct: 60  TQIPTGIQVGLGSKAAAVSKIFTAGNITQTGNEMDLAIEGEGFFQIQMPDGSTNYSRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS+G++V +DG  L+P ++IP    +I V   G +  +    +    VG + +A F 
Sbjct: 120 FKKDSQGRMVNSDGYPLLPEVIIPNNATKITVGNDGTVSVMQSGQNTPTSVGTIQLATFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G NL   T  SG          G   + QG+LE SNV  ++E+  MI  QRA
Sbjct: 180 NPAGLSSLGHNLYQPTDSSGAATTGTSGQNGIGTLSQGFLEMSNVSVMEEMVNMIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK ++AADEM      +R
Sbjct: 240 YEINSKAVQAADEMLQTANNLR 261


>gi|291288379|ref|YP_003505195.1| flagellar basal-body rod protein FlgG [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290885539|gb|ADD69239.1| flagellar basal-body rod protein FlgG [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 262

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 155/261 (59%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +    AA GM+AQQTN++ I+NN+AN+N  GYK++RA F D +YQ  K AG  + SA   
Sbjct: 3   RTLWTAATGMTAQQTNIDTISNNLANVNNIGYKKSRAHFEDLIYQELKPAG--AISAAGM 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P GI +G G +++++  V+TQG   +TG +LD+A+ G G+FQ   P   + YTR GS 
Sbjct: 61  THPTGIQVGLGSKVAAIEKVHTQGSFQYTGVSLDIAVEGDGYFQFTLPSGEIAYTRNGSL 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             D+ G LV ++G  L P + +P++  +I     G I        + Q +GQ+ ++ FIN
Sbjct: 121 KTDADGNLVNSNGYYLEPAVTVPDDVTDIAFGEDGTISVTLAGEEEAQEIGQIELSRFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG NL   T  SG+ +   P + G+  + Q  LE SNV  V E+  MI+ QRAY
Sbjct: 181 PAGLKAIGKNLFMPTGASGNAVAGVPSEDGYGSITQNTLEMSNVSVVDEMVNMITGQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK ++  DEM  ++  ++
Sbjct: 241 EINSKAVQTGDEMLQIVNNLK 261


>gi|116327820|ref|YP_797540.1| flagellar basal body rod protein FlgG [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116120564|gb|ABJ78607.1| Endoflagellar distal basal body rod protein [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
          Length = 265

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 106/265 (40%), Positives = 165/265 (62%), Gaps = 5/265 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ +++ I+NN+AN+NTTG+K+ RA+F D +YQ + +AG+P+ S   
Sbjct: 2   MRSLWTAATGMIAQQFHIDTISNNLANVNTTGFKKNRADFEDLVYQHQVLAGTPATSVS- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVG-RGWFQVETPDKTVMYTRAG 119
             +P G+++G GV+ ++ + ++  G    TGN LD+A+ G  G+F+++ PD +  ++R G
Sbjct: 61  -EIPTGVNVGHGVRAAASQKLFEIGSFQATGNKLDMAITGEMGFFKIQMPDGSFAFSRDG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
           SF IDS  Q+VT++G  L P +++PE      + +S  G++    G +     +GQ+ + 
Sbjct: 120 SFKIDSNQQVVTSNGYLLEPPLILPEGAILNTLMISEQGEVTVKVGADIRPIVIGQVELY 179

Query: 178 NFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISA 237
            F+N AGL+ IG NL   T  SG  I   P   GF +V QG+LE SNV  V+E+  MI A
Sbjct: 180 RFVNPAGLQAIGKNLFQETVASGPEIPGTPGMEGFGNVLQGFLEMSNVKIVEEMVAMIVA 239

Query: 238 QRAYEMNSKVIEAADEMSSLITKMR 262
           QRAYE NSK I+ +D M S    ++
Sbjct: 240 QRAYESNSKAIQTSDNMLSTAISLK 264


>gi|330826757|ref|YP_004390060.1| flagellar basal-body rod protein FlgG [Alicycliphilus denitrificans
           K601]
 gi|329312129|gb|AEB86544.1| flagellar basal-body rod protein FlgG [Alicycliphilus denitrificans
           K601]
          Length = 260

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  GMSAQQT L++I++N+AN++TTG+KR  A F D +YQ  +  G  +Q+ ++
Sbjct: 2   INSLWIAKTGMSAQQTQLDVISHNLANVSTTGFKRNSAVFEDLIYQNLRQVG--AQTTEE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    +TQG +  + N+LD+A+ G G+F+V+ PD T+ YTR GS
Sbjct: 60  NQLPTGLHLGLGVRTVATSRNFTQGSLQQSSNSLDVAINGNGFFEVQLPDGTIGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VT+ G  +  GI +P+    I +S +G + A    N+  Q +GQL +++FI
Sbjct: 120 FQLDAQGRMVTSGGLPVANGITVPQGATSISISETGVVSATIAGNAQPQQLGQLAMSSFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ +G N+   ++ SG P    P   G   +KQG+LE SNV+ V+E+  MI  QRA
Sbjct: 180 NAAGLQPVGQNMYKESAASGPPQQGQPGTNGLGVIKQGFLETSNVNVVEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + ++++
Sbjct: 240 YEMNSKAIQTSDQMLAKLSQL 260


>gi|255322391|ref|ZP_05363537.1| flagellar basal-body rod protein FlgG [Campylobacter showae RM3277]
 gi|255300764|gb|EET80035.1| flagellar basal-body rod protein FlgG [Campylobacter showae RM3277]
          Length = 262

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 168/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ ++NIAN+NT GYK+ RAEFAD +YQ  + AG  + ++  
Sbjct: 2   MRSIYSAATGMIAQQTQIDVTSHNIANVNTIGYKKNRAEFADLMYQVMEYAG--TATSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G G + +++  +++QG    T NNLD+ + G G+FQV+ PD T  YTR G+
Sbjct: 60  TKSPTGIEVGLGARPTAITKIFSQGYFKETSNNLDMVIAGNGFFQVQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G +V +DG  L P + IP +  ++ V   G +  +   N++   VG++ +ANFI
Sbjct: 120 FKLDSEGTIVNSDGYVLQPQMTIPADATQVSVGTDGTVSVLQPGNTEMTQVGRIELANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   T  SG+ ++      G   ++QG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSMGDNLYLPTGSSGEVVVGTAGLDGLGTIRQGFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +D+M S++  ++
Sbjct: 240 YEANSKAITTSDDMLSIVNSLK 261


>gi|302878278|ref|YP_003846842.1| flagellar basal-body rod protein FlgG [Gallionella
           capsiferriformans ES-2]
 gi|302581067|gb|ADL55078.1| flagellar basal-body rod protein FlgG [Gallionella
           capsiferriformans ES-2]
          Length = 260

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  G+ AQQT ++ IANN+AN++T G+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGLDAQQTQMDTIANNLANVSTNGFKRSRAVFEDLLYQTIRQPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  TGN LD+A+ G G+FQV  PD +  YTR GS
Sbjct: 60  TQIPSGLQIGTGVRPVAAERIHTQGNLQQTGNQLDVAINGSGFFQVLMPDGSTGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D++GQ+VTA G  + P I +P     + + R G +       +    VG + +  FI
Sbjct: 120 FQRDAQGQMVTASGFPVQPAISLPANAITVTIGRDGVVSVTQPGVAAPVQVGSMQVTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G+NL   T+ SG P  + P   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLMAQGENLYQETASSGTPSTNVPGTNGSGLLSQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +++M
Sbjct: 240 YEINSKSITTSDQMLQKLSQM 260


>gi|319405401|emb|CBI79020.1| Flagellar basal-body rod protein flgG [Bartonella sp. AR 15-3]
          Length = 264

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 132/263 (50%), Positives = 186/263 (70%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MK+  IAA GM+AQQTNL++IANN+ANINTTG+KR RAEFAD +Y A++  G P+   ++
Sbjct: 3   MKSLSIAATGMAAQQTNLDVIANNMANINTTGFKRGRAEFADLMYVADRAVGVPNM-LNQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A++PEG  IG GV+ ++VR V TQG  V TGN LDLA+ G GWF+++ P+  V YTR+G+
Sbjct: 62  AIIPEGAMIGMGVRTAAVRTVNTQGAFVQTGNALDLAINGNGWFEIQDPNGNVFYTRSGA 121

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN+   GQ++T DGN + P + IP  ++ I VS  G I   T  + +    G+L + NF+
Sbjct: 122 FNLSETGQIITLDGNLVQPVVTIPIGSKNITVSSDGTIYYQTDTDPNAVEAGRLRLVNFV 181

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDNL   T  SG P+  +P + G+  + Q  LE SNVD VKE++E+I+AQR+
Sbjct: 182 NEVGLEPIGDNLFRETQASGAPVPGDPKEDGYGSIMQAMLETSNVDPVKEMTELIAAQRS 241

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+A+DEM+++++  +R
Sbjct: 242 YEMNSKVIQASDEMAAVVSKNLR 264


>gi|241766922|ref|ZP_04764728.1| flagellar basal-body rod protein FlgG [Acidovorax delafieldii 2AN]
 gi|241362626|gb|EER58474.1| flagellar basal-body rod protein FlgG [Acidovorax delafieldii 2AN]
          Length = 259

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 157/261 (60%), Gaps = 3/261 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  GMSAQQT L++I++N+AN++TTGYKR  A F D +YQ  +  G  + S+++
Sbjct: 2   INSLWIAKTGMSAQQTQLDVISHNLANVSTTGYKRNNAVFEDLIYQNLRQVG--ANSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + +P G+ +G GV + +    + QG +  +G + DLA+ G G+FQV  PD T  YTR GS
Sbjct: 60  SQLPTGLHLGLGVNVVATNRDFRQGALQQSGKDFDLAINGAGFFQVSMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  GQ+V + G  L  GI       +  ++ +G++              +L +A+FI
Sbjct: 120 FTIDKDGQMVNSSGYPLTDGITKVAGAVKASIAANGEVTFTDSAGKAVGTG-RLTLASFI 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +G NL   +  SG+P   +P   GF  +KQG+LE SNV+ V+E+  MI  QRA
Sbjct: 179 NPAGLEPVGQNLYKESIASGNPQTGSPTSAGFGELKQGFLETSNVNVVEELVTMIQTQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + + ++
Sbjct: 239 YEMNSKAIQTSDQMLAKLAQL 259


>gi|167909129|ref|ZP_02496220.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           112]
          Length = 262

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 165/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLQQTGNSKDVAINGPGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP+    + +   G +      +++   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPQNANSLTIGSDGVVSVTQPGSNNAVQIGALQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   +KQGY+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESSNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +T+M
Sbjct: 241 EINSKAVTTSDQMLQTVTQM 260


>gi|110677663|ref|YP_680670.1| flagellar basal body rod protein FlgG [Roseobacter denitrificans
           OCh 114]
 gi|109453779|gb|ABG29984.1| flagellar basal-body rod protein FlgG [Roseobacter denitrificans
           OCh 114]
          Length = 261

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 120/262 (45%), Positives = 168/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN++N++TTGY   RAEFAD  YQ     G+ + + D 
Sbjct: 1   MRALKIAATGMSAQQMRVETISNNLSNMSTTGYNARRAEFADLHYQQMSRPGTVN-ATDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ S+V     QG +  TG +LDLA+ G G+ +V  P     YTR G 
Sbjct: 60  TVLPTGVQLGLGVRPSAVSVQLQQGSLSATGGDLDLAIEGTGFLEVTLPSGQTAYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              D++G +VT+DG  + P IVIP++ R I ++ SG++ A     +D + +GQ  +A F 
Sbjct: 120 LKRDAEGLIVTSDGYPVEPEIVIPDDARSISINTSGEVFAYFSDATDAELLGQFNLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL A T  SG  I+S P + G   V+QGYLE+S+VDAV+EI+E+I AQR 
Sbjct: 180 NAKGLEALGGNLFAETEASGAAIVSTPGEDGLGTVRQGYLESSSVDAVREITELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI AAD+M    T++R
Sbjct: 240 YEMNAKVISAADQMMGATTQIR 261


>gi|254516991|ref|ZP_05129049.1| flagellar basal-body rod protein FlgG [gamma proteobacterium
           NOR5-3]
 gi|219674496|gb|EED30864.1| flagellar basal-body rod protein FlgG [gamma proteobacterium
           NOR5-3]
          Length = 261

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 98/259 (37%), Positives = 156/259 (60%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  I+  G+ AQQT +  IANN+AN+ TTG+KR RA F D +YQ  +  G  SQS+   
Sbjct: 3   QSLWISKTGLDAQQTKMSTIANNLANVGTTGFKRGRAIFEDLIYQNVRQVG--SQSSQDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           ++P G+ IG+G ++ +   ++TQG +  T + LD+A+ GRG+F++  PD    +TR GSF
Sbjct: 61  LLPSGLQIGTGTRVVATEKLFTQGNLTKTDSALDIAIQGRGFFEILLPDGNQAFTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+ +G +VT+ G  + P I +P++   + ++  G +       +    +G + + +FIN
Sbjct: 121 QINDQGIVVTSAGYQVQPPITVPQDALSVTIANDGTVSVQQPGTAASTQIGLVQLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+  G+NL   +  SG P   NP   G   + QGY+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQARGENLFLESGASGAPQPGNPGLNGLGTLSQGYVESSNVNVVEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNS+ I  AD+M   I+ 
Sbjct: 241 EMNSRAISTADQMLQYISN 259


>gi|293395585|ref|ZP_06639868.1| flagellar basal-body rod protein FlgG [Serratia odorifera DSM 4582]
 gi|291421904|gb|EFE95150.1| flagellar basal-body rod protein FlgG [Serratia odorifera DSM 4582]
          Length = 260

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   IPSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGYFQVMLPDGSQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  GQLVTA G  + P I IP     I V R G +       +  Q VGQL +  FI
Sbjct: 120 FQIDQNGQLVTASGFQVQPAITIPANALSITVGRDGIVSVTQQGQTAAQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL ++G+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESVGENLYQETESSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|57237001|ref|YP_178802.1| flagellar basal body rod protein FlgG [Campylobacter jejuni RM1221]
 gi|86149818|ref|ZP_01068047.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86153387|ref|ZP_01071591.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88597119|ref|ZP_01100355.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121613571|ref|YP_001000394.1| flagellar basal body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|148926663|ref|ZP_01810344.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|157414985|ref|YP_001482241.1| flagellar basal body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167005337|ref|ZP_02271095.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|205355540|ref|ZP_03222311.1| flagellar basaL body rod protein [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|218562337|ref|YP_002344116.1| flagellar basal body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|283956107|ref|ZP_06373594.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|57165805|gb|AAW34584.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni RM1221]
 gi|85839636|gb|EAQ56896.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85843113|gb|EAQ60324.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87249438|gb|EAQ72398.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88190808|gb|EAQ94781.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360043|emb|CAL34835.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|145845182|gb|EDK22277.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|157385949|gb|ABV52264.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|205346774|gb|EDZ33406.1| flagellar basaL body rod protein [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|283792427|gb|EFC31209.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|284925954|gb|ADC28306.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|307747622|gb|ADN90892.1| Flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315058161|gb|ADT72490.1| Flagellar basal-body rod protein flgG [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315926812|gb|EFV06186.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315931897|gb|EFV10852.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 263

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 102/263 (38%), Positives = 163/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKSRAEFADLMYQVMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 60  TLSPSGIEVGVGVRPTAVTKVFTEGNLKSTSTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 120 QFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 240 AYEAGSKAITTSDDMLGIVNQLK 262


>gi|34498338|ref|NP_902553.1| flagellar basal-body rod protein FlgG [Chromobacterium violaceum
           ATCC 12472]
 gi|34104192|gb|AAQ60551.1| flagellar basal-body rod protein FlgG [Chromobacterium violaceum
           ATCC 12472]
          Length = 260

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 99/261 (37%), Positives = 152/261 (58%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IA  GM   Q  L++++NN+AN+NT G+K++R  F D  YQ  +  G   Q A+ 
Sbjct: 2   MRALYIAKTGMDTSQFQLDVVSNNLANVNTVGFKKSRGIFEDLYYQTLRQPG--GQLANG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ +G+G    +   ++TQG    TG  LDL + G G+F++  PD T  Y+R G 
Sbjct: 60  NANPTGLQVGTGAAAVASSRIFTQGPPQQTGQPLDLQIQGDGFFRLLQPDGTTAYSRNGQ 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G +V  DG  L P I IP   ++I VS +G +      ++  Q  G +L+  FI
Sbjct: 120 FQRDANGNVVNPDGLPLNPNINIPATAQQITVSSAGVVQYTLAGSAAPQTAGTILLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL++IG+NL  +T+ SGDP   NP       +K G+LE+SNV+  +E+  MI+AQR+
Sbjct: 180 NPQGLQSIGNNLYLQTAASGDPQDGNPQTDDRGAIKSGFLESSNVNVTEELVNMITAQRS 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           +EMNS+ +  AD+M   ++ +
Sbjct: 240 FEMNSRAVTTADQMLQKLSNL 260


>gi|212709494|ref|ZP_03317622.1| hypothetical protein PROVALCAL_00536 [Providencia alcalifaciens DSM
           30120]
 gi|212687832|gb|EEB47360.1| hypothetical protein PROVALCAL_00536 [Providencia alcalifaciens DSM
           30120]
          Length = 260

 Score =  230 bits (586), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 102/261 (39%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTNL++I+NN+AN++T G+KR RA F D LYQ  +  G  + S+++
Sbjct: 2   IRSLWIAKTGLDAQQTNLDVISNNLANVSTNGFKRQRAVFEDLLYQNIRQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G +  +   +++QG +  TG   D+A+ G+G+  V+ PD T  YTR G+
Sbjct: 60  TSLPSGLQMGTGARPVATVRIHSQGNLNKTGTTTDIAIKGQGFLHVQMPDGTDAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              +  GQLVT+ G  +VP I+IPE    + ++R G +      ++  Q +GQ+ +  FI
Sbjct: 120 LQRNQDGQLVTSSGYQVVPAIMIPENANSLSIARDGTVSVTVYGDNQPQQIGQITLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T+ SG P  S P   G   + QG LE SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESMGENLYMETASSGAPNESAPGTNGAGLLYQGMLETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   +T++
Sbjct: 240 YEINSKAVSASDQMLQRLTQL 260


>gi|268680164|ref|YP_003304595.1| flagellar basal-body rod protein FlgG [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268618195|gb|ACZ12560.1| flagellar basal-body rod protein FlgG [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 262

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 169/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQT ++  +NNI+N+NT GYK+ RAEFAD +YQ    AG+ + +   
Sbjct: 2   IRSLYTAATGMIAQQTQIDTTSNNISNVNTIGYKKQRAEFADLMYQTMTYAGTSTSATST 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +    GI +G GV+ +++   +TQG    TGN+LD+A+ G G+FQ++ PD T  YTR GS
Sbjct: 62  SPT--GIEVGLGVRPTAIAKQFTQGNFKETGNSLDVAITGNGFFQIQLPDGTTGYTRNGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G +V +DG  L+P + IPE+  +I +  +G +  +    ++   +GQ+ +ANFI
Sbjct: 120 FKLDSEGSVVNSDGYRLLPELTIPEDATQITIGVNGVVSVLQAGQTETNEIGQIELANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDN    TS SGDPI+S P   G    +Q ++E SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSLGDNNYINTSASGDPIVSEPGLNGLGQTRQQFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +DEM   +  ++
Sbjct: 240 YEANSKAITTSDEMLQTVNALK 261


>gi|16126303|ref|NP_420867.1| flagellar basal body rod protein FlgG [Caulobacter crescentus CB15]
 gi|221235080|ref|YP_002517516.1| flagellar basal body rod protein FlgG [Caulobacter crescentus
           NA1000]
 gi|13637955|sp|Q06172|FLGG_CAUCR RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|13423543|gb|AAK24035.1| flagellar basal-body rod protein FlgG [Caulobacter crescentus CB15]
 gi|220964252|gb|ACL95608.1| flagellar basal-body rod protein flgG [Caulobacter crescentus
           NA1000]
          Length = 262

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 126/262 (48%), Positives = 172/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+E+I+NNIAN+NT G+KR RAEF D LYQ  + AGS S S+D 
Sbjct: 1   MQALRTAASGMAAQQLNVEVISNNIANMNTVGFKRQRAEFQDLLYQTIERAGSQS-SSDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+  SV  +  QG    T + LDLA+ G+G+  +  P     YTRAG+
Sbjct: 60  NIVPTGVQVGGGVKAGSVYRITEQGTPTLTDSPLDLAIQGKGYMPILLPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ + +GQ+VT DG  + PGI IP+   +I +S+SG +          Q VGQ+ +ANF+
Sbjct: 120 FSTNDQGQIVTEDGYLVQPGITIPQNATDITISKSGLVQVKLDGQPQPQTVGQIQLANFL 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDNL   T+ SG   ++ P + GF  + Q Y EASNVDAV EI+ +I+AQRA
Sbjct: 180 NEGGLEAIGDNLFLETAASGAATLAAPGEPGFGMLLQHYTEASNVDAVSEITALITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  AD+M    +++R
Sbjct: 240 YEMNSKVISTADQMLQATSQLR 261


>gi|146307867|ref|YP_001188332.1| flagellar basal body rod protein FlgG [Pseudomonas mendocina ymp]
 gi|145576068|gb|ABP85600.1| flagellar basal-body rod protein FlgG [Pseudomonas mendocina ymp]
          Length = 261

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 116/258 (44%), Positives = 160/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ  NL  I+NN+AN+ TTG+KR RAEF D LYQ  +  G   QS+  + 
Sbjct: 4   ALWVSKTGLSAQDMNLTTISNNLANVATTGFKRDRAEFEDLLYQIRRQPG--GQSSQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   + ++T G +  T   LD+A+ GRG+FQ+  PD TV YTR GSF+
Sbjct: 62  LPSGLQLGTGVRVVGTQKIFTAGSLQTTEQPLDMAINGRGFFQILQPDGTVSYTRDGSFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VT+ G  L P IV+P E R   V   G +   T  N   Q +G + +A+F+N 
Sbjct: 122 LNSDGQIVTSQGFALEPAIVLPNEVRTFTVGEDGTVSVTTAGNPQPQIIGNIQLADFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG+NL   T  SG P + NP   G     Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLEAIGNNLFLETGSSGAPQVGNPGLNGLGTTLQNTLENSNVSVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|271500068|ref|YP_003333093.1| flagellar basal-body rod protein FlgG [Dickeya dadantii Ech586]
 gi|270343623|gb|ACZ76388.1| flagellar basal-body rod protein FlgG [Dickeya dadantii Ech586]
          Length = 260

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 116/261 (44%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G++AQQTN+++I+NN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLNAQQTNMDVISNNLANVSTNGFKRQRAVFEDLMYQTVRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S   ++TQG +  TGN  DLA+ G G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVSTERIHTQGGLTETGNAKDLAINGAGFFQVLMPDGTTQYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS GQLVT+ G  + P I IP     I V R G +       +    VGQL +A FI
Sbjct: 120 FQLDSNGQLVTSSGFQVQPAITIPANATNITVGRDGVVTVTQQGQTAPVQVGQLNLAMFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+N+G+NL A T+ SG P  S P   G   + Q Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NEAGLQNMGENLYAETASSGAPTQSTPGLNGAGLIMQKYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I + D+M   +T++
Sbjct: 240 YEINSKAISSTDQMLQKLTQL 260


>gi|302338304|ref|YP_003803510.1| flagellar basal-body rod protein FlgG [Spirochaeta smaragdinae DSM
           11293]
 gi|301635489|gb|ADK80916.1| flagellar basal-body rod protein FlgG [Spirochaeta smaragdinae DSM
           11293]
          Length = 264

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 112/264 (42%), Positives = 166/264 (62%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA+GM+ QQ N++ I+NN++N+NTTG+K+ RA+F D LYQ  +VAG+P  + + 
Sbjct: 2   MRSLWTAASGMTGQQFNIDTISNNLSNVNTTGFKKNRADFEDLLYQTSRVAGTP--ATEL 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ +G GV++++ + ++TQG + +TGN  DLA+ G G+F+V   D +  Y+R GS
Sbjct: 60  TTVPTGVQVGHGVKVAATQKMFTQGALQNTGNVTDLAIQGDGFFRVLLIDGSYGYSRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS GQLV ++G+ L+P +V+PE        +S+ G+I      N D   VGQL +  
Sbjct: 120 FKIDSNGQLVNSNGHRLIPEVVLPENFERDSLTISQDGRITVKVAGNDDPVQVGQLELYR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG N    T+ SGD I   P   G     Q +LE SNV  V+E+  MI AQ
Sbjct: 180 FVNPAGLSAIGQNNFKITNASGDAIPGRPGFDGMGQTVQRFLEMSNVSVVQEMVNMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYELNSKAIQTSDTMLGIANSLK 263


>gi|15596279|ref|NP_249773.1| flagellar basal body rod protein FlgG [Pseudomonas aeruginosa PAO1]
 gi|107100527|ref|ZP_01364445.1| hypothetical protein PaerPA_01001552 [Pseudomonas aeruginosa PACS2]
 gi|116049011|ref|YP_792187.1| flagellar basal body rod protein FlgG [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152984786|ref|YP_001349648.1| flagellar basal body rod protein FlgG [Pseudomonas aeruginosa PA7]
 gi|218892954|ref|YP_002441823.1| flagellar basal body rod protein FlgG [Pseudomonas aeruginosa
           LESB58]
 gi|254234218|ref|ZP_04927541.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa
           C3719]
 gi|254239440|ref|ZP_04932762.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa 2192]
 gi|296390554|ref|ZP_06880029.1| flagellar basal body rod protein FlgG [Pseudomonas aeruginosa PAb1]
 gi|313106037|ref|ZP_07792296.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa
           39016]
 gi|9946998|gb|AAG04471.1|AE004539_13 flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa PAO1]
 gi|115584232|gb|ABJ10247.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166149|gb|EAZ51660.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa
           C3719]
 gi|126192818|gb|EAZ56881.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa 2192]
 gi|150959944|gb|ABR81969.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa PA7]
 gi|218773182|emb|CAW28994.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa
           LESB58]
 gi|310878798|gb|EFQ37392.1| flagellar basal-body rod protein FlgG [Pseudomonas aeruginosa
           39016]
          Length = 261

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 118/260 (45%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + A  ++  G+SAQ  NL  I+NN+AN++TTG+KR RAEF D LYQ  +  G   QS   
Sbjct: 2   LSALWVSKTGLSAQDMNLTTISNNLANVSTTGFKRDRAEFQDLLYQIRRQPG--GQSTQD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + +P G+ +G+GV++   + ++T G +  T   LD+A+ GRG+FQV  PD TV YTR GS
Sbjct: 60  SELPSGLQLGTGVRVVGTQKIFTPGSLQTTEQPLDMAVNGRGFFQVLLPDGTVSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+++S GQ+VT++G  L P IV+P ET+   V + G +   T  N+  Q +G +  A+FI
Sbjct: 120 FHLNSDGQIVTSNGFALEPAIVVPNETQTFTVGQDGTVSVTTTGNAQPQVIGNIQTADFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ IG+NL   T  SG P +  P   G   V Q  LE SNV+ V+E+  MI+ QRA
Sbjct: 180 NPAGLQAIGNNLFLETGSSGAPQVGTPGLNGLGTVAQNTLENSNVNVVEELVNMITTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI  AD+M S +T+
Sbjct: 240 YEMNSKVISTADQMLSFVTQ 259


>gi|260597447|ref|YP_003210018.1| flagellar basal body rod protein FlgG [Cronobacter turicensis
           z3032]
 gi|260216624|emb|CBA29921.1| Flagellar basal-body rod protein flgG [Cronobacter turicensis
           z3032]
          Length = 260

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVLLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I V R G +       +    VGQ+ +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITVGRDGVVSVTQQGTAAPVQVGQINLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESIGENLYTETQSSGTPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|258404727|ref|YP_003197469.1| flagellar basal-body rod protein FlgG [Desulfohalobium retbaense
           DSM 5692]
 gi|257796954|gb|ACV67891.1| flagellar basal-body rod protein FlgG [Desulfohalobium retbaense
           DSM 5692]
          Length = 262

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 114/260 (43%), Positives = 161/260 (61%), Gaps = 3/260 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A   AA GM AQQT +++IANN+AN+NTTG+K++R +F D LYQ  +  G  S    +  
Sbjct: 4   ALSTAATGMEAQQTIVDVIANNLANVNTTGFKKSRVDFQDLLYQDARNVG--SAVTQEND 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           VP G  IG GV+ ++V  + T G++  TGN LDLA+ G G+FQV  PD    YTRAG+  
Sbjct: 62  VPTGTQIGHGVRTAAVYKINTIGDINRTGNELDLAIEGDGFFQVTLPDGETAYTRAGALK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNS-DFQPVGQLLIANFIN 181
            D  G++VT+DG  L P IVIPE   ++ + + G + A     +     +G + +A F N
Sbjct: 122 KDGDGRVVTSDGYPLEPEIVIPENATDVVIGKDGTVQAYLEGEAATPSDLGTIELARFSN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+NIG+NL   T  SG PI+  P + G   + Q +LE SNV  ++E+  MISAQRAY
Sbjct: 182 PAGLKNIGNNLHLETQSSGAPIVDLPGEDGLGALAQNFLEDSNVSTMQEMVNMISAQRAY 241

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK ++ ADEM  +  ++
Sbjct: 242 EINSKAVKTADEMLQMTNQL 261


>gi|146311248|ref|YP_001176322.1| flagellar basal body rod protein FlgG [Enterobacter sp. 638]
 gi|145318124|gb|ABP60271.1| flagellar basal-body rod protein FlgG [Enterobacter sp. 638]
          Length = 260

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 161/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVQLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP  +  I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANSLSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGSGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|224531677|ref|ZP_03672309.1| flagellar basal-body rod protein FlgG [Borrelia valaisiana VS116]
 gi|224511142|gb|EEF81548.1| flagellar basal-body rod protein FlgG [Borrelia valaisiana VS116]
          Length = 265

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 107/264 (40%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQDRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++   ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATHRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE  +    +S  G +      N++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIQNSITISDQGIVSVKIDNNNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   +KQG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEIAGIPGTEGMGRLKQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|73539452|ref|YP_299819.1| flagellar basal body rod protein FlgG [Ralstonia eutropha JMP134]
 gi|72122789|gb|AAZ64975.1| Protein of unknown function DUF1078 [Ralstonia eutropha JMP134]
          Length = 261

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 169/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I+NN+AN++T G+KR RA F D +YQ  +  G  + S+D+
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISNNLANVSTNGFKRGRAVFEDLMYQNIRQPG--ALSSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG    TGN+ D+A++G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVATERIHTQGNPQQTGNSKDVAIIGQGFFQVAMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I IP  T  + V+R G +      +S+   VGQL +A F+
Sbjct: 120 FQVDQNGQLVTSSGFVIQPAITIPANTTSMTVARDGTVSVTQPGSSNNVQVGQLQLATFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G+NL  +T  SG P  + P   G   ++Q Y+EASNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLESMGENLYVQTDASGAPNTTVPGLNGAGVLQQNYVEASNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   +T+M
Sbjct: 240 YEINSKAVQTSDQMLQRLTQM 260


>gi|221199741|ref|ZP_03572784.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           CGD2M]
 gi|221208654|ref|ZP_03581654.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           CGD2]
 gi|221171465|gb|EEE03912.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           CGD2]
 gi|221179980|gb|EEE12384.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           CGD2M]
          Length = 262

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLTQTGNSKDVAINGSGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+    + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQILPAITVPQNATSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVSQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|89068731|ref|ZP_01156117.1| hypothetical protein OG2516_06821 [Oceanicola granulosus HTCC2516]
 gi|89045694|gb|EAR51756.1| hypothetical protein OG2516_06821 [Oceanicola granulosus HTCC2516]
          Length = 261

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 116/262 (44%), Positives = 177/262 (67%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IA  GM AQQTN+++I+NNIAN NTTG+K +RA F D +YQ     G+ + + D 
Sbjct: 1   MKALGIATTGMLAQQTNVDVISNNIANANTTGFKSSRAAFQDLIYQNVAREGALT-AEDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G+ IG GVQ      + TQG ++ TGN+LDLA+ G G+F V  PD +  YTR G 
Sbjct: 60  TVRPTGVDIGLGVQTVGTVRLNTQGGLIATGNDLDLAIDGPGYFAVNLPDGSQGYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++++GQLV   G+ + PG+VIPE T +++++ SG ++A    +     +GQL +  F+
Sbjct: 120 FRVNAEGQLVNLQGHEIDPGLVIPELTTKVEINESGVVMAYVENDPAPVELGQLTLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GLR +G+NL  ++  SG+P+ + P + G   ++QG+LE SNV+ +++I+++I+AQRA
Sbjct: 180 NDSGLRPVGNNLFLQSEASGEPVPAVPGEPGIGIIRQGHLEGSNVNIIQQITDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK IE AD+M +   ++R
Sbjct: 240 YEMNSKAIETADQMMNTANQVR 261


>gi|16760055|ref|NP_455672.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16764535|ref|NP_460150.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29142174|ref|NP_805516.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56413834|ref|YP_150909.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62179696|ref|YP_216113.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161614598|ref|YP_001588563.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553033|ref|ZP_02346783.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167994043|ref|ZP_02575135.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234105|ref|ZP_02659163.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237261|ref|ZP_02662319.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244778|ref|ZP_02669710.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168264028|ref|ZP_02686001.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168467131|ref|ZP_02700973.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168822622|ref|ZP_02834622.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446556|ref|YP_002040433.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450313|ref|YP_002045178.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472223|ref|ZP_03078207.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734396|ref|YP_002114178.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251031|ref|YP_002146864.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197262058|ref|ZP_03162132.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197362757|ref|YP_002142394.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|200390304|ref|ZP_03216915.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|207857313|ref|YP_002243964.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213424682|ref|ZP_03357447.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213582039|ref|ZP_03363865.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213613179|ref|ZP_03371005.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213648928|ref|ZP_03378981.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865503|ref|ZP_03387622.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224584317|ref|YP_002638115.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238911001|ref|ZP_04654838.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289828578|ref|ZP_06546403.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|60392289|sp|P0A1J3|FLGG_SALTY RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|60392290|sp|P0A1J4|FLGG_SALTI RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|25298926|pir||AD0640 flagellar basal-body rod protein FlgG (distal rod protein)
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|47677|emb|CAA36314.1| flgG protein product (AA 1-260) [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16419696|gb|AAL20109.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502349|emb|CAD08303.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29137804|gb|AAO69365.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56128091|gb|AAV77597.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|62127329|gb|AAX65032.1| flagellar biosynthesis, cell-distal portion of basal-body rod
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161363962|gb|ABX67730.1| hypothetical protein SPAB_02348 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405219|gb|ACF65441.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408617|gb|ACF68836.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458587|gb|EDX47426.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194709898|gb|ACF89119.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630467|gb|EDX49093.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197094234|emb|CAR59739.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197214734|gb|ACH52131.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197240313|gb|EDY22933.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289797|gb|EDY29158.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|199602749|gb|EDZ01295.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205322431|gb|EDZ10270.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205328014|gb|EDZ14778.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331903|gb|EDZ18667.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336447|gb|EDZ23211.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205341038|gb|EDZ27802.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205347402|gb|EDZ34033.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709116|emb|CAR33449.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224468844|gb|ACN46674.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261246390|emb|CBG24199.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267992953|gb|ACY87838.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157720|emb|CBW17212.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312912166|dbj|BAJ36140.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320086381|emb|CBY96154.1| Flagellar basal-body rod protein flgG Distal rod protein
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321223797|gb|EFX48860.1| Flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616549|gb|EFY13458.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620510|gb|EFY17374.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622504|gb|EFY19349.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629655|gb|EFY26430.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632625|gb|EFY29371.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636880|gb|EFY33583.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641582|gb|EFY38220.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644072|gb|EFY40618.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650028|gb|EFY46446.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653953|gb|EFY50276.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658485|gb|EFY54747.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663343|gb|EFY59545.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670077|gb|EFY66217.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674859|gb|EFY70950.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676671|gb|EFY72738.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682593|gb|EFY78612.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686654|gb|EFY82633.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322714166|gb|EFZ05737.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129449|gb|ADX16879.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195768|gb|EFZ80944.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198340|gb|EFZ83444.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323209179|gb|EFZ94116.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323209683|gb|EFZ94612.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217861|gb|EGA02576.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222149|gb|EGA06533.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224921|gb|EGA09179.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229663|gb|EGA13786.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323232888|gb|EGA16984.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240623|gb|EGA24665.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242937|gb|EGA26958.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250254|gb|EGA34143.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252629|gb|EGA36467.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323258843|gb|EGA42496.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261032|gb|EGA44625.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266941|gb|EGA50426.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269982|gb|EGA53431.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|332988070|gb|AEF07053.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|84502379|ref|ZP_01000515.1| flagellar basal body rod protein FlgG [Oceanicola batsensis
           HTCC2597]
 gi|84389191|gb|EAQ01988.1| flagellar basal body rod protein FlgG [Oceanicola batsensis
           HTCC2597]
          Length = 261

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 124/262 (47%), Positives = 177/262 (67%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQQTN+++I+NNIAN +TTG+K ARA F D LY+  +  G+P+ S   
Sbjct: 1   MKALGIAATGMMAQQTNVDVISNNIANASTTGFKSARASFQDLLYENIEREGAPT-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+ +    + TQG +  T N  DLA+ GRG+F V  PD    YTR GS
Sbjct: 60  TYLPVGIDVGLGVRTAGTVRLNTQGGLTQTENQTDLAIEGRGYFVVNMPDGNAAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
             ++++GQ+VT  G  + PGIV+P++T  +++  +G + A  G ++    +GQL +A FI
Sbjct: 120 LRLNAEGQIVTQQGYEVNPGIVVPQDTTRVEIGETGIVSAYVGNDAIPVEIGQLTLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AG+R +G+NLLA T  SGDP  +NP D     ++QGYLE SNV+ +++I+++ISAQRA
Sbjct: 180 NDAGMRPLGNNLLAATVASGDPTQANPGDPAVGILRQGYLETSNVNIIQQITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK IE AD+M S   ++R
Sbjct: 240 YEMNSKSIETADQMMSTANQIR 261


>gi|216263448|ref|ZP_03435443.1| flagellar basal-body rod protein FlgG [Borrelia afzelii ACA-1]
 gi|215980292|gb|EEC21113.1| flagellar basal-body rod protein FlgG [Borrelia afzelii ACA-1]
          Length = 265

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 105/264 (39%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE       +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIRDSITISEQGIVSVKIDNSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEIAGIPGSKGMGKLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|161526184|ref|YP_001581196.1| flagellar basal body rod protein FlgG [Burkholderia multivorans
           ATCC 17616]
 gi|189349100|ref|YP_001944728.1| flagellar basal body rod protein FlgG [Burkholderia multivorans
           ATCC 17616]
 gi|221215573|ref|ZP_03588536.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           CGD1]
 gi|160343613|gb|ABX16699.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           ATCC 17616]
 gi|189333122|dbj|BAG42192.1| flagellar basal-body rod protein [Burkholderia multivorans ATCC
           17616]
 gi|221164561|gb|EED97044.1| flagellar basal-body rod protein FlgG [Burkholderia multivorans
           CGD1]
          Length = 262

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+    + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQILPAITVPQNATSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVSQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|303328380|ref|ZP_07358818.1| flagellar basal-body rod protein FlgG [Desulfovibrio sp. 3_1_syn3]
 gi|302861710|gb|EFL84646.1| flagellar basal-body rod protein FlgG [Desulfovibrio sp. 3_1_syn3]
          Length = 261

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 163/262 (62%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++    A GM AQQ N+++I+NN+AN+NTTG+K++RAEF D +YQ  K+AGS ++  ++
Sbjct: 2   MRSLYTGATGMVAQQLNIDVISNNLANVNTTGFKKSRAEFEDLMYQTMKIAGSITEGDNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+ ++V   +TQG+  +TGN LD+A+ G G+FQV   +  +MYTRAGS
Sbjct: 62  --LPVGIQVGMGVRPTAVHKFFTQGDFQNTGNALDVAVEGDGFFQV-DVNGELMYTRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G  L P   +P ET+ I +S +G I A+  +  +     ++ +  FI
Sbjct: 119 FKLNQDGTVVTANGYILQPEFAVPAETKNISISSTGHIAALDSEGQEI-AGAEIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T  SG      P       + QG+LE SNV+ V E+  MI  QRA
Sbjct: 178 NPAGLDARGRNLYTPTEASGAETEGVPGTDNVGTLAQGFLEMSNVEVVDEMVNMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+ +D M  +  +++
Sbjct: 238 YEVNSKAIQTSDSMLGMAVQLK 259


>gi|163794152|ref|ZP_02188125.1| Flagellar basal body rod protein [alpha proteobacterium BAL199]
 gi|159180766|gb|EDP65285.1| Flagellar basal body rod protein [alpha proteobacterium BAL199]
          Length = 261

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 131/262 (50%), Positives = 174/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA+ GM+AQQ N+E+I+NNIAN+NTTGYKR RAEF D LYQ  +  G+ S S   
Sbjct: 1   MQSLNIASTGMAAQQFNVEVISNNIANMNTTGYKRQRAEFQDLLYQDLRRVGTNS-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP GI IG GV+ ++   +  QG +  T N  DLA++G+G+FQVE P+    YTRAGS
Sbjct: 60  TIVPSGIQIGVGVKTAATYRINEQGALTLTDNKFDLAILGQGYFQVELPNGETAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  +  G LVT DG T+ PGI IP +T  + ++ SGQ+ A        Q VGQL +A F 
Sbjct: 120 FQTNQDGTLVTPDGYTVQPGITIPSDTLSVTINESGQVFAQIDGQVQEQNVGQLQLAIFQ 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL NIG NLL  TS SG      P   GF  ++QG++EASNVD V EI+ +I+AQRA
Sbjct: 180 NDAGLENIGQNLLLETSASGAATTGVPGATGFGKLQQGFVEASNVDPVHEITNLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK+IE +D+M S +  +R
Sbjct: 240 YELNSKIIETSDQMMSTVNNVR 261


>gi|156934438|ref|YP_001438354.1| flagellar basal body rod protein FlgG [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156532692|gb|ABU77518.1| hypothetical protein ESA_02269 [Cronobacter sakazakii ATCC BAA-894]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHTQGNLSQTNNSKDVAIKGQGFFQVLLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I V R G +       +    VGQ+ +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITVGRDGVVSVTQQGTAAPVQVGQINLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDSGLESIGENLYTETQSSGTPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|51246533|ref|YP_066417.1| flagellar hook basal body protein (FlgG) [Desulfotalea psychrophila
           LSv54]
 gi|50877570|emb|CAG37410.1| probable flagellar hook basal body protein (FlgG) [Desulfotalea
           psychrophila LSv54]
          Length = 261

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/260 (41%), Positives = 164/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++      GM AQQ N++IIANN+AN+NTTG+K++ A+F D LYQ  KV G  SQ++   
Sbjct: 3   RSLWTGTTGMQAQQLNIDIIANNLANVNTTGFKKSSADFQDLLYQTMKVPG--SQTSPDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P GI +G GV+ ++V  V+TQG+++ T N LD+A+ GRG+FQ+E PD  + YTRAG+F
Sbjct: 61  ESPTGILVGLGVKPAAVTKVFTQGDLIQTENELDVAIQGRGFFQIEAPDGNIKYTRAGAF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             DS G++ ++DG  L+P I IP   +++ +  +G +      +S    +G + +A F N
Sbjct: 121 KRDSNGRMTSSDGYPLIPEITIPSGAKQVSIGETGIVSVKLDSDSTETEIGTIELAGFTN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL  IG NL   T  SG   I  P + G+  + Q YLE SNV+ V E++ MIS QRAY
Sbjct: 181 PAGLAAIGKNLFEETGASGTATIGIPGEEGYGTLIQQYLEGSNVNLVAEMAAMISTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NS +++ +D+M   +  +
Sbjct: 241 EINSSMVKTSDQMMQTVNDL 260


>gi|121607559|ref|YP_995366.1| flagellar basal-body rod protein FlgG [Verminephrobacter eiseniae
           EF01-2]
 gi|121552199|gb|ABM56348.1| flagellar basal-body rod protein FlgG [Verminephrobacter eiseniae
           EF01-2]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + A  IA  GMSAQQT L++IA+N+AN++TTGYKR+ A F D +YQ  +  G  + S ++
Sbjct: 2   IDALWIAKTGMSAQQTQLDVIAHNLANVSTTGYKRSNAMFEDLIYQNLRQVG--ANSTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    + QG +  + NNLD+A+ G G+FQV  PD ++ YTR GS
Sbjct: 60  NQLPTGLQLGLGVRTVATSRCFVQGSLQESRNNLDVAINGNGFFQVMLPDGSLGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G+LVTA+G  +  GI I      + +S  G + A+   +   QP+G L +A+FI
Sbjct: 120 FQVDAQGRLVTANGLPVANGITIAANAISVSISAEGAVSAIMPGSVQPQPLGNLAMASFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   ++ SG P    P   G   +KQG+LEASN++ V+E+  MI  QRA
Sbjct: 180 NPAGLEPIGQNLFKESAASGQPQQGIPGSNGLGVIKQGFLEASNINIVEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + ++++
Sbjct: 240 YEMNSKAIQTSDQMLAKLSQL 260


>gi|15595119|ref|NP_212908.1| flagellar basal body rod protein FlgG [Borrelia burgdorferi B31]
 gi|195941595|ref|ZP_03086977.1| flagellar basal body rod protein FlgG [Borrelia burgdorferi 80a]
 gi|216264940|ref|ZP_03436932.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 156a]
 gi|221217835|ref|ZP_03589302.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 72a]
 gi|223889350|ref|ZP_03623936.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 64b]
 gi|224532949|ref|ZP_03673558.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi
           WI91-23]
 gi|224533277|ref|ZP_03673871.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi
           CA-11.2a]
 gi|225548956|ref|ZP_03769933.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 94a]
 gi|225549893|ref|ZP_03770854.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 118a]
 gi|226320636|ref|ZP_03796195.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 29805]
 gi|226321474|ref|ZP_03797001.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi Bol26]
 gi|3913655|sp|O51715|FLGG_BORBU RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|2688724|gb|AAC67132.1| flagellar basal-body rod protein (flgG) [Borrelia burgdorferi B31]
 gi|215981413|gb|EEC22220.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 156a]
 gi|221192141|gb|EEE18361.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 72a]
 gi|223885036|gb|EEF56140.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 64b]
 gi|224512113|gb|EEF82505.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi
           WI91-23]
 gi|224513442|gb|EEF83799.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi
           CA-11.2a]
 gi|225369352|gb|EEG98804.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 118a]
 gi|225370559|gb|EEG99995.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 94a]
 gi|226233270|gb|EEH32022.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi Bol26]
 gi|226233959|gb|EEH32681.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi 29805]
 gi|312149206|gb|ADQ29277.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi N40]
          Length = 265

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 106/264 (40%), Positives = 161/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ    AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTHNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I+ PEE  +    +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNILFPEEYIQNSITISEEGIVSVKIDTSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           FIN AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FINPAGLSAIGSNLFKETAGSGQEIAGIPGSEGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|254698165|ref|ZP_05159993.1| flagellar basal body rod protein FlgG [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 246

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 137/247 (55%), Positives = 183/247 (74%), Gaps = 2/247 (0%)

Query: 17  NLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQIS 76
           NLE+IANNIANINTTG+KRARAEF D LYQ+E+ AG P+Q A++A+VPEG  +G GVQ +
Sbjct: 1   NLEVIANNIANINTTGFKRARAEFTDLLYQSERTAGVPNQ-ANQAIVPEGALVGLGVQTA 59

Query: 77  SVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNT 136
           +VRN++ QG    TGN  D+AL GRGWFQ+++P    +YTRAG+FN ++ GQLVT DGN 
Sbjct: 60  AVRNLHIQGSFNQTGNPYDVALTGRGWFQIQSPTGETLYTRAGAFNKNADGQLVTLDGNP 119

Query: 137 LVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLART 196
           + P I IP +  E+ ++ +GQ+ A      +   +GQL +ANF NEAGL  +G NL   T
Sbjct: 120 VEPAITIPPDAIEVTITDTGQVFAKLQDQINQVDLGQLTLANFTNEAGLEPLGGNLYRET 179

Query: 197 SVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSS 256
             SG P++  P D G+  +KQGYLEASNVD VKEI+++I+AQRAYEMNSKVI+AADEM++
Sbjct: 180 EASGGPLVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRAYEMNSKVIQAADEMAA 239

Query: 257 LIT-KMR 262
            ++  +R
Sbjct: 240 TVSKNLR 246


>gi|198244335|ref|YP_002215958.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197938851|gb|ACH76184.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|326623706|gb|EGE30051.1| flagellar basal-body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+ +
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSGQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|49082998|gb|AAT50899.1| PA1082 [synthetic construct]
          Length = 262

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 118/260 (45%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + A  ++  G+SAQ  NL  I+NN+AN++TTG+KR RAEF D LYQ  +  G   QS   
Sbjct: 2   LSALWVSKTGLSAQGMNLTTISNNLANVSTTGFKRDRAEFQDLLYQIRRQPG--GQSTQD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + +P G+ +G+GV++   + ++T G +  T   LD+A+ GRG+FQV  PD TV YTR GS
Sbjct: 60  SELPSGLQLGTGVRVVGTQKIFTPGSLQTTEQPLDMAVNGRGFFQVLLPDGTVSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+++S GQ+VT++G  L P IV+P ET+   V + G +   T  N+  Q +G +  A+FI
Sbjct: 120 FHLNSDGQIVTSNGFALEPVIVVPNETQTFTVGQDGTVSVTTTGNAQPQVIGNIQTADFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ IG+NL   T  SG P +  P   G   V Q  LE SNV+ V+E+  MI+ QRA
Sbjct: 180 NPAGLQAIGNNLFLETGSSGAPQVGTPGLNGLGTVAQNTLENSNVNVVEELVNMITTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI  AD+M S +T+
Sbjct: 240 YEMNSKVISTADQMLSFVTQ 259


>gi|146277706|ref|YP_001167865.1| flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555947|gb|ABP70560.1| flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17025]
          Length = 262

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 158/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            A  +A  G++AQQT +++I+NN+AN+NTTG+KR RA F   LYQ  K  G+ +  A   
Sbjct: 4   NAMHVAKTGLNAQQTRMQVISNNLANVNTTGFKRDRANFESLLYQTWKPGGAQTSEATAM 63

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P    +G+GV++ S   +YTQG + +T N LDLA+ G G+FQV  PD  + YTR G+F
Sbjct: 64  TSPSA--VGTGVRVVSTEKLYTQGSLANTDNALDLAIDGPGFFQVLLPDGRMGYTRNGTF 121

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           + +++G + T  G  + P I IPE    + +S  G +  +    ++ Q VGQ+ IA F N
Sbjct: 122 SQNAEGTITTPSGYVVQPEIQIPEGAVSVTISADGIVSVLMPDETEAQEVGQITIATFAN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ +G+     T+ SG+  I NP + GF  + QG LE+SNV+ V+E+ +MI  QRAY
Sbjct: 182 PRGLQPVGETFAVETAASGEAAIGNPVEPGFGKLVQGALESSNVNVVQELVDMIETQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           E+NSK I A+DEM   +  
Sbjct: 242 EVNSKSISASDEMMQYLAN 260


>gi|218549194|ref|YP_002382985.1| flagellar basal body rod protein FlgG [Escherichia fergusonii ATCC
           35469]
 gi|218356735|emb|CAQ89363.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia fergusonii ATCC 35469]
 gi|324113873|gb|EGC07847.1| flagellar basal-body rod protein FlgG [Escherichia fergusonii B253]
 gi|325497614|gb|EGC95473.1| flagellar basal body rod protein FlgG [Escherichia fergusonii
           ECD227]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYVETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|218249434|ref|YP_002375273.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi ZS7]
 gi|218164622|gb|ACK74683.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi ZS7]
          Length = 265

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 106/264 (40%), Positives = 162/264 (61%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ    AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTHNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I+ PEE  +    +S+ G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNILFPEEYIQNSITISKEGIVSVKIDTSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           FIN AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FINPAGLSAIGSNLFKETAGSGQEIAGIPGSEGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|237731009|ref|ZP_04561490.1| flagellar basal body rod protein FlgG [Citrobacter sp. 30_2]
 gi|226906548|gb|EEH92466.1| flagellar basal body rod protein FlgG [Citrobacter sp. 30_2]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP  +  I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANSLSITIGRDGIVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|225551864|ref|ZP_03772807.1| flagellar basal-body rod protein FlgG [Borrelia sp. SV1]
 gi|225371659|gb|EEH01086.1| flagellar basal-body rod protein FlgG [Borrelia sp. SV1]
          Length = 265

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 106/264 (40%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ    AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTHNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV--SRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE  +  +  S  G +      N++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIQNSIAISEEGIVSVKIDNNNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEIAGIPGSEGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|195940720|ref|ZP_03086102.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           str. EC4024]
 gi|295096223|emb|CBK85313.1| flagellar basal-body rod protein FlgG, Gram-negative bacteria
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVQLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGIVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGTPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|261339378|ref|ZP_05967236.1| flagellar basal-body rod protein FlgG [Enterobacter cancerogenus
           ATCC 35316]
 gi|288318179|gb|EFC57117.1| flagellar basal-body rod protein FlgG [Enterobacter cancerogenus
           ATCC 35316]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQ++ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQIQLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGTPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|220903671|ref|YP_002478983.1| flagellar basal body rod protein FlgG [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867970|gb|ACL48305.1| flagellar basal-body rod protein FlgG [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 261

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 164/262 (62%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++    A GM AQQ N+++I+NN+AN+NTTG+K++RAEF D +YQ  ++AGS ++  ++
Sbjct: 2   MRSLWTGATGMVAQQLNIDVISNNLANVNTTGFKKSRAEFEDLMYQTMRMAGSITEGDNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G G + ++V   +TQG+  +TGN LD+A+ G G+FQV   +  +MYTRAGS
Sbjct: 62  --LPVGIQVGMGTRPTAVHKFFTQGDFQNTGNTLDVAIEGDGFFQV-DVNGELMYTRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G  L P   +P ET+ I +S SG I A+  +  +     ++ +  FI
Sbjct: 119 FKLNQDGVVVTANGYILQPEFAVPPETKNISISSSGHIAALDAQGQEI-AGAEIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T  SG+ +   P       + QG+LE SNV+ V E+  MI  QRA
Sbjct: 178 NYAGLDARGRNLFTPTEASGEAVEGIPGTDNVGTLAQGFLEMSNVEVVDEMVNMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+ +D M  +  +++
Sbjct: 238 YEVNSKSIQTSDSMLGIAVQLK 259


>gi|119899025|ref|YP_934238.1| flagellar basal body rod protein FlgG [Azoarcus sp. BH72]
 gi|119671438|emb|CAL95351.1| flagellar basal-body rod protein FlgG [Azoarcus sp. BH72]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 101/261 (38%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A  G+ AQQT+L++I+NN+AN++T G+KR RA F D LYQ  +  G  +QS  +
Sbjct: 2   IRSLWTARTGLDAQQTSLDVISNNLANVSTNGFKRQRAVFEDLLYQTMRQPG--AQSTQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             V  G+ IG+GV+  +   ++TQG +  TG +LD+A+ G G+FQ+  PD T  YTR G+
Sbjct: 60  TQVGSGLQIGTGVRPVATERIFTQGNLQQTGGSLDIAIQGNGFFQIALPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G +VTA G  L   I IP +T  + V++ G +  +    +    +G + +A FI
Sbjct: 120 FQLDNQGNVVTASGYPLADNINIPADTLTVTVAKDGTVSVLQAGQTTPTQIGAIQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL++ G+NL   ++ SG    + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NSGGLQSAGENLFLESASSGVATPNQPGTNGTGVLNQGYVETSNVNVAEELVNMIVTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNS+ I+ +D M   +T++
Sbjct: 240 YEMNSRAIQTSDSMLGRLTQL 260


>gi|283833628|ref|ZP_06353369.1| flagellar basal-body rod protein FlgG [Citrobacter youngae ATCC
           29220]
 gi|291071311|gb|EFE09420.1| flagellar basal-body rod protein FlgG [Citrobacter youngae ATCC
           29220]
          Length = 260

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGIVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|296102906|ref|YP_003613052.1| flagellar basal body rod protein FlgG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057365|gb|ADF62103.1| flagellar basal body rod protein FlgG [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 260

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVQLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGTPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|218689031|ref|YP_002397243.1| flagellar basal body rod protein FlgG [Escherichia coli ED1a]
 gi|218426595|emb|CAR07423.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli ED1a]
          Length = 260

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVEMSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|161503733|ref|YP_001570845.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865080|gb|ABX21703.1| hypothetical protein SARI_01818 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 260

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALNITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|323139654|ref|ZP_08074696.1| flagellar basal-body rod protein FlgG [Methylocystis sp. ATCC
           49242]
 gi|322395086|gb|EFX97645.1| flagellar basal-body rod protein FlgG [Methylocystis sp. ATCC
           49242]
          Length = 262

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 137/260 (52%), Positives = 182/260 (70%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ N+E+IA+NIANINTTG+KR+RAEF D LYQ +++ G  ++  D 
Sbjct: 1   MRALAIAATGMSAQQQNIEVIAHNIANINTTGFKRSRAEFTDLLYQTDRLQGVSNRGRDA 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P+G   G GV+ ++VR++  QG + +TGN  DL++ GRGWFQ+   D   +YTRAGS
Sbjct: 61  TV-PQGAQFGLGVRAAAVRSLQQQGPLTNTGNMYDLSMNGRGWFQILGSDNETLYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ ++ GQLVT DG  L P I IP  T  + VS+SG + A+    +  Q +GQL +ANF 
Sbjct: 120 FSTNNNGQLVTVDGYLLTPTITIPNNTLNVSVSQSGIVSAIVAGQTQPQQIGQLTVANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL  +G NL   T  SG PI+  P D GF  + QGYLE+SNVD VKE+  +ISAQRA
Sbjct: 180 NESGLEALGGNLFRETYASGQPIVGIPGDPGFGVINQGYLESSNVDPVKELVSLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +E+NSKVI+AADEM+  I+K
Sbjct: 240 FELNSKVIQAADEMAGTISK 259


>gi|294339841|emb|CAZ88204.1| Flagellar basal-body rod protein flgG (Distal rod protein)
           [Thiomonas sp. 3As]
          Length = 261

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  +A  G+ A+QT +++IANN+AN+NT+G+K +RA F D LYQ     G  +QS+  
Sbjct: 2   IRSLYVAKTGLEAEQTRMDVIANNLANVNTSGFKGSRAVFQDLLYQNLTQPG--AQSSQS 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ +G+GV+  S   + TQG +  TGN+LD+A+ G+G+FQV  P+ T+ YTR G+
Sbjct: 60  TQYPSGLQLGTGVRPVSTERLMTQGNLTQTGNSLDVAINGQGFFQVLEPNGTIAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++++GQLVTA+G  + P + IP   + + +   G +       +  Q VG L +A+F+
Sbjct: 120 FQLNNQGQLVTANGYLVQPTVTIPASAQSVTIGNDGTVSVTLPGQAAPQQVGALQLASFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL++IGDNL  +T  SG P    P   G   V+QGYLE+SNV+ V E+ +MIS QRA
Sbjct: 180 NPTGLQSIGDNLYLQTGSSGAPNTGQPTLNGLGSVRQGYLESSNVNVVAELVDMISTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YE+NSK + A+D+M   +  
Sbjct: 240 YEVNSKAVTASDQMLQYVNN 259


>gi|223040682|ref|ZP_03610951.1| flagellar basal-body rod protein FlgG [Campylobacter rectus RM3267]
 gi|222878046|gb|EEF13158.1| flagellar basal-body rod protein FlgG [Campylobacter rectus RM3267]
          Length = 262

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 168/262 (64%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ ++NIAN+NT GYK+ RAEFAD +YQ  + AG  + ++  
Sbjct: 2   MRSIYSAATGMIAQQTQIDVTSHNIANVNTIGYKKNRAEFADLMYQVMEYAG--TATSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G G + +++  +++QG    T NNLD+ + G G+FQV+ PD T  YTR G+
Sbjct: 60  TKSPTGIEVGLGARPTAITKIFSQGYFKETSNNLDMVIAGNGFFQVQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++S+G +V +DG  L P + IP +  +I V   G +  +   N++   VG++ +ANFI
Sbjct: 120 FKLNSEGTVVNSDGYVLQPQMTIPADATQISVGTDGTVSVLQPGNTEMAQVGRIELANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   T  SG+ ++      G   ++QG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSMGDNLYLPTGSSGEVVVGTAGLDGLGTIRQGFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +D+M S++  ++
Sbjct: 240 YEANSKAITTSDDMLSIVNSLK 261


>gi|289208116|ref|YP_003460182.1| flagellar basal-body rod protein FlgG [Thioalkalivibrio sp. K90mix]
 gi|288943747|gb|ADC71446.1| flagellar basal-body rod protein FlgG [Thioalkalivibrio sp. K90mix]
          Length = 262

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 160/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  IA  G+ AQ T +  ++NN+AN+NTTG+K+ RA F D +YQ  +  G  +Q+    
Sbjct: 3   QALWIAKTGLDAQHTRMSTVSNNLANVNTTGFKKDRAVFEDLIYQTVRQPG--AQATQDQ 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ IG+GV+  S   ++TQG +  T N+LD+A+ GRG+FQV  P+  + YTR GSF
Sbjct: 61  QLPSGLQIGTGVRAVSTEKMFTQGNLQQTDNSLDVAIEGRGFFQVLMPNGDIGYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +++ G++V ++G  L PG+ +P +T+ + + + G + A     ++   +G + +A+F+N
Sbjct: 121 QLNADGEVVMSNGYPLQPGLFVPPDTQSLAIGKDGTVTAQIPGQAEPVELGNIQLADFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG+NL   T+ SG    + P   G   + QG LE SNV+  +E+  MI  QRAY
Sbjct: 181 PAGLQAIGENLFQETAASGVAQQAQPGLNGTGTLVQGSLETSNVNIAEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           E+NSK I AAD+    + +
Sbjct: 241 EVNSKAISAADQSLQFVNQ 259


>gi|86151551|ref|ZP_01069765.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85841180|gb|EAQ58428.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 260.94]
          Length = 263

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 102/263 (38%), Positives = 163/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKSRAEFADLMYQVMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 60  TLSPSGIEVGVGVRPTAVTKVFTEGNLKSTNTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 120 QFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 240 AYEAGSKAITTSDDMLGIVNQLK 262


>gi|329297209|ref|ZP_08254545.1| Flagellar basal-body rod protein flgG [Plautia stali symbiont]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR+RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRSRAVFEDLMYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++ QG +  T N+ ++A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVTTERLHNQGNLSQTSNSKNVAINGQGYFQVQMPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT  G  + PGI IP     I ++R G +       +    VGQL ++ F+
Sbjct: 120 FQVDQNGQLVTNAGFPVQPGITIPANATSITIARDGVVTVTQQGQTQPAQVGQLTLSTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  S P   G   + Q Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLDSVGENLYQETQASGAPTESTPGQNGAGLLYQSYVETSNVNVAEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   +T++
Sbjct: 240 YEINSKAISTSDQMLQKLTQL 260


>gi|15616948|ref|NP_240161.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681701|ref|YP_002468087.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682256|ref|YP_002468640.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|257471397|ref|ZP_05635396.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str.
           LSR1 (Acyrthosiphon pisum)]
 gi|11386809|sp|P57424|FLGG_BUCAI RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|25298916|pir||G84969 flagellar basal-body rod protein flgG [imported] - Buchnera sp.
           (strain APS)
 gi|10039013|dbj|BAB13047.1| flagellar basal-body rod protein flgG [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621989|gb|ACL30145.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|219624544|gb|ACL30699.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086079|gb|ADP66161.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str.
           LL01 (Acyrthosiphon pisum)]
 gi|311086651|gb|ADP66732.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
 gi|311087237|gb|ADP67317.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str.
           JF99 (Acyrthosiphon pisum)]
 gi|311087756|gb|ADP67835.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str.
           JF98 (Acyrthosiphon pisum)]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  I+  G+ AQQ N+ II+NN+AN++T G+KR+RA F D +YQ  + AG  + S+ +
Sbjct: 2   IPSLWISKTGLDAQQINMNIISNNLANVSTNGFKRSRAVFEDLMYQTIREAG--TNSSLE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S   ++TQG +  T  + D+A+ G G+FQV+ PD  + YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVSTERIHTQGNLSKTDASKDVAINGSGFFQVQLPDGNIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT  G  ++P I IP  +  I ++R G I  V    +    +GQL + NF+
Sbjct: 120 FQLDQNGQLVTNSGFPIIPEINIPSNSTNINIARDGVISVVVQGQTQPVLLGQLNLINFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T  SG PI + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NNSGLESLGENLYQETQASGSPIETTPGLNGTGVLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   ++++
Sbjct: 240 YEINSKSISTSDQMLQKLSQL 260


>gi|126668560|ref|ZP_01739514.1| Flagellar basal body rod protein [Marinobacter sp. ELB17]
 gi|126626965|gb|EAZ97608.1| Flagellar basal body rod protein [Marinobacter sp. ELB17]
          Length = 262

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ TN+  I+NN+AN+NTTG+KR RA F D LYQ ++  G    +     
Sbjct: 4   ALWVSKTGLSAQDTNMSTISNNLANVNTTGFKRDRAVFQDLLYQVKRQPG--GLNTQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++      +TQG +  T   LD+A+ GRG+ QV+ PD    YTR G F 
Sbjct: 62  LPSGLQLGTGVRVVGTVKQFTQGNLQITEQPLDMAVNGRGFLQVQLPDGQTAYTRDGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S G +V   G  L P I IPE    + + R G + AVT   +    +GQ+ + +FIN 
Sbjct: 122 LNSDGDVVNPSGYALEPNINIPENATNVTIGRDGTVTAVTDDQAAPINLGQITLVDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG+NL  +T+ SGDP    P   G   ++QG +E+SNV+ V+E+  MI+ QRAYE
Sbjct: 182 QGLQAIGNNLFKQTNASGDPTEGEPGLAGLGSLEQGSIESSNVEVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+   D+M   IT 
Sbjct: 242 MNSKVVSTVDQMLQFITN 259


>gi|259907636|ref|YP_002647992.1| Flagellar basal-body rod protein, FlgG [Erwinia pyrifoliae Ep1/96]
 gi|224963258|emb|CAX54742.1| Flagellar basal-body rod protein, FlgG [Erwinia pyrifoliae Ep1/96]
 gi|283477478|emb|CAY73394.1| Flagellar basal-body rod protein flgG [Erwinia pyrifoliae DSM
           12163]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN+ +TG+KR RA F D LYQ  +  G  +Q++++
Sbjct: 2   IRSLWIAKTGLEAQQTNMDVISNNLANVGSTGFKRQRAVFQDLLYQTMRQPG--AQASEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV   + + ++TQG +  TG + D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPTGMQLGTGVATVATQRMHTQGSLTQTGRDYDMAIQGKGFFQVQLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+++  GQ+VTA+GN + P I +P + +++ V   G + A     +  Q +GQL +ANFI
Sbjct: 120 FSLNENGQMVTAEGNPVQPDITVPADAQKLTVGEDGIVTATVPGQAAPQQIGQLTLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G NL   T  SG P  + P   G   +K  Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESLGGNLYVETQASGAPNEATPGMDGAGRLKHQYIETSNVNVAEELVTMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   + ++
Sbjct: 240 YEINSKAVSASDQMLQRLAQL 260


>gi|157146224|ref|YP_001453543.1| flagellar basal body rod protein FlgG [Citrobacter koseri ATCC
           BAA-895]
 gi|157083429|gb|ABV13107.1| hypothetical protein CKO_01981 [Citrobacter koseri ATCC BAA-895]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP  +  I V R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANSLSITVGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|170768358|ref|ZP_02902811.1| flagellar basal-body rod protein FlgG [Escherichia albertii
           TW07627]
 gi|170123124|gb|EDS92055.1| flagellar basal-body rod protein FlgG [Escherichia albertii
           TW07627]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAVPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL + T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYSETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|221069320|ref|ZP_03545425.1| flagellar basal-body rod protein FlgG [Comamonas testosteroni KF-1]
 gi|220714343|gb|EED69711.1| flagellar basal-body rod protein FlgG [Comamonas testosteroni KF-1]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  GM AQQT L++I++N+AN++TTGYKRA A F D +YQ  + +G  SQ+ ++
Sbjct: 2   INSLFIAKTGMEAQQTQLDVISHNLANVSTTGYKRANAVFEDLIYQNLRQSG--SQTTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    + QG +  + N LD+A+ G G+F+V  PD T+ YTR GS
Sbjct: 60  NQLPTGLHLGLGVRTVATSRNFLQGSLQQSSNALDVAINGNGFFEVNMPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+GQLVT+ G  +  GI IP+   ++ +S  G +       +  Q VG + ++ FI
Sbjct: 120 FEVDSQGQLVTSSGLPVANGITIPQGATKVSISHDGVVSVTMPGQAAPQQVGNIAMSQFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T+ SG P    P   G   ++QGYLEASNV+ V+E+  MI  QRA
Sbjct: 180 NAAGLEPRGQNLYVETASSGQPQQGTPGTNGLGTIQQGYLEASNVNVVQELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + + ++
Sbjct: 240 YEMNSKAIQTSDQMLAKLAQL 260


>gi|331652131|ref|ZP_08353150.1| flagellar basal-body rod protein FlgG [Escherichia coli M718]
 gi|331050409|gb|EGI22467.1| flagellar basal-body rod protein FlgG [Escherichia coli M718]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NETGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|264676572|ref|YP_003276478.1| flagellar basal-body rod protein FlgG [Comamonas testosteroni
           CNB-2]
 gi|299531284|ref|ZP_07044694.1| flagellar basal-body rod protein FlgG [Comamonas testosteroni S44]
 gi|262207084|gb|ACY31182.1| flagellar basal-body rod protein FlgG [Comamonas testosteroni
           CNB-2]
 gi|298720691|gb|EFI61638.1| flagellar basal-body rod protein FlgG [Comamonas testosteroni S44]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  GM AQQT L++I++N+AN++TTGYKRA A F D +YQ  + +G  SQ+ ++
Sbjct: 2   INSLFIAKTGMEAQQTQLDVISHNLANVSTTGYKRANAVFEDLIYQNLRQSG--SQTTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    + QG +  + N LD+A+ G G+F+V  PD T+ YTR GS
Sbjct: 60  NQLPTGLHLGLGVRTVATSRNFLQGSLQQSSNALDVAINGNGFFEVNMPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++GQLVT+ G  +  GI IP+   ++ +S  G +       +  Q VG + ++ FI
Sbjct: 120 FEVDAQGQLVTSSGLPVANGITIPQGATKVSISHDGVVSVTMPGQAAPQQVGNIAMSQFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T+ SG P    P   G   ++QGYLEASNV+ V+E+  MI  QRA
Sbjct: 180 NAAGLEPRGQNLYVETASSGQPQQGTPGTNGLGTIQQGYLEASNVNVVQELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + + ++
Sbjct: 240 YEMNSKAIQTSDQMLAKLAQL 260


>gi|310764858|gb|ADP09808.1| Flagellar basal-body rod protein, FlgG [Erwinia sp. Ejp617]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 170/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN+ +TG+KR RA F D LYQ  +  G  +Q++++
Sbjct: 2   IRSLWIAKTGLEAQQTNMDVISNNLANVGSTGFKRQRAVFQDLLYQTMRQPG--AQASEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV   + + ++TQG +  TG + D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPTGMQLGTGVATVATQRMHTQGSLTQTGRDYDMAIQGKGFFQVQLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+++  GQ+VTA+GN L P I +P + +++ V   G + A     +  Q +GQL +ANFI
Sbjct: 120 FSLNENGQMVTAEGNPLQPDITVPADAQKLTVGEDGIVTATVPGQAAPQQIGQLTLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G NL   T  SG P  + P   G   +K  Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESLGGNLYVETQASGAPNEATPGMDGAGRLKHQYIETSNVNVAEELVTMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   + ++
Sbjct: 240 YEINSKAVSASDQMLQRLAQL 260


>gi|53717916|ref|YP_106902.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           K96243]
 gi|53724567|ref|YP_104800.1| flagellar basal body rod protein FlgG [Burkholderia mallei ATCC
           23344]
 gi|67641540|ref|ZP_00440317.1| flagellar basal-body rod protein FlgG [Burkholderia mallei GB8
           horse 4]
 gi|76808723|ref|YP_331881.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           1710b]
 gi|121598854|ref|YP_994293.1| flagellar basal body rod protein FlgG [Burkholderia mallei SAVP1]
 gi|124386502|ref|YP_001028058.1| flagellar basal body rod protein FlgG [Burkholderia mallei NCTC
           10229]
 gi|126439033|ref|YP_001057324.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           668]
 gi|126450732|ref|YP_001082865.1| flagellar basal body rod protein FlgG [Burkholderia mallei NCTC
           10247]
 gi|126454438|ref|YP_001064566.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           1106a]
 gi|134283616|ref|ZP_01770315.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           305]
 gi|167001539|ref|ZP_02267334.1| flagellar basal-body rod protein FlgG [Burkholderia mallei PRL-20]
 gi|167717662|ref|ZP_02400898.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           DM98]
 gi|167736705|ref|ZP_02409479.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           14]
 gi|167813804|ref|ZP_02445484.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           91]
 gi|167822320|ref|ZP_02453791.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei 9]
 gi|167843910|ref|ZP_02469418.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           B7210]
 gi|167892412|ref|ZP_02479814.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           7894]
 gi|167900910|ref|ZP_02488115.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           NCTC 13177]
 gi|167917166|ref|ZP_02504257.1| flagellar basal body rod protein FlgG [Burkholderia pseudomallei
           BCC215]
 gi|217425015|ref|ZP_03456511.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           576]
 gi|226199816|ref|ZP_03795367.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810463|ref|YP_002894914.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           MSHR346]
 gi|242317698|ref|ZP_04816714.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1106b]
 gi|254175110|ref|ZP_04881771.1| flagellar basal-body rod protein FlgG [Burkholderia mallei ATCC
           10399]
 gi|254182138|ref|ZP_04888735.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1655]
 gi|254196575|ref|ZP_04902999.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           S13]
 gi|254201898|ref|ZP_04908262.1| flagellar basal-body rod protein FlgG [Burkholderia mallei FMH]
 gi|254207232|ref|ZP_04913583.1| flagellar basal-body rod protein FlgG [Burkholderia mallei JHU]
 gi|254261052|ref|ZP_04952106.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1710a]
 gi|254295816|ref|ZP_04963273.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           406e]
 gi|254359734|ref|ZP_04976005.1| flagellar basal-body rod protein FlgG [Burkholderia mallei
           2002721280]
 gi|52208330|emb|CAH34263.1| flagellar basal-body rod protein [Burkholderia pseudomallei K96243]
 gi|52427990|gb|AAU48583.1| flagellar basal-body rod protein FlgG [Burkholderia mallei ATCC
           23344]
 gi|76578176|gb|ABA47651.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1710b]
 gi|121227664|gb|ABM50182.1| flagellar basal-body rod protein FlgG [Burkholderia mallei SAVP1]
 gi|124294522|gb|ABN03791.1| flagellar basal-body rod protein FlgG [Burkholderia mallei NCTC
           10229]
 gi|126218526|gb|ABN82032.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           668]
 gi|126228080|gb|ABN91620.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1106a]
 gi|126243602|gb|ABO06695.1| flagellar basal-body rod protein FlgG [Burkholderia mallei NCTC
           10247]
 gi|134245025|gb|EBA45120.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           305]
 gi|147747792|gb|EDK54868.1| flagellar basal-body rod protein FlgG [Burkholderia mallei FMH]
 gi|147752774|gb|EDK59840.1| flagellar basal-body rod protein FlgG [Burkholderia mallei JHU]
 gi|148028948|gb|EDK86880.1| flagellar basal-body rod protein FlgG [Burkholderia mallei
           2002721280]
 gi|157806194|gb|EDO83364.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           406e]
 gi|160696155|gb|EDP86125.1| flagellar basal-body rod protein FlgG [Burkholderia mallei ATCC
           10399]
 gi|169653318|gb|EDS86011.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           S13]
 gi|184212676|gb|EDU09719.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1655]
 gi|217392035|gb|EEC32061.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           576]
 gi|225928167|gb|EEH24203.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504504|gb|ACQ96822.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           MSHR346]
 gi|238522491|gb|EEP85935.1| flagellar basal-body rod protein FlgG [Burkholderia mallei GB8
           horse 4]
 gi|242140937|gb|EES27339.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1106b]
 gi|243062740|gb|EES44926.1| flagellar basal-body rod protein FlgG [Burkholderia mallei PRL-20]
 gi|254219741|gb|EET09125.1| flagellar basal-body rod protein FlgG [Burkholderia pseudomallei
           1710a]
          Length = 262

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLQQTGNSKDVAINGQGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP+    + +   G +      +++   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPQNANSLTIGSDGVVSVTQPGSNNAVQIGALQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   +KQGY+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESSNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +T+M
Sbjct: 241 EINSKAVTTSDQMLQTVTQM 260


>gi|15801195|ref|NP_287212.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           EDL933]
 gi|15830710|ref|NP_309483.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           str. Sakai]
 gi|16129041|ref|NP_415596.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli str. K-12 substr. MG1655]
 gi|26247218|ref|NP_753258.1| flagellar basal body rod protein FlgG [Escherichia coli CFT073]
 gi|89107924|ref|AP_001704.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli str. K-12 substr. W3110]
 gi|91210230|ref|YP_540216.1| flagellar basal body rod protein FlgG [Escherichia coli UTI89]
 gi|110641254|ref|YP_668984.1| flagellar basal body rod protein FlgG [Escherichia coli 536]
 gi|110805095|ref|YP_688615.1| flagellar basal body rod protein FlgG [Shigella flexneri 5 str.
           8401]
 gi|117623264|ref|YP_852177.1| flagellar basal body rod protein FlgG [Escherichia coli APEC O1]
 gi|157156521|ref|YP_001462312.1| flagellar basal body rod protein FlgG [Escherichia coli E24377A]
 gi|168747146|ref|ZP_02772168.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4113]
 gi|168758629|ref|ZP_02783636.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4401]
 gi|168764490|ref|ZP_02789497.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4501]
 gi|168767737|ref|ZP_02792744.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4486]
 gi|168773923|ref|ZP_02798930.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4196]
 gi|168783608|ref|ZP_02808615.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4076]
 gi|168790013|ref|ZP_02815020.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC869]
 gi|168802023|ref|ZP_02827030.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC508]
 gi|170080729|ref|YP_001730049.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170679890|ref|YP_001744102.1| flagellar basal body rod protein FlgG [Escherichia coli SMS-3-5]
 gi|188492805|ref|ZP_03000075.1| flagellar basal-body rod protein FlgG [Escherichia coli 53638]
 gi|191168453|ref|ZP_03030241.1| flagellar basal-body rod protein FlgG [Escherichia coli B7A]
 gi|191172450|ref|ZP_03033991.1| flagellar basal-body rod protein FlgG [Escherichia coli F11]
 gi|193064556|ref|ZP_03045636.1| flagellar basal-body rod protein FlgG [Escherichia coli E22]
 gi|193069501|ref|ZP_03050455.1| flagellar basal-body rod protein FlgG [Escherichia coli E110019]
 gi|194438123|ref|ZP_03070216.1| flagellar basal-body rod protein FlgG [Escherichia coli 101-1]
 gi|195935468|ref|ZP_03080850.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           str. EC4024]
 gi|208806632|ref|ZP_03248969.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4206]
 gi|208815071|ref|ZP_03256250.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4045]
 gi|208822750|ref|ZP_03263069.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4042]
 gi|209399139|ref|YP_002269924.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4115]
 gi|209918332|ref|YP_002292416.1| flagellar basal body rod protein FlgG [Escherichia coli SE11]
 gi|215486287|ref|YP_002328718.1| flagellar basal body rod protein FlgG [Escherichia coli O127:H6
           str. E2348/69]
 gi|217328263|ref|ZP_03444345.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. TW14588]
 gi|218553656|ref|YP_002386569.1| flagellar basal body rod protein FlgG [Escherichia coli IAI1]
 gi|218557960|ref|YP_002390873.1| flagellar basal body rod protein FlgG [Escherichia coli S88]
 gi|218694612|ref|YP_002402279.1| flagellar basal body rod protein FlgG [Escherichia coli 55989]
 gi|218700419|ref|YP_002408048.1| flagellar basal body rod protein FlgG [Escherichia coli IAI39]
 gi|218704486|ref|YP_002412005.1| flagellar basal body rod protein FlgG [Escherichia coli UMN026]
 gi|227886564|ref|ZP_04004369.1| flagellar basal body rod protein FlgG [Escherichia coli 83972]
 gi|237706936|ref|ZP_04537417.1| flagellar basal-body rod protein flgG [Escherichia sp. 3_2_53FAA]
 gi|238900332|ref|YP_002926128.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli BW2952]
 gi|253773898|ref|YP_003036729.1| flagellar basal body rod protein FlgG [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161184|ref|YP_003044292.1| flagellar basal body rod protein FlgG [Escherichia coli B str.
           REL606]
 gi|254792460|ref|YP_003077297.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           str. TW14359]
 gi|256018665|ref|ZP_05432530.1| flagellar basal body rod protein FlgG [Shigella sp. D9]
 gi|256023224|ref|ZP_05437089.1| flagellar basal body rod protein FlgG [Escherichia sp. 4_1_40B]
 gi|260843318|ref|YP_003221096.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O103:H2 str. 12009]
 gi|260854561|ref|YP_003228452.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O26:H11 str. 11368]
 gi|260867441|ref|YP_003233843.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O111:H- str. 11128]
 gi|261227017|ref|ZP_05941298.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256251|ref|ZP_05948784.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291282098|ref|YP_003498916.1| Flagellar basal-body rod protein flgG [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404362|ref|ZP_06648356.1| flagellar basal-body rod protein flgG [Escherichia coli FVEC1412]
 gi|293409444|ref|ZP_06653020.1| flagellar basal-body rod protein FlgG [Escherichia coli B354]
 gi|293433368|ref|ZP_06661796.1| flagellar basal-body rod protein FlgG [Escherichia coli B088]
 gi|297516691|ref|ZP_06935077.1| flagellar basal body rod protein FlgG [Escherichia coli OP50]
 gi|298380142|ref|ZP_06989747.1| flagellar basal-body rod protein flgG [Escherichia coli FVEC1302]
 gi|300816780|ref|ZP_07097000.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 107-1]
 gi|300821141|ref|ZP_07101290.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 119-7]
 gi|300899597|ref|ZP_07117836.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 198-1]
 gi|300902469|ref|ZP_07120451.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 84-1]
 gi|300918680|ref|ZP_07135261.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 115-1]
 gi|300922604|ref|ZP_07138704.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 182-1]
 gi|300928370|ref|ZP_07143904.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 187-1]
 gi|300938643|ref|ZP_07153372.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 21-1]
 gi|300950173|ref|ZP_07164118.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 116-1]
 gi|300954382|ref|ZP_07166836.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 175-1]
 gi|300974382|ref|ZP_07172594.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 45-1]
 gi|300982619|ref|ZP_07176203.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 200-1]
 gi|301023265|ref|ZP_07187062.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 69-1]
 gi|301029707|ref|ZP_07192761.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 196-1]
 gi|301051138|ref|ZP_07197968.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 185-1]
 gi|301304983|ref|ZP_07211085.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 124-1]
 gi|301328552|ref|ZP_07221613.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 78-1]
 gi|301644990|ref|ZP_07244956.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 146-1]
 gi|306814073|ref|ZP_07448246.1| flagellar basal body rod protein FlgG [Escherichia coli NC101]
 gi|307137713|ref|ZP_07497069.1| flagellar basal body rod protein FlgG [Escherichia coli H736]
 gi|307310144|ref|ZP_07589794.1| flagellar basal-body rod protein FlgG [Escherichia coli W]
 gi|309798072|ref|ZP_07692447.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 145-7]
 gi|312968848|ref|ZP_07783055.1| flagellar basal-body rod protein FlgG [Escherichia coli 2362-75]
 gi|331641622|ref|ZP_08342757.1| flagellar basal-body rod protein FlgG [Escherichia coli H736]
 gi|331646336|ref|ZP_08347439.1| flagellar basal-body rod protein FlgG [Escherichia coli M605]
 gi|331657140|ref|ZP_08358102.1| flagellar basal-body rod protein FlgG [Escherichia coli TA206]
 gi|331662484|ref|ZP_08363407.1| flagellar basal-body rod protein FlgG [Escherichia coli TA143]
 gi|331667478|ref|ZP_08368342.1| flagellar basal-body rod protein FlgG [Escherichia coli TA271]
 gi|331672598|ref|ZP_08373387.1| flagellar basal-body rod protein FlgG [Escherichia coli TA280]
 gi|331676869|ref|ZP_08377565.1| flagellar basal-body rod protein FlgG [Escherichia coli H591]
 gi|331682580|ref|ZP_08383199.1| flagellar basal-body rod protein FlgG [Escherichia coli H299]
 gi|332279734|ref|ZP_08392147.1| flagellar basal-body rod protein FlgG [Shigella sp. D9]
 gi|78100014|sp|P0ABX7|FLGG_ECO57 RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|78100015|sp|P0ABX6|FLGG_ECOL6 RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|78100016|sp|P0ABX5|FLGG_ECOLI RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|12514619|gb|AAG55824.1|AE005318_1 flagellar biosynthesis, cell-distal portion of basal-body rod
           [Escherichia coli O157:H7 str. EDL933]
 gi|26107619|gb|AAN79818.1|AE016759_92 Flagellar basal-body rod protein flgG [Escherichia coli CFT073]
 gi|1787318|gb|AAC74162.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli str. K-12 substr. MG1655]
 gi|4062656|dbj|BAA35887.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli str. K12 substr. W3110]
 gi|13360920|dbj|BAB34879.1| flagellar basal body rod protein flgG [Escherichia coli O157:H7
           str. Sakai]
 gi|91071804|gb|ABE06685.1| flagellar basal body rod protein FlgG [Escherichia coli UTI89]
 gi|110342846|gb|ABG69083.1| flagellar basal-body rod protein FlgG [Escherichia coli 536]
 gi|110614643|gb|ABF03310.1| flagellar basal-body rod protein FlgG [Shigella flexneri 5 str.
           8401]
 gi|115512388|gb|ABJ00463.1| flagellar basal-body rod protein FlgG [Escherichia coli APEC O1]
 gi|157078551|gb|ABV18259.1| flagellar basal-body rod protein FlgG [Escherichia coli E24377A]
 gi|169888564|gb|ACB02271.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170517608|gb|ACB15786.1| flagellar basal-body rod protein FlgG [Escherichia coli SMS-3-5]
 gi|187770380|gb|EDU34224.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4196]
 gi|188018193|gb|EDU56315.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4113]
 gi|188488004|gb|EDU63107.1| flagellar basal-body rod protein FlgG [Escherichia coli 53638]
 gi|188999095|gb|EDU68081.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4076]
 gi|189354587|gb|EDU73006.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4401]
 gi|189363057|gb|EDU81476.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4486]
 gi|189365523|gb|EDU83939.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4501]
 gi|189370495|gb|EDU88911.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC869]
 gi|189375944|gb|EDU94360.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC508]
 gi|190901472|gb|EDV61233.1| flagellar basal-body rod protein FlgG [Escherichia coli B7A]
 gi|190907334|gb|EDV66932.1| flagellar basal-body rod protein FlgG [Escherichia coli F11]
 gi|192927808|gb|EDV82422.1| flagellar basal-body rod protein FlgG [Escherichia coli E22]
 gi|192957249|gb|EDV87698.1| flagellar basal-body rod protein FlgG [Escherichia coli E110019]
 gi|194423059|gb|EDX39053.1| flagellar basal-body rod protein FlgG [Escherichia coli 101-1]
 gi|208726433|gb|EDZ76034.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4206]
 gi|208731719|gb|EDZ80407.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4045]
 gi|208738235|gb|EDZ85918.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4042]
 gi|209160539|gb|ACI37972.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC4115]
 gi|209773358|gb|ACI84991.1| flagellar basal body rod protein flgG [Escherichia coli]
 gi|209773360|gb|ACI84992.1| flagellar basal body rod protein flgG [Escherichia coli]
 gi|209773362|gb|ACI84993.1| flagellar basal body rod protein flgG [Escherichia coli]
 gi|209773364|gb|ACI84994.1| flagellar basal body rod protein flgG [Escherichia coli]
 gi|209773366|gb|ACI84995.1| flagellar basal body rod protein flgG [Escherichia coli]
 gi|209911591|dbj|BAG76665.1| flagellar basal-body rod protein FlgG [Escherichia coli SE11]
 gi|215264359|emb|CAS08716.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217318690|gb|EEC27116.1| flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. TW14588]
 gi|218351344|emb|CAU97050.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli 55989]
 gi|218360424|emb|CAQ97978.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli IAI1]
 gi|218364729|emb|CAR02419.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli S88]
 gi|218370405|emb|CAR18212.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli IAI39]
 gi|218431583|emb|CAR12462.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli UMN026]
 gi|222032831|emb|CAP75570.1| flagellar basal-body rod protein flgG [Escherichia coli LF82]
 gi|226898146|gb|EEH84405.1| flagellar basal-body rod protein flgG [Escherichia sp. 3_2_53FAA]
 gi|227836768|gb|EEJ47234.1| flagellar basal body rod protein FlgG [Escherichia coli 83972]
 gi|238861100|gb|ACR63098.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli BW2952]
 gi|242376882|emb|CAQ31599.1| flagellar basal-body rod protein FlgG, subunit of Flagellar Motor
           Complex and Flagellum [Escherichia coli BL21(DE3)]
 gi|253324942|gb|ACT29544.1| flagellar basal-body rod protein FlgG [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973085|gb|ACT38756.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli B str. REL606]
 gi|253977299|gb|ACT42969.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli BL21(DE3)]
 gi|254591860|gb|ACT71221.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli O157:H7 str. TW14359]
 gi|257753210|dbj|BAI24712.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O26:H11 str. 11368]
 gi|257758465|dbj|BAI29962.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O103:H2 str. 12009]
 gi|257763797|dbj|BAI35292.1| flagellar component FlgG of cell-distal portion of basal-body rod
           [Escherichia coli O111:H- str. 11128]
 gi|260449782|gb|ACX40204.1| flagellar basal-body rod protein FlgG [Escherichia coli DH1]
 gi|281178187|dbj|BAI54517.1| flagellar basal-body rod protein FlgG [Escherichia coli SE15]
 gi|284920901|emb|CBG33964.1| flagellar basal-body rod protein FlgG [Escherichia coli 042]
 gi|290761971|gb|ADD55932.1| Flagellar basal-body rod protein flgG [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324187|gb|EFE63609.1| flagellar basal-body rod protein FlgG [Escherichia coli B088]
 gi|291428948|gb|EFF01973.1| flagellar basal-body rod protein flgG [Escherichia coli FVEC1412]
 gi|291469912|gb|EFF12396.1| flagellar basal-body rod protein FlgG [Escherichia coli B354]
 gi|294490415|gb|ADE89171.1| flagellar basal-body rod protein FlgG [Escherichia coli IHE3034]
 gi|298279840|gb|EFI21348.1| flagellar basal-body rod protein flgG [Escherichia coli FVEC1302]
 gi|299877395|gb|EFI85606.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 196-1]
 gi|300297159|gb|EFJ53544.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 185-1]
 gi|300307084|gb|EFJ61604.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 200-1]
 gi|300318618|gb|EFJ68402.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 175-1]
 gi|300356868|gb|EFJ72738.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 198-1]
 gi|300397110|gb|EFJ80648.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 69-1]
 gi|300405501|gb|EFJ89039.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 84-1]
 gi|300410625|gb|EFJ94163.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 45-1]
 gi|300414174|gb|EFJ97484.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 115-1]
 gi|300421081|gb|EFK04392.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 182-1]
 gi|300450520|gb|EFK14140.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 116-1]
 gi|300456428|gb|EFK19921.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 21-1]
 gi|300463628|gb|EFK27121.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 187-1]
 gi|300526440|gb|EFK47509.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 119-7]
 gi|300530554|gb|EFK51616.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 107-1]
 gi|300839701|gb|EFK67461.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 124-1]
 gi|300844944|gb|EFK72704.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 78-1]
 gi|301076719|gb|EFK91525.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 146-1]
 gi|305852710|gb|EFM53158.1| flagellar basal body rod protein FlgG [Escherichia coli NC101]
 gi|306909862|gb|EFN40356.1| flagellar basal-body rod protein FlgG [Escherichia coli W]
 gi|307553080|gb|ADN45855.1| flagellar basal-body rod protein FlgG [Escherichia coli ABU 83972]
 gi|308118355|gb|EFO55617.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 145-7]
 gi|309701350|emb|CBJ00651.1| flagellar basal-body rod protein FlgG [Escherichia coli ETEC
           H10407]
 gi|312286250|gb|EFR14163.1| flagellar basal-body rod protein FlgG [Escherichia coli 2362-75]
 gi|312945640|gb|ADR26467.1| flagellar basal body rod protein FlgG [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315060356|gb|ADT74683.1| flagellar component of cell-distal portion of basal-body rod
           [Escherichia coli W]
 gi|315135710|dbj|BAJ42869.1| flagellar basal-body rod protein flgG [Escherichia coli DH1]
 gi|315253879|gb|EFU33847.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 85-1]
 gi|315287367|gb|EFU46778.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 110-3]
 gi|315291072|gb|EFU50435.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 153-1]
 gi|315296709|gb|EFU56004.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 16-3]
 gi|315618248|gb|EFU98838.1| flagellar basal-body rod protein FlgG [Escherichia coli 3431]
 gi|320189761|gb|EFW64417.1| Flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. EC1212]
 gi|320196440|gb|EFW71063.1| Flagellar basal-body rod protein FlgG [Escherichia coli WV_060327]
 gi|320200974|gb|EFW75558.1| Flagellar basal-body rod protein FlgG [Escherichia coli EC4100B]
 gi|320637529|gb|EFX07329.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           str. G5101]
 gi|320643090|gb|EFX12291.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H-
           str. 493-89]
 gi|320648548|gb|EFX17203.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H-
           str. H 2687]
 gi|320653862|gb|EFX21936.1| flagellar basal body rod protein FlgG [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659342|gb|EFX26911.1| flagellar basal body rod protein FlgG [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664477|gb|EFX31628.1| flagellar basal body rod protein FlgG [Escherichia coli O157:H7
           str. LSU-61]
 gi|323156885|gb|EFZ43019.1| flagellar basal-body rod protein FlgG [Escherichia coli EPECa14]
 gi|323163703|gb|EFZ49523.1| flagellar basal-body rod protein FlgG [Escherichia coli E128010]
 gi|323175691|gb|EFZ61285.1| flagellar basal-body rod protein FlgG [Escherichia coli 1180]
 gi|323185799|gb|EFZ71160.1| flagellar basal-body rod protein FlgG [Escherichia coli 1357]
 gi|323190590|gb|EFZ75862.1| flagellar basal-body rod protein FlgG [Escherichia coli RN587/1]
 gi|323379083|gb|ADX51351.1| flagellar basal-body rod protein FlgG [Escherichia coli KO11]
 gi|323937818|gb|EGB34082.1| flagellar basal-body rod protein FlgG [Escherichia coli E1520]
 gi|323942547|gb|EGB38714.1| flagellar basal-body rod protein FlgG [Escherichia coli E482]
 gi|323947620|gb|EGB43624.1| flagellar basal-body rod protein FlgG [Escherichia coli H120]
 gi|323953236|gb|EGB49102.1| flagellar basal-body rod protein FlgG [Escherichia coli H252]
 gi|323957902|gb|EGB53614.1| flagellar basal-body rod protein FlgG [Escherichia coli H263]
 gi|323962677|gb|EGB58255.1| flagellar basal-body rod protein FlgG [Escherichia coli H489]
 gi|323967019|gb|EGB62445.1| flagellar basal-body rod protein FlgG [Escherichia coli M863]
 gi|323973333|gb|EGB68522.1| flagellar basal-body rod protein FlgG [Escherichia coli TA007]
 gi|323976549|gb|EGB71637.1| flagellar basal-body rod protein FlgG [Escherichia coli TW10509]
 gi|324007918|gb|EGB77137.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 57-2]
 gi|324013352|gb|EGB82571.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 60-1]
 gi|324017418|gb|EGB86637.1| flagellar basal-body rod protein FlgG [Escherichia coli MS 117-3]
 gi|324117351|gb|EGC11258.1| flagellar basal-body rod protein FlgG [Escherichia coli E1167]
 gi|326339300|gb|EGD63114.1| Flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. 1125]
 gi|326344739|gb|EGD68487.1| Flagellar basal-body rod protein FlgG [Escherichia coli O157:H7
           str. 1044]
 gi|327253477|gb|EGE65115.1| flagellar basal-body rod protein FlgG [Escherichia coli STEC_7v]
 gi|330910892|gb|EGH39402.1| flagellar basal-body rod protein FlgG [Escherichia coli AA86]
 gi|331038420|gb|EGI10640.1| flagellar basal-body rod protein FlgG [Escherichia coli H736]
 gi|331045088|gb|EGI17215.1| flagellar basal-body rod protein FlgG [Escherichia coli M605]
 gi|331055388|gb|EGI27397.1| flagellar basal-body rod protein FlgG [Escherichia coli TA206]
 gi|331060906|gb|EGI32870.1| flagellar basal-body rod protein FlgG [Escherichia coli TA143]
 gi|331065063|gb|EGI36958.1| flagellar basal-body rod protein FlgG [Escherichia coli TA271]
 gi|331070241|gb|EGI41607.1| flagellar basal-body rod protein FlgG [Escherichia coli TA280]
 gi|331075558|gb|EGI46856.1| flagellar basal-body rod protein FlgG [Escherichia coli H591]
 gi|331080211|gb|EGI51390.1| flagellar basal-body rod protein FlgG [Escherichia coli H299]
 gi|332102086|gb|EGJ05432.1| flagellar basal-body rod protein FlgG [Shigella sp. D9]
 gi|333004888|gb|EGK24408.1| flagellar basal-body rod protein FlgG [Shigella flexneri VA-6]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|259908810|ref|YP_002649166.1| Flagellar basal-body rod protein [Erwinia pyrifoliae Ep1/96]
 gi|224964432|emb|CAX55941.1| Flagellar basal-body rod protein [Erwinia pyrifoliae Ep1/96]
 gi|283478792|emb|CAY74708.1| Flagellar basal-body rod protein flgG [Erwinia pyrifoliae DSM
           12163]
 gi|310767292|gb|ADP12242.1| Flagellar basal-body rod protein [Erwinia sp. Ejp617]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+  QQTN+++IANN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDGQQTNMDVIANNLANVSTNGFKRQRAVFEDLMYQTLRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +  +   ++ QG +  T ++ D+A+ G+G+F V+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGTRPVATERLHNQGNLSQTDSSKDVAINGQGFFSVQLPDGTAAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT+ G  + P IVIP  +  + +SR G +       ++   VGQL ++ F+
Sbjct: 120 FQTDQNGQLVTSAGFPVQPAIVIPANSLSMTISRDGVVSVTQQGQANPVQVGQLTLSTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  SNP + G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLSSMGENLYQETQASGAPNESNPGNNGAGTLYQGYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + +T++
Sbjct: 240 YEINSKAISTSDQMLAKLTQI 260


>gi|209963565|ref|YP_002296480.1| flagellar basal-body rod protein FlgG [Rhodospirillum centenum SW]
 gi|209957031|gb|ACI97667.1| flagellar basal-body rod protein FlgG [Rhodospirillum centenum SW]
          Length = 261

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 184/262 (70%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+   IAA GM AQQ N+E+I+NNIAN+NT G+KR+RAEF D +YQA+   GS S S   
Sbjct: 1   MRTLNIAATGMMAQQLNVEVISNNIANLNTVGFKRSRAEFQDLMYQAQVRPGSES-SDQD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP GI +G GV+ ++V  ++ QG +  T N+ D+AL GRG+F +  P+    YTRAG+
Sbjct: 60  TIVPAGIQLGLGVKPAAVSRMHGQGPLTPTENDYDVALDGRGYFVITLPNGDTAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G +VT DG T+ P I +P+ TR++ ++R+G++LA     ++ + VGQ  +A F+
Sbjct: 120 FQLSPEGTIVTVDGYTVSPNITVPDNTRKVAINRNGEVLAFIDGQTEPENVGQFEVATFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +GDNL   T  SG PI+  P  +G+  ++QGY+EA+NV+ V+EI+ +ISAQRA
Sbjct: 180 NEAGLEAMGDNLFRETPASGIPILGIPGQLGYGGIRQGYVEAANVNIVQEITSLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNS+V+EA D+M + +T+MR
Sbjct: 240 YEMNSRVVEAGDQMLNTVTQMR 261


>gi|189426330|ref|YP_001953507.1| flagellar basal body rod protein FlgG [Geobacter lovleyi SZ]
 gi|189422589|gb|ACD96987.1| flagellar basal-body rod protein FlgG [Geobacter lovleyi SZ]
          Length = 262

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA+GM+ Q  N+ +IANN+AN+NTTG+K++RA+F D +YQ  +  GSPS +A  
Sbjct: 2   MRSLWTAASGMNTQTQNINVIANNLANVNTTGFKKSRADFQDLMYQTVQNPGSPSTNA-- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A +P GI  G G ++++V   +T G+  +TG  LD+A+ G G+FQ++ PD +  Y+RAG+
Sbjct: 60  AQIPVGIQFGMGSKLAAVSKQFTPGDFSNTGGQLDMAIEGDGFFQIQMPDGSTAYSRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS G++VT +G  ++P IVIP  + +I +   G + AV    S    VG + IANF 
Sbjct: 120 FKMDSNGRVVTPEGYPMLPEIVIPNNSTKITIGTDGTVSAVQSGQSTASTVGNIQIANFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G N   +T  SG+     P   G   + QG+LE SNVD   E+  MI  QRA
Sbjct: 180 NPAGLSSMGKNFYQQTDASGNATTGTPGQTGLGTITQGFLEMSNVDVATEMVNMIIGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +DEM  L   ++
Sbjct: 240 YEANSKAITTSDEMLQLANNLK 261


>gi|167585196|ref|ZP_02377584.1| flagellar basal-body rod protein FlgG [Burkholderia ubonensis Bu]
          Length = 262

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T GYK +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGYKGSRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ DLA+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLQQTGNSKDLAIDGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+    + + + G +      +++   +G + IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVLPAITVPQNATALTIGKDGVVSVKQAGSNNAVQIGSIQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVSQPGLNGAGSLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQNVTQMK 261


>gi|332342624|gb|AEE55958.1| flagellar basal-body rod protein FlgG [Escherichia coli UMNK88]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVTTERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|26991074|ref|NP_746499.1| flagellar basal body rod protein FlgG [Pseudomonas putida KT2440]
 gi|24986108|gb|AAN69963.1|AE016634_12 flagellar basal-body rod protein FlgG [Pseudomonas putida KT2440]
          Length = 261

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 166/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEFAD LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFADLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +  G +  T N LD+A+ GRG+FQ+  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKSFVAGSLQTTDNPLDMAVNGRGFFQILQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VT +G  L P IV+P + +   V + G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LNSDGQIVTDNGYALEPAIVVPNDAQTFTVGQDGTVSITTAGNPAAQVIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IGDNL   T+ SG P +  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGDNLFLETAASGAPQVGTPGLNGFGTTLQQTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|292489131|ref|YP_003532018.1| flagellar basal-body rod protein FlgG [Erwinia amylovora CFBP1430]
 gi|292900250|ref|YP_003539619.1| flagellar basal-body rod protein [Erwinia amylovora ATCC 49946]
 gi|291200098|emb|CBJ47224.1| flagellar basal-body rod protein [Erwinia amylovora ATCC 49946]
 gi|291554565|emb|CBA22177.1| Flagellar basal-body rod protein flgG [Erwinia amylovora CFBP1430]
 gi|312173289|emb|CBX81544.1| Flagellar basal-body rod protein flgG [Erwinia amylovora ATCC
           BAA-2158]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++I+NN+AN+ +TG+KR RA F D LYQ  +  G  +Q++++
Sbjct: 2   IRSLWIAKTGLEAQQTNMDVISNNLANVGSTGFKRQRAVFQDLLYQTMRQPG--AQASEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV   + + ++TQG +  TG + D+A+ G+G+FQV+ PD T  YTR GS
Sbjct: 60  TTLPTGMQLGTGVATVATQRMHTQGSLTQTGRDYDMAIQGKGFFQVQLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+++  GQ+VTA+GN + P I +P + +++ V   G + A     +  Q +GQL +ANFI
Sbjct: 120 FSLNENGQMVTAEGNPVQPDITVPADAQKLTVGEDGIVTATVPGQAAPQQIGQLTLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G NL A T  SG P  + P   G   +K  Y+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESLGGNLYAETQASGAPNEATPGMDGAGRLKHQYIETSNVNVAEELVTMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   + ++
Sbjct: 240 YEINSKAVSASDQMLQRLAQL 260


>gi|94263287|ref|ZP_01287103.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|94267694|ref|ZP_01290963.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93451896|gb|EAT02627.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456370|gb|EAT06494.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 97/262 (37%), Positives = 150/262 (57%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A      GM  QQ  L+ I+NN+AN+NT G+K++R +F D  YQ  +  G  +   D 
Sbjct: 2   IRALYSGTTGMRGQQLQLDTISNNLANVNTAGFKKSRTQFEDLYYQELRAVGVENI--DG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ +G GV+ ++ + ++TQG +  TG++LD+A+ G+G+FQV   D    YTRAG+
Sbjct: 60  GQVPSGMQVGLGVKATANQKIFTQGSIHETGSDLDIAIEGKGFFQVL-KDGEEFYTRAGN 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G +VT +G+ L P   IP ET  + +   G I A      +     QL + +FI
Sbjct: 119 FTRDADGFIVTQNGDRLQPEFQIPPETVSLHIGADGLIQAKDAAQ-EIIAEDQLTLFDFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GLR  G NL   T  SGDP  ++P   G   + Q + E SNV+  +E+  +I  QRA
Sbjct: 178 NPGGLRAEGGNLFRATEASGDPREADPGTEGVGVLLQRFNEVSNVEVTEELVNLIITQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           +EMNSK ++ AD++  +   ++
Sbjct: 238 FEMNSKSVQTADQLLEVANTLK 259


>gi|320173530|gb|EFW48726.1| Flagellar basal-body rod protein FlgG [Shigella dysenteriae CDC
           74-1112]
          Length = 260

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 160/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD + +YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSVYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|111115606|ref|YP_710224.1| flagellar basal body rod protein FlgG [Borrelia afzelii PKo]
 gi|110890880|gb|ABH02048.1| flagellar basal-body rod protein [Borrelia afzelii PKo]
          Length = 265

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 105/264 (39%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE       +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIRNSITISEQGIVSVKIDNSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEIAGIPGSKGMGKLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|288940411|ref|YP_003442651.1| flagellar basal-body rod protein FlgG [Allochromatium vinosum DSM
           180]
 gi|288895783|gb|ADC61619.1| flagellar basal-body rod protein FlgG [Allochromatium vinosum DSM
           180]
          Length = 263

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 162/259 (62%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  IA  G+ AQQT + +++NN+AN+NTTG+K+ RA F D +Y + +  G  +Q+  + 
Sbjct: 3   QALWIAKTGLDAQQTRMSVVSNNLANVNTTGFKKGRAVFEDLIYHSCRQHG--AQATQET 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G++IG+GV+  + + ++ QG  + TGN+LD+A+ G+G+FQ+  P   + YTR GSF
Sbjct: 61  QLPSGLTIGTGVRTVATQKLFAQGNYIQTGNSLDMAIEGQGFFQILMPGGEIGYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +++ G++V ++G  L P +VIP +   I + + G +            +GQ+ +ANFIN
Sbjct: 121 QLNADGEVVMSNGYALQPALVIPADAESITIGKDGTVSIKQPNQVGEVQIGQIQLANFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG+NL   T+ SG P  SNP + GF  + Q  LE SNV+  +E+  MI  QRAY
Sbjct: 181 PAGLQPIGENLFRETTASGAPQQSNPGENGFGSLVQCSLETSNVNMAEELVNMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           E+NSK I AAD M   +  
Sbjct: 241 EVNSKAISAADSMLQFVNN 259


>gi|167568109|ref|ZP_02361025.1| flagellar basal body rod protein FlgG [Burkholderia oklahomensis
           EO147]
 gi|167574227|ref|ZP_02367101.1| flagellar basal body rod protein FlgG [Burkholderia oklahomensis
           C6786]
          Length = 262

 Score =  229 bits (583), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 167/260 (64%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ+ +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQSQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGALQQTGNSKDVAINGQGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP+    + +   G +      +++   +G L +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPQNATSLTIGSDGVVSVTQPGSNNAVQIGALQVATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   +KQGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETTSSGQPNVSQPGLNGAGTLKQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +T+M
Sbjct: 241 EINSKAVTTSDQMLQTVTQM 260


>gi|288958675|ref|YP_003449016.1| flagellar basal-body rod protein [Azospirillum sp. B510]
 gi|288910983|dbj|BAI72472.1| flagellar basal-body rod protein [Azospirillum sp. B510]
          Length = 261

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 167/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  I A GM AQQ N+E I+NNIAN  TTGYK+ RAEF D LYQ  +  GS + S   
Sbjct: 1   MRSLAIGATGMIAQQLNVETISNNIANSTTTGYKKQRAEFQDLLYQNFRRIGS-TSSDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP G+ +G+GV++++V  V  QG +  T N LD+A+ G G+FQ+  P     YTRAG+
Sbjct: 60  TVVPTGVQVGAGVRVAAVARVLEQGNLNITDNKLDVAINGSGYFQITLPSGDTSYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G +VTADG T+ P I IP    +I ++ SG++L      +  Q VGQ+ +A F 
Sbjct: 120 FKLSPQGVIVTADGYTVQPNITIPTNAVDISINSSGEVLVKLDGQTATQNVGQIQLATFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   GDNL   T+ SG P+  NP   GF  V QG LE SNV+ V+EI+ +I+AQRA
Sbjct: 180 NAAGLEATGDNLFMETAASGQPVTGNPGAPGFGRVTQGALETSNVNVVQEITTLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+  DEM    ++MR
Sbjct: 240 YEMNSKVIKTTDEMMQQASQMR 261


>gi|153952075|ref|YP_001398357.1| flagellar basal body rod protein FlgG [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939521|gb|ABS44262.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 263

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 101/263 (38%), Positives = 162/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ  +++ +NNIAN+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQMQIDVTSNNIANVNTAGFKKSRAEFADLMYQVMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 60  TLSPSGIEVGVGVRPTAVTKVFTKGNLKSTSTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 120 QFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 240 AYEAGSKAITTSDDMLGIVNQLK 262


>gi|330808197|ref|YP_004352659.1| flagellar basal-body rod protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376305|gb|AEA67655.1| flagellar basal-body rod protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 261

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 117/258 (45%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL  I+NN+AN++TTG+KR RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTTISNNLANVSTTGFKRDRAEFQDLLYQVKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T   LD+A+ GRG+FQ+  PD T  YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKNFTAGSLQTTEQPLDMAIDGRGFFQILQPDGTTSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +DS GQ+V A G  L P I+IP + +   V R G +      N   Q +G L  A+FIN 
Sbjct: 122 LDSNGQIVNASGFALEPAIIIPNDAQTFTVGRDGTVSITVAGNPASQVIGNLQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G+NL   T+ SG P +  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAVGNNLFLETAASGAPQVGTPGLNGFGTTLQNTLETSNVSTVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|83721615|ref|YP_440803.1| flagellar basal body rod protein FlgG [Burkholderia thailandensis
           E264]
 gi|167579490|ref|ZP_02372364.1| flagellar basal body rod protein FlgG [Burkholderia thailandensis
           TXDOH]
 gi|167617587|ref|ZP_02386218.1| flagellar basal body rod protein FlgG [Burkholderia thailandensis
           Bt4]
 gi|257140546|ref|ZP_05588808.1| flagellar basal body rod protein FlgG [Burkholderia thailandensis
           E264]
 gi|83655440|gb|ABC39503.1| flagellar basal-body rod protein FlgG [Burkholderia thailandensis
           E264]
          Length = 262

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 111/260 (42%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLTQTGNSKDVAINGQGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP+    + +   G +      +++   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPQNATSLTIGSDGVVSVTQPGSNNAVQIGALQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   +KQGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDARGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +T+M
Sbjct: 241 EINSKAVTTSDQMLQTVTQM 260


>gi|296135671|ref|YP_003642913.1| flagellar basal-body rod protein FlgG [Thiomonas intermedia K12]
 gi|295795793|gb|ADG30583.1| flagellar basal-body rod protein FlgG [Thiomonas intermedia K12]
          Length = 261

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  +A  G+ A+QT +++IANN+AN+NT+G+K +RA F D LYQ     G  +QS+  
Sbjct: 2   IRSLYVAKTGLEAEQTRMDVIANNLANVNTSGFKGSRAVFQDLLYQNLTQPG--AQSSQS 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ +G+GV+  S   + TQG +  TGN+LD+A+ G+G+FQV  P+ T+ YTR G+
Sbjct: 60  TQYPSGLQLGTGVRPVSTERLMTQGNLTQTGNSLDVAINGQGFFQVLEPNGTIAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++++GQLVTA+G  + P + IP   + + +   G +       +  Q VG L +A+F+
Sbjct: 120 FQLNNQGQLVTANGYLVQPTVTIPASAQSVTIGNDGTVSVTLPGQAAPQQVGALQLASFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL++IGDNL  +T  SG P    P   G   V+QGYLE+SNV+ V E+ +MIS QRA
Sbjct: 180 NPTGLQSIGDNLYLQTGSSGAPNTGQPTLNGLGSVQQGYLESSNVNVVAELVDMISTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YE+NSK + A+D+M   +  
Sbjct: 240 YEVNSKAVTASDQMLQYVNN 259


>gi|157160605|ref|YP_001457923.1| flagellar basal body rod protein FlgG [Escherichia coli HS]
 gi|170020526|ref|YP_001725480.1| flagellar basal body rod protein FlgG [Escherichia coli ATCC 8739]
 gi|312971215|ref|ZP_07785393.1| flagellar basal-body rod protein FlgG [Escherichia coli 1827-70]
 gi|157066285|gb|ABV05540.1| flagellar basal-body rod protein FlgG [Escherichia coli HS]
 gi|169755454|gb|ACA78153.1| flagellar basal-body rod protein FlgG [Escherichia coli ATCC 8739]
 gi|310336417|gb|EFQ01603.1| flagellar basal-body rod protein FlgG [Escherichia coli 1827-70]
          Length = 260

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T GYKR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGYKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|312148533|gb|ADQ31192.1| flagellar basal-body rod protein FlgG [Borrelia burgdorferi JD1]
          Length = 265

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 106/264 (40%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ    AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTHNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT  G  ++P I+ PEE  +    +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTNQGYKVLPNILFPEEYIQNSITISEEGIVSVKIDTSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           FIN AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FINPAGLSAIGSNLFKETAGSGQEIAGIPGSEGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|332800000|ref|YP_004461499.1| flagellar basal-body rod protein FlgG [Tepidanaerobacter sp. Re1]
 gi|332697735|gb|AEE92192.1| flagellar basal-body rod protein FlgG [Tepidanaerobacter sp. Re1]
          Length = 270

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 107/270 (39%), Positives = 159/270 (58%), Gaps = 10/270 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A++GM AQQ N++I +NN+AN+NT G+K++RAEF D LY+  +   SP      
Sbjct: 2   MRALWSASSGMQAQQLNMDITSNNLANVNTAGFKKSRAEFKDLLYETLQRPDSPEL-LSG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A VP GI +G GV+ S+    + +G +  TGN  D+A+ G G+F VE PD  + +TR GS
Sbjct: 61  AAVPVGIQVGHGVRPSATGRDFNEGNLQPTGNTFDVAIEGTGFFMVERPDGNLAFTRDGS 120

Query: 121 FNIDSKG---QLVTADGNTL----VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQ 173
           F +   G    LVT++G  +       I IPEE  +I +S  G I       +  + +GQ
Sbjct: 121 FKVSLDGTDRNLVTSEGYYVLSGDESYITIPEEYTDISISSDGLITGQDEDGT-IEELGQ 179

Query: 174 LLIANFINEAGLRNIGDNLLARTSVSGDPIIS-NPDDIGFAHVKQGYLEASNVDAVKEIS 232
           + I  F+N  GL  IG+NL   T  SG+ +   +  D G+  + QG+LE SNV  V+E+ 
Sbjct: 180 IGIVKFLNPQGLLAIGNNLFEATEASGEYVPMEDVSDPGYGTLLQGFLEMSNVQVVEEMV 239

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
            +I AQRAYE+N+K ++A+DEM +    +R
Sbjct: 240 NLIIAQRAYEVNTKAVQASDEMLAQANNLR 269


>gi|205353083|ref|YP_002226884.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205272864|emb|CAR37793.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326628163|gb|EGE34506.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 260

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+N K +   D+M   +T++
Sbjct: 240 YEINCKAVSTTDQMLQKLTQL 260


>gi|297183134|gb|ADI19277.1| flagellar basal body rod protein [uncultured delta proteobacterium
           HF0200_39L23]
          Length = 262

 Score =  228 bits (582), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 112/261 (42%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N++  ANN+AN+NT+GYK+++  F D LY  E+ AG PS  +  
Sbjct: 2   MRALYTAATGMAAQQRNIDTTANNLANVNTSGYKKSKVHFQDLLYHNERTAGVPSSVS-- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ +G GV+      ++TQG + +TGN+LD+++ G G+FQ+  P+  V Y+R G 
Sbjct: 60  TQVPVGLHVGHGVKFIGTEKIHTQGNLENTGNDLDISIDGHGFFQILQPNGIVGYSRDGH 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FNID  G+LVT DG  L P I IP++TR+I+V   G +       +  + +G + +A F 
Sbjct: 120 FNIDGMGRLVTNDGMLLDPEINIPQDTRKIEVGFDGTVTVFLRDETMPEAIGSVQLARFQ 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   T  SG+ I+  P       + QG+LE SNV  V+E+  MI++QRA
Sbjct: 180 NPAGLTPIGKNLYVSTPASGNAIVDAPGANSMGSLTQGFLERSNVSLVEEMVNMITSQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I++ADEM      +
Sbjct: 240 YEVNSKAIQSADEMLKNTNNL 260


>gi|209964690|ref|YP_002297605.1| flagellar basal body rod protein FlgG [Rhodospirillum centenum SW]
 gi|209958156|gb|ACI98792.1| flagellar basal-body rod protein FlgG [Rhodospirillum centenum SW]
          Length = 261

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 129/262 (49%), Positives = 175/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  I A GM AQQ N+E+I+NNIAN+ TTG+KR RAEF D LYQ  +  GS + S   
Sbjct: 1   MRSLSIGATGMLAQQLNVEVISNNIANMTTTGFKRQRAEFQDLLYQNMRRVGS-TSSDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP G+ IG+GV+ ++V  +  QG +  TGN LDLA+ G+G+FQVE PD    YTRAGS
Sbjct: 60  TVVPSGVQIGAGVKTAAVYRINEQGNISVTGNALDLAINGQGYFQVELPDGQTAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++++G +VTADG  L PG+V+PE   +I V+ +G++L      +    +GQ+ +A F 
Sbjct: 120 FQLNAEGTIVTADGYQLQPGLVVPENAVDITVNPNGEVLVKLDGQTQPANIGQIQLATFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IGDNLL  +  SG+ I  NP   GF  V Q  LE SNV+ V EI+ +I+AQRA
Sbjct: 180 NPAGLEAIGDNLLLESPASGNIIAGNPGAPGFGRVIQQALETSNVNIVSEITNLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNS+VI  +D+M   I++MR
Sbjct: 240 YEMNSRVISTSDQMMQSISQMR 261


>gi|149375032|ref|ZP_01892805.1| Flagellar basal body rod protein [Marinobacter algicola DG893]
 gi|149360921|gb|EDM49372.1| Flagellar basal body rod protein [Marinobacter algicola DG893]
          Length = 262

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 108/258 (41%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ TN+  I+NN+AN+NTTG+KR RA F D LYQ ++  G    +   + 
Sbjct: 4   ALWVSKTGLSAQDTNMSTISNNLANVNTTGFKRDRAVFQDLLYQIDRQPG--GLNTQNSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I      ++QG +  T   LD+A+ GRG+ Q+  PD  + YTR G F 
Sbjct: 62  LPSGLQLGTGVRIVGTAKQFSQGNLEVTEQPLDMAVNGRGFMQILLPDGQIAYTRDGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S G +V  DG TL P I +PE    I + + G + AVT   +    +G++ + +FIN 
Sbjct: 122 LNSNGDIVNPDGYTLEPNINVPENATNITIGKDGTVSAVTDDQAAPVNLGEITLVDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG+NL   T+ SGDP    P   G   ++QG +EASNV+ V+E+  MI+ QRAYE
Sbjct: 182 QGLQAIGNNLFKATNASGDPAEGEPGIGGLGTLEQGMVEASNVEVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+ A D+M   IT 
Sbjct: 242 MNSKVVSATDQMLQFITN 259


>gi|157363239|ref|YP_001470006.1| flagellar basal-body rod protein FlgG [Thermotoga lettingae TMO]
 gi|157313843|gb|ABV32942.1| flagellar basal-body rod protein FlgG [Thermotoga lettingae TMO]
          Length = 261

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 170/262 (64%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M +   AA GM AQQ  L+ I+NN+AN++TTGYK+ RAEF D +YQ  K AG+P+     
Sbjct: 2   MVSLYSAATGMWAQQYKLDTISNNLANVDTTGYKKVRAEFQDLVYQYYKNAGTPTAVNS- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI  G G ++S+   +++ G + +TGN LD+A+ G G+FQV+  D    YTR G+
Sbjct: 61  -TIPTGIYFGHGTRLSATTKIFSLGNMEYTGNALDVAITGDGFFQVQLQDGRTAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G++VT++G  L+P IV+P +   I +S  G   A     +  Q +G + +  F+
Sbjct: 120 FKVDSEGRVVTSNGLALIPNIVVPADAVAINISPDGIFSAEMQDGT-VQNLGTITLVRFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL+ +GDNL   T+ SG+PI   P+  GF  ++QGYLE +NVD VKE+ +MI+AQRA
Sbjct: 179 NPSGLKAVGDNLYLETTASGEPIEGTPNQDGFGALQQGYLEKANVDVVKEMVDMITAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N++ I+ AD M   ++ ++
Sbjct: 239 YELNARAIQTADNMLQTVSTLK 260


>gi|38570330|gb|AAR24613.1| flagellar basal-body rod protein [Campylobacter jejuni subsp.
           jejuni]
          Length = 263

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 102/263 (38%), Positives = 162/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K +RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKESRAEFADLMYQVMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 60  TLSPSGIEVGVGVRPTAVTKVFTEGNLKSTSTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 120 QFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 240 AYEAGSKAITTSDDMLGIVNQLK 262


>gi|313497764|gb|ADR59130.1| FlgG [Pseudomonas putida BIRD-1]
          Length = 261

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 167/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEFAD LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFADLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +  G +  T N LD+A+ GRG+FQV  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKSFVAGSLQTTENPLDMAVNGRGFFQVLQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VTA+G  L P IV+P + +   V + G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LNSDGQIVTANGYALEPAIVVPNDAQTFTVGQDGTVSITTAGNPAAQVIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IGDNL   T+ SG P +  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGDNLFLETAASGAPQVGTPGLNGFGTTLQQTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|315497881|ref|YP_004086685.1| flagellar basal-body rod protein flgg [Asticcacaulis excentricus CB
           48]
 gi|315415893|gb|ADU12534.1| flagellar basal-body rod protein FlgG [Asticcacaulis excentricus CB
           48]
          Length = 262

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 127/262 (48%), Positives = 172/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GMSAQQ N++ I++NIAN+NT G+K+ RAEF D LYQ  +  G+ S S   
Sbjct: 1   MRALRTATTGMSAQQLNVDTISHNIANMNTVGFKKQRAEFQDLLYQNVERMGAQS-SESG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP GI +G GV+  SV  + TQG    T N  D+ + GRG+FQV  P     YTRAG+
Sbjct: 60  TVVPTGIQVGGGVKTGSVYRILTQGSATRTDNPYDIMVDGRGYFQVLMPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++ +GQLVT DG  + P I  P++T+E+ +S++GQ+       +    +GQL +A+F 
Sbjct: 120 FAVNDQGQLVTDDGYLVQPQITFPQDTKEVTISKTGQVSVTQDGVTAPTVIGQLQVASFF 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNL  ++  SG P I  P D+G+  + QGY EASNVDAV EI+ +I AQRA
Sbjct: 180 NEAGLEAIGDNLYLQSGASGAPNIGTPGDVGYGTLMQGYTEASNVDAVSEITSLIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK+I+ ADEM S+ + +R
Sbjct: 240 YEMNSKIIKTADEMLSVTSSLR 261


>gi|163744349|ref|ZP_02151709.1| flagellar basal-body rod protein FlgG [Oceanibulbus indolifex
           HEL-45]
 gi|161381167|gb|EDQ05576.1| flagellar basal-body rod protein FlgG [Oceanibulbus indolifex
           HEL-45]
          Length = 261

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 118/262 (45%), Positives = 173/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQQTN+++I+NNIAN NTTG+K +RA F D +YQ+ +  G+ + S   
Sbjct: 1   MKALSIAATGMMAQQTNVDVISNNIANANTTGFKASRAAFQDLIYQSMQREGALT-SEAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +  P GI IG GVQ +    + TQG +V T N L++A+ GRG+F V  PD    +TR GS
Sbjct: 60  STRPVGIDIGMGVQTAGTVRLNTQGGMVATENQLNVAIDGRGYFSVTLPDGNQAFTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G++VT  G  + PG+V+PE T  ++++  G ++A    + +   +GQ  +  F+
Sbjct: 120 FQLSPEGEIVTMQGYRVEPGLVVPENTTAVEINEQGVVMAYVENDPEPVELGQFSLTTFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE G+R +G+N L  T  SG+  + NP D G   ++QGYLEASNV+ +++I+++ISAQRA
Sbjct: 180 NEPGMRPVGNNFLLATEASGEAQVVNPGDPGAGMIRQGYLEASNVNVIQQITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK IE AD+M S   ++R
Sbjct: 240 YEMNSKSIETADQMLSAANQIR 261


>gi|329849714|ref|ZP_08264560.1| flagellar basal-body rod protein FlgG [Asticcacaulis biprosthecum
           C19]
 gi|328841625|gb|EGF91195.1| flagellar basal-body rod protein FlgG [Asticcacaulis biprosthecum
           C19]
          Length = 263

 Score =  228 bits (581), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 127/261 (48%), Positives = 171/261 (65%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A  GM+AQQ N+E+I+NNIAN+NT G+K+ RAEF D LYQ  +  GS S S   
Sbjct: 1   MRALRTATTGMAAQQLNVEVISNNIANMNTVGFKKQRAEFQDLLYQNIERMGSQS-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP GI +G+GV+  SV  +  QG +  T N  D+A+ G+G+FQ+  P     YTRAG+
Sbjct: 60  TVVPTGIQVGAGVKAGSVYRIMQQGSMTLTQNQYDVAIEGKGYFQILMPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++D +G+LVT DG  + P + IP++  ++ +S++GQI A     +    VGQL  A F 
Sbjct: 120 FSVDDQGRLVTEDGYLVQPSVTIPQDAIDVSISKTGQIQATQQGQTAPTTVGQLQTATFF 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNL   +  SG P +S P D+GF  + QGY EASNVDAV EI+ +I AQRA
Sbjct: 180 NEAGLDAIGDNLFLESGASGAPNVSTPGDVGFGTLLQGYTEASNVDAVGEITALIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSKVI  AD+M    +++
Sbjct: 240 YEMNSKVITTADQMLQTASQI 260


>gi|206558970|ref|YP_002229730.1| flagellar basal body rod protein FlgG [Burkholderia cenocepacia
           J2315]
 gi|198035007|emb|CAR50879.1| flagellar basal-body rod protein FlgG (distal rod protein)
           [Burkholderia cenocepacia J2315]
          Length = 262

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+  + + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVLPAITVPQNAQSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVSQPGLNGAGVLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|120613061|ref|YP_972739.1| flagellar basal-body rod protein FlgG [Acidovorax citrulli AAC00-1]
 gi|326319099|ref|YP_004236771.1| flagellar basal-body rod protein FlgG [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|120591525|gb|ABM34965.1| flagellar basal-body rod protein FlgG [Acidovorax citrulli AAC00-1]
 gi|323375935|gb|ADX48204.1| flagellar basal-body rod protein FlgG [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 260

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  GMSAQQT L++I++N+AN++TTGYKR  A F D +YQ  +  G  +Q+ ++
Sbjct: 2   INSLWIAKTGMSAQQTQLDVISHNLANVSTTGYKRNNAVFEDLIYQNLRQVG--AQTTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    +TQG +  + NNLD+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  NQLPTGLHLGLGVRTVATSRNFTQGSLAQSNNNLDVAINGNGFFQVTMPDGTTGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G+LVT+ G  +  GI +P     I +S  G + A     +  Q +G L +A+FI
Sbjct: 120 FQLDSQGRLVTSSGLPVANGITVPANATGISISTDGIVSATVPGTTAPQQIGTLGMASFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   ++ SG P    P   G   ++QG+LE SNV+ V+E+  MI  QRA
Sbjct: 180 NSAGLEPIGQNLFKESAASGQPQQGTPGTNGLGIIRQGFLETSNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + + ++
Sbjct: 240 YEMNSKAIQTSDQMLAKLAQL 260


>gi|57167709|ref|ZP_00366849.1| flagellar basal-body rod protein (flgG) [Campylobacter coli RM2228]
 gi|305433215|ref|ZP_07402371.1| flagellar basal-body rod protein FlgG [Campylobacter coli JV20]
 gi|57020831|gb|EAL57495.1| flagellar basal-body rod protein (flgG) [Campylobacter coli RM2228]
 gi|304443916|gb|EFM36573.1| flagellar basal-body rod protein FlgG [Campylobacter coli JV20]
          Length = 263

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 103/263 (39%), Positives = 162/263 (61%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K+ RAEFAD +YQ  K AG  + ++  
Sbjct: 2   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKGRAEFADLMYQVMKYAG--TSTSAT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 60  TLSPSGIEVGIGVRPTAVTKVFTEGNLKATSTDSLDMAIAGNGFFQIQLPDGTIAYTRNG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V ADG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 120 QFTKDNEGNIVNADGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVQF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 180 INPAGLHSMGDNLYLETGASGAPVAGIATQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE  SK I  +D+M  ++ +++
Sbjct: 240 AYEAGSKAITTSDDMLGIVNQLK 262


>gi|188587423|ref|YP_001918968.1| flagellar basal-body rod protein FlgG [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179352110|gb|ACB86380.1| flagellar basal-body rod protein FlgG [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 265

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 99/262 (37%), Positives = 150/262 (57%), Gaps = 1/262 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQA-EKVAGSPSQSADK 60
           ++    A+GM+AQQ N+++++NN+AN NTTGYK +RAEF D +Y   E+  G      D 
Sbjct: 3   RSLWTGASGMNAQQKNMDVVSNNLANANTTGYKNSRAEFQDLIYATLERPDGPDDLGDDG 62

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI IG G + S+    ++ G +  T  + DLA+ G G+F +E  +    YTR GS
Sbjct: 63  RSTPAGIQIGHGAKNSATLRDFSTGSMQETEQDFDLAIEGDGFFIIEGTEGEEYYTRDGS 122

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID +G LVT+DG  +        +            +  T ++ +   +G++ IA+FI
Sbjct: 123 FKIDGEGNLVTSDGLHVQSFDGEIPQEATNVSITEEGRVIATLEDGETDEIGEIEIASFI 182

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL + T+ SGD  +  P + G   ++QG+LE SNV+  +E+  MI+AQRA
Sbjct: 183 NPAGLEAQGSNLYSATAASGDASVGLPGENGRGQLQQGFLEGSNVNIAEEMVNMITAQRA 242

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I++ DEM S+   ++
Sbjct: 243 YETNSKSIQSTDEMMSIANNLK 264


>gi|154174905|ref|YP_001408076.1| flagellar basal body rod protein FlgG [Campylobacter curvus 525.92]
 gi|112802860|gb|EAU00204.1| flagellar basal-body rod protein FlgG [Campylobacter curvus 525.92]
          Length = 262

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 106/262 (40%), Positives = 166/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT GYK+ RAEFAD +YQ  + AG  + ++  
Sbjct: 2   MRSLYTAATGMIAQQTQIDVTSNNIANVNTYGYKKNRAEFADLMYQVMEYAG--TATSQT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +++  +++QG    T NNLD+ + G G+FQ++ PD T  YTR G+
Sbjct: 60  TTSPTGIEVGLGVRPTAINKIFSQGYFKETSNNLDMVIAGNGFFQLQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS G +V +DG  L+P IV+P    +I +   G +  +    ++   +GQ+ IANFI
Sbjct: 120 FKLDSNGTIVNSDGYQLIPQIVVPANATQISIGTDGTVSVLQAGETNMAQIGQIQIANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDN    T+ SGD ++      G   ++QG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSMGDNNYLETAASGDAVVGVAGLDGLGTIRQGFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +D M  ++  ++
Sbjct: 240 YEANSKAITTSDSMLEIVNGLK 261


>gi|260431748|ref|ZP_05785719.1| flagellar basal-body rod protein FlgG [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415576|gb|EEX08835.1| flagellar basal-body rod protein FlgG [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 261

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 118/262 (45%), Positives = 171/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN+NTTGY   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQMRVETISNNLANMNTTGYNARRAEFADLHYQQMARAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P GI +G GV+ ++V     QG +  TG++LD+A+ GRG+ +V  P+    YTR GS
Sbjct: 60  TVLPTGIQLGLGVRPAAVTVQLAQGALSATGSDLDIAIEGRGYLEVTLPNGQSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG  +VP I IP++ R I ++ +G++ A     ++ Q +G+  +A+F 
Sbjct: 120 LKRSAEGLIVTSDGFPVVPEITIPDDARSISINAAGEVYAYFDDTAEGQLLGEFTLASFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG PI+  P + G   ++QGYLE S+VDAV+E++E+I AQR 
Sbjct: 180 NAKGLEAIGSNLFKETEASGAPIVGTPGEDGLGTLRQGYLEDSSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M    T++R
Sbjct: 240 YEMNAKVISAVDQMMGATTQVR 261


>gi|325529016|gb|EGD06029.1| flagellar basal body rod protein FlgG [Burkholderia sp. TJI49]
          Length = 262

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAGFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+    + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQILPAITVPQNATSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL + T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEARGENLFSETTSSGAPNVSQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|319787119|ref|YP_004146594.1| flagellar basal-body rod protein FlgG [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465631|gb|ADV27363.1| flagellar basal-body rod protein FlgG [Pseudoxanthomonas suwonensis
           11-1]
          Length = 261

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 150/259 (57%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + ++ANN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 3   QALWVAKTGLDAQQTRMSVVANNLANTNTTGFKRDRANFEDLLYQQVRQPG--GSTSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V  PD T  YTR GSF
Sbjct: 61  QLPSGLQLGTGVRVVSTAKDFQQGNPQQTGRALDVMINGRGFFEVLMPDGTSAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            ++++G+LVT+ G  + PGI +PE  + + +   G I      +     +G L + +FIN
Sbjct: 121 QVNAQGELVTSSGYPVQPGIQVPEGAQSMTIGTDGTITVQMAGDGQALEIGALTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+  G+NL   T+ SG      P   G   V+QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLQARGENLYMETTASGPAQNGTPGLNGLGLVEQGALEGSNVNVVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDSMLGYLNN 259


>gi|224534580|ref|ZP_03675156.1| flagellar basal-body rod protein FlgG [Borrelia spielmanii A14S]
 gi|224514257|gb|EEF84575.1| flagellar basal-body rod protein FlgG [Borrelia spielmanii A14S]
          Length = 265

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 105/264 (39%), Positives = 161/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDIAIEGDGFYKILLPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE  +    +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIQNSITISEQGIVSVKIDNSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLNAIGSNLFKETAGSGQEIAGIPGSEGMGRLRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|320537132|ref|ZP_08037104.1| flagellar basal-body rod protein FlgG [Treponema phagedenis F0421]
 gi|320146005|gb|EFW37649.1| flagellar basal-body rod protein FlgG [Treponema phagedenis F0421]
          Length = 264

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 106/264 (40%), Positives = 159/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA+GM++QQ N++ +ANN+AN+NT+G+K+ RAEF D LYQ  K AG+P  + + 
Sbjct: 2   IRSLWTAASGMNSQQANIDTVANNLANVNTSGFKKQRAEFEDLLYQTVKSAGTP--ATED 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P GI +G G ++++ + ++ QG + HTG   D+A+ G G+F+V   D T  YTR GS
Sbjct: 60  TITPVGIQMGHGSKLAATQRIFEQGALQHTGLTSDVAVAGEGFFRVLQYDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV--SRSGQILAVTGKNSDFQPVGQLLIAN 178
           F ID+  QLVT++G  ++P I+ PE   E  +  S+ G++    G+  +   VGQ+ +  
Sbjct: 120 FKIDADRQLVTSNGLRVLPEIIFPENYVERSIAISQDGRVTVRVGEEDEPIDVGQIELYR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F N AGL   G NL  +T  SG  I   P   GF   +  +LE SNV  V E+  MI AQ
Sbjct: 180 FQNNAGLAAEGSNLFKQTPASGQAIPGRPGFNGFGKTEHKFLEMSNVSTVSEMVNMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE NSK I+ +D M      ++
Sbjct: 240 RAYEFNSKAIQTSDNMLGTAVGLK 263


>gi|298529926|ref|ZP_07017328.1| flagellar basal-body rod protein FlgG [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509300|gb|EFI33204.1| flagellar basal-body rod protein FlgG [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 260

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 163/262 (62%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM+AQQ N+++ +NN+AN+NT G+K+++A+F D +YQ  KVAG+ + + D+
Sbjct: 2   MRSLWTAATGMAAQQMNIDVTSNNLANVNTDGFKKSQAQFEDLMYQTLKVAGTENLTGDR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ +G G    SV  ++TQG+   TGN LDL + G G+FQV   D  V YTRAGS
Sbjct: 62  --VPTGLQVGMGTNPLSVHKIFTQGDYKQTGNPLDLTIEGDGFFQVMAND-EVRYTRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  G++VTA+G  L P   IPE+T  + V   G I+ V G + +    G++ I  F+
Sbjct: 119 FKPDQDGRIVTANGYPLQPEFHIPEDTARVHVDEQGNIVCVDGDD-NVIAEGEIPIYRFM 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G NL + T  SG      P +  F  ++ G LE+SNV+ V E+  MI  QRA
Sbjct: 178 NPAGLNSAGRNLYSETEASGPATEGVPGEENFGSIRSGALESSNVEIVDEMVNMIIGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+ +D+M  +  +M+
Sbjct: 238 YEINSKAIQTSDQMLQMANQMK 259


>gi|325274797|ref|ZP_08140825.1| flagellar basal body rod protein FlgG [Pseudomonas sp. TJI-51]
 gi|324100065|gb|EGB97883.1| flagellar basal body rod protein FlgG [Pseudomonas sp. TJI-51]
          Length = 261

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 120/258 (46%), Positives = 167/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEFAD LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFADLLYQVKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +  G +  T N LD+A+ GRG+FQ+  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKSFVAGSLQTTENPLDMAVNGRGFFQILQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VTA+G  L P IV+P + +   V   G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LNSDGQIVTANGYALEPAIVVPNDAQTFTVGTDGTVSITTAGNPAAQVIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IGDNL   T+ SG P +  P   GF   +Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGDNLFLETAASGAPQVGTPGLNGFGTTQQQTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|167038473|ref|YP_001666051.1| hypothetical protein Teth39_2092 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116868|ref|YP_004187027.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166857307|gb|ABY95715.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929959|gb|ADV80644.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 266

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 103/268 (38%), Positives = 143/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAATGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +T+G +  T N LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGKPVNMQVGVGVRPSAIVKDFTEGSLQQTENPLDLALDGEGFFAVLGPDDKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSR------SGQILAVTGKNSDFQPVGQL 174
           F + + G  +        P +           +          +++V   +   Q V  L
Sbjct: 118 FKLSADGNTLMLVTADGYPVLDDSGNPIVFDSTEKDISVSPMGVISVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G NL   T  SG P   +        V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFVNPQGLLSVGSNLYEPTEASGQPSTRDDFQGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|293414371|ref|ZP_06657020.1| flagellar basal-body rod protein FlgG [Escherichia coli B185]
 gi|291434429|gb|EFF07402.1| flagellar basal-body rod protein FlgG [Escherichia coli B185]
          Length = 260

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 108/258 (41%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
             IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++  +
Sbjct: 5   LWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQTTL 62

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
           P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GSF +
Sbjct: 63  PSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGSFQV 122

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
           D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+N+ 
Sbjct: 123 DQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDT 182

Query: 184 GLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEM 243
           GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRAYE+
Sbjct: 183 GLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEI 242

Query: 244 NSKVIEAADEMSSLITKM 261
           NSK +   D+M   +T++
Sbjct: 243 NSKAVSTTDQMLQKLTQL 260


>gi|328543156|ref|YP_004303265.1| flagellar basal-body rod FlgG [polymorphum gilvum SL003B-26A1]
 gi|326412902|gb|ADZ69965.1| Flagellar basal-body rod FlgG [Polymorphum gilvum SL003B-26A1]
          Length = 259

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 133/262 (50%), Positives = 181/262 (69%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQ+ N+E+I+NN+AN+ TTGYKR RA+F D LYQ  +  G+ S +A  
Sbjct: 1   MKALHIAATGMKAQELNVEVISNNVANMRTTGYKRQRADFQDLLYQNLRRMGTDSSNA-G 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ IGSGV+ ++   + TQG +  TG ++D+A+ G G+FQ++ PD T  YTR GS
Sbjct: 60  TIVPTGVQIGSGVKTAATARIMTQGTIEQTGKDMDVAIRGEGFFQIQLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G LVT DG TL PGIVIP + R++ +S +G + AV G     Q  GQ+ +A F+
Sbjct: 120 FERDANGTLVTIDGYTLDPGIVIPNDARDLTISANGTVQAVVG--VATQQFGQIQLARFV 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL  IGDNL   T  SG P +  P + G+  ++Q YLE SNVDAV EIS++I+AQRA
Sbjct: 178 NKSGLEAIGDNLYLETEASGQPQVGIPGEEGYGDLQQSYLEMSNVDAVSEISDLIAAQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNS++I+AADEM S  T +R
Sbjct: 238 YEMNSRIIQAADEMYSTTTNIR 259


>gi|114566479|ref|YP_753633.1| flagellar basal-body rod protein FlgG [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337414|gb|ABI68262.1| flagellar basal-body rod protein FlgG [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 261

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 100/263 (38%), Positives = 152/263 (57%), Gaps = 5/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A++GM AQQ N++ +++N+AN+NT G+K+ R EF D LYQ  +   +     + 
Sbjct: 2   MRSLYTASSGMYAQQLNIDTLSHNMANVNTVGFKKQRLEFQDLLYQTIRRPAADEDRNE- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVM-YTRAG 119
              P G+ +G GV+ +++  ++  G +  T N LD+A+ G  +F V+      + YTR G
Sbjct: 61  ---PVGLLVGLGVKPAAINTIFNTGNLQATENPLDVAINGTAFFGVKVAGNDELLYTRDG 117

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
           +F ID+ GQLVTADGN L       E   +I+++  G+I  +       +  GQL +  F
Sbjct: 118 AFKIDANGQLVTADGNLLEGAGTFDEGAYDIQIASDGKISYMIPGQETPEEAGQLKLFKF 177

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL+ IG NL   T  SG+     PD      ++ GYLE SNV  V+E+  +I+AQR
Sbjct: 178 INPAGLQKIGKNLYRATPNSGEAEEWQPDSDNSVSLEAGYLEMSNVQIVEEMVNLITAQR 237

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE+NSKVI ++DEM      +R
Sbjct: 238 AYEINSKVIISSDEMLQTAANLR 260


>gi|317153844|ref|YP_004121892.1| flagellar basal-body rod protein FlgG [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944095|gb|ADU63146.1| flagellar basal-body rod protein FlgG [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 260

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 158/262 (60%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM A QT+++ ++NN+AN+NTTG+K++RAEF D +YQ  ++AG+ +QS  +
Sbjct: 2   MRSLWTAATGMVAMQTHIDTLSNNLANVNTTGFKKSRAEFEDLMYQTLQIAGTETQSGGR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  SV   +TQG+  +TGN LD+A+ G G+F +   +   +YTR GS
Sbjct: 62  --LPVGMQVGMGVRPVSVHKFFTQGDFKNTGNPLDIAIEGEGFF-LVDMNGEDVYTRDGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VTA G+ L P   IP ET  + ++ +G I A+    +       + I  F 
Sbjct: 119 FKLDNEGRVVTAGGHVLQPEFTIPPETVSVVITETGHISALDKDGAALAET-DIDIYRFQ 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG N    +  SGD +   P D  F  + Q +LE SNV+ V E+  +I  QRA
Sbjct: 178 NPAGLTAIGRNFYRGSEASGDAVAGTPGDENFGTLAQAFLEGSNVEMVDEMVGLIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I  +D M      ++
Sbjct: 238 YEINSKAITTSDGMLQTAINIK 259


>gi|116691038|ref|YP_836661.1| flagellar basal body rod protein FlgG [Burkholderia cenocepacia
           HI2424]
 gi|170734372|ref|YP_001766319.1| flagellar basal body rod protein FlgG [Burkholderia cenocepacia
           MC0-3]
 gi|254246967|ref|ZP_04940288.1| Flagellar basal body rod protein [Burkholderia cenocepacia PC184]
 gi|116649127|gb|ABK09768.1| flagellar basal-body rod protein FlgG [Burkholderia cenocepacia
           HI2424]
 gi|124871743|gb|EAY63459.1| Flagellar basal body rod protein [Burkholderia cenocepacia PC184]
 gi|169817614|gb|ACA92197.1| flagellar basal-body rod protein FlgG [Burkholderia cenocepacia
           MC0-3]
          Length = 262

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+  + + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVLPAITVPQNAQSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PTGLEAKGENLFAETTSSGAPNVSQPGLNGAGVLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|330502736|ref|YP_004379605.1| flagellar basal body rod protein FlgG [Pseudomonas mendocina NK-01]
 gi|328917022|gb|AEB57853.1| flagellar basal body rod protein FlgG [Pseudomonas mendocina NK-01]
          Length = 261

 Score =  228 bits (580), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 116/258 (44%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ  NL  I+NN+AN+ TTG+KR RAEF D LYQ  +  G   Q++  + 
Sbjct: 4   ALWVSKTGLSAQDMNLTTISNNLANVATTGFKRDRAEFEDLLYQIRRQPG--GQTSQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   + ++T G +  T   LDLA+ GRG+FQ+  PD TV YTR GSF+
Sbjct: 62  LPSGLQLGTGVRVVGTQKIFTAGSLQTTEQPLDLAVNGRGFFQILQPDGTVSYTRDGSFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VT+ G  L P IV+P E R   V   G +   T  N+  Q +G + +A+F+N 
Sbjct: 122 LNSDGQIVTSQGFALEPAIVLPAEVRTFTVGEDGTVSVTTAGNAQAQVIGNIQLADFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG+NL   T  SG P + NP   G     Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLEAIGNNLFLETGSSGAPQVGNPGLNGLGTTLQNTLENSNVSVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|88799023|ref|ZP_01114604.1| Flagellar basal body rod protein [Reinekea sp. MED297]
 gi|88778250|gb|EAR09444.1| Flagellar basal body rod protein [Reinekea sp. MED297]
          Length = 261

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 111/259 (42%), Positives = 161/259 (62%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           KA  +   G+ AQ   L  I+NN+AN  TTGYK+ RA F D +YQ ++  G  +QS+   
Sbjct: 3   KALWVGKTGLEAQDIALSTISNNLANAATTGYKKERAVFEDLIYQVQRQPG--AQSSQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV+    +  + QG++  T   LD+A+ GRG+FQV  PD  + YTR G+F
Sbjct: 61  QLPSGLQLGTGVRTVGTQKQFVQGDLNMTEQPLDMAINGRGFFQVLMPDGNIAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++D++G +VTA+G  L P I +PE+T+ I V   G + AV+  ++D   +G + I +F+N
Sbjct: 121 HLDAEGNVVTANGYFLEPNIQVPEQTKTITVGTDGIVTAVSAGDNDPVEIGNIDIVDFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG+NL   T+ SG P    P   GF  + QG LE SNV  V+E+ +MIS QRAY
Sbjct: 181 PAGLQAIGNNLFLETAASGAPAEGVPSLDGFGSIIQGALENSNVTIVEEMVDMISTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK +  AD+M   IT 
Sbjct: 241 EMNSKAVSTADQMLGFITS 259


>gi|237653581|ref|YP_002889895.1| flagellar basal body rod protein FlgG [Thauera sp. MZ1T]
 gi|237624828|gb|ACR01518.1| flagellar basal-body rod protein FlgG [Thauera sp. MZ1T]
          Length = 260

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 102/261 (39%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A  G+ AQQT+L++I+NN+AN++T G+KR RA F D LYQ  +  G  +QS  +
Sbjct: 2   IRSLWTARTGLDAQQTSLDVISNNLANVSTNGFKRQRAIFEDLLYQTIRQPG--AQSTQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +  G+ IG+GV+  +   ++TQG +  TG +LD+A+ G G+FQV  PD T  YTR G+
Sbjct: 60  TQISSGLQIGTGVKPVATERIFTQGTLQQTGGSLDVAVQGNGFFQVAMPDGTTAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G +VTA G TL   I IP +   I + + G +  +    +    +G + +A FI
Sbjct: 120 FQLDSQGNVVTASGYTLADNINIPADALSITIGKDGTVSVLQAGQTAPVEIGAIQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL+  G+NL   T+ SG    + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NSGGLQAAGENLFYETASSGVATPTQPGTNGAGVLNQGYVEVSNVNVAEELVSMIVTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NS+ I  +D+M   +T++
Sbjct: 240 YELNSRAISTSDQMLGRLTQL 260


>gi|222147571|ref|YP_002548528.1| flagellar basal-body rod protein [Agrobacterium vitis S4]
 gi|221734559|gb|ACM35522.1| flagellar basal-body rod protein [Agrobacterium vitis S4]
          Length = 263

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 141/264 (53%), Positives = 196/264 (74%), Gaps = 3/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IA+ GM+AQQTNLE+I+NNIANINTTG+K++RAEF+D LYQ EK  G  ++ A++
Sbjct: 1   MRALAIASTGMNAQQTNLEVISNNIANINTTGFKKSRAEFSDLLYQTEKAVGVANR-ANQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDK-TVMYTRAG 119
           + VPEG +IG GVQ ++VR +  QGE+  T N LD+A+VGRG+ QV++PD  T  YTRAG
Sbjct: 60  STVPEGANIGLGVQTAAVRTMNEQGELSETSNELDVAIVGRGYLQVQSPDGATTFYTRAG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
           + N DS G LVT +G  ++P I IP +  E+K+S SG++  + G +S +  +GQL  + F
Sbjct: 120 ALNKDSDGNLVTTEGYKIIPNITIPTDATEVKISESGEVSVLQGDSSTYTTLGQLETSAF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           +N AGL+ IGDNL   T+ SG+PI   P D G+ ++KQGYLE+SNVD+V EI+ +ISAQR
Sbjct: 180 VNPAGLKAIGDNLFQETASSGNPINGVPGDAGYGYLKQGYLESSNVDSVTEITSLISAQR 239

Query: 240 AYEMNSKVIEAADEMSSLIT-KMR 262
           AYEMNSKVI  ADEM+ +++  ++
Sbjct: 240 AYEMNSKVITTADEMAQIVSKNLK 263


>gi|183598619|ref|ZP_02960112.1| hypothetical protein PROSTU_02019 [Providencia stuartii ATCC 25827]
 gi|188020798|gb|EDU58838.1| hypothetical protein PROSTU_02019 [Providencia stuartii ATCC 25827]
          Length = 260

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 100/261 (38%), Positives = 161/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+  QQTNL++I+NN+AN++T G+KR RA F D LYQ  +  G  + S+++
Sbjct: 2   IRSLWIAKTGLDTQQTNLDVISNNLANVSTNGFKRQRAVFEDLLYQNIRQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G +  +   +++QG +  TGN  D+A+ G+G+  V+ PD T  YTR G+
Sbjct: 60  TSLPSGLQLGTGSRPVATMRIHSQGALNKTGNTTDIAIKGQGFLHVQLPDGTDAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              +  GQLVT+ G  +VP I IP+    + ++R G +      ++  Q +GQ+ +  FI
Sbjct: 120 LQPNQDGQLVTSSGYQIVPAITIPDNANSLTIARDGTVSITVYGDNQPQQIGQITLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T+ SG P  S P   G   + Q  LE SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESMGENLYMETASSGAPNESAPGTNGAGLLYQHMLETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   +T++
Sbjct: 240 YEINSKAVSASDQMLQRLTQL 260


>gi|326389274|ref|ZP_08210842.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994637|gb|EGD53061.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 266

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 103/268 (38%), Positives = 143/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAATGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +T+G +  T N LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGKPVNMQVGVGVRPSAIVKDFTEGSLQQTENPLDLALDGEGFFAVLGPDDKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSR------SGQILAVTGKNSDFQPVGQL 174
           F + + G  +        P +           +          +++V   +   Q V  L
Sbjct: 118 FKLSADGNTLMLVTADGYPVLDDSGNPIVFDSTEKDISVSPMGVISVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G NL   T  SG P   +        V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFVNPQGLLSVGSNLYEPTEASGQPGTRDDFQGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|330721006|gb|EGG99167.1| Flagellar basal-body rod protein FlgG [gamma proteobacterium
           IMCC2047]
          Length = 261

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 149/258 (57%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +  I+  G+SAQ   L  I+NN+AN++TTGYKR RA F D LY      G  +QS+    
Sbjct: 4   SLWISKTGLSAQDQALASISNNLANVSTTGYKRERAVFQDLLYPVHTQPG--AQSSQSTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+  G+GV+  + + ++T G +  T   LD+A+ GRG+FQV  PD    Y R G F 
Sbjct: 62  LPSGLQTGTGVKTVATQKLHTNGSLEVTDQPLDIAINGRGYFQVLLPDGETGYARDGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S G +V + G  L P I +P  T  I +   G I A    +S    +G + +A FIN 
Sbjct: 122 LNSDGVIVNSQGFELQPSITVPANTLNITIGSDGVISATVAGSSTPTQIGDIQLAEFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG NL   T+ SG P    P   G   ++QG LE SNV+ V+E+ +MI+ QRAYE
Sbjct: 182 TGLQAIGGNLYKETAASGTPTTGTPGLSGRGTIEQGVLENSNVNIVEELVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KVI  +D+M   +T+
Sbjct: 242 MNTKVISTSDQMLQFVTQ 259


>gi|167034941|ref|YP_001670172.1| flagellar basal body rod protein FlgG [Pseudomonas putida GB-1]
 gi|166861429|gb|ABY99836.1| flagellar basal-body rod protein FlgG [Pseudomonas putida GB-1]
          Length = 261

 Score =  228 bits (580), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 168/258 (65%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEFAD LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFADLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +  G +  T N LD+A+ GRG+FQ+  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKSFVAGSLQTTENPLDMAVNGRGFFQILQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VTA+G  L P +V+P + +   V + G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LNSDGQIVTANGYALEPAVVVPNDAQTFTVGQDGTVSITTAGNPAAQVIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IGDNL   T+ SG P +  P   GF   +Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGDNLFLETAASGAPQVGTPGLNGFGTTQQQTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|221640825|ref|YP_002527087.1| flagellar basal body rod protein FlgG [Rhodobacter sphaeroides
           KD131]
 gi|332559802|ref|ZP_08414124.1| FlgG2 [Rhodobacter sphaeroides WS8N]
 gi|221161606|gb|ACM02586.1| Flagellar basal-body rod protein FlgG precursor [Rhodobacter
           sphaeroides KD131]
 gi|332277514|gb|EGJ22829.1| FlgG2 [Rhodobacter sphaeroides WS8N]
          Length = 261

 Score =  227 bits (579), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 168/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQT +++I+NN+AN++TTGY   RA+FAD  YQ     G+ S + D 
Sbjct: 1   MKALQIAATGMSAQQTRVDVISNNLANMSTTGYNARRADFADLHYQQVVRPGTVS-AEDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G GV+ S+V  V +QG +  T  +LDLA+ GRG+ +V  P     YTR G+
Sbjct: 60  RMLPTGVQLGMGVRPSAVSVVLSQGALAQTRGDLDLAIDGRGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +V++DG+ + PGI IP++   I +  +G++          Q +GQ+ +  F 
Sbjct: 120 LKRSAEGLIVSSDGHEVAPGITIPQDAASISIDATGEVWGYFTGQVQPQLLGQISLTGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG NL   T+ SG PI     + GF  ++QGYLE S+VD+V+EI+E+I AQR 
Sbjct: 180 NEKGLEAIGSNLFLETAASGPPIAGVAGEDGFGTLRQGYLEESSVDSVQEITELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M +  +++R
Sbjct: 240 YELNAKVITAADQMLAATSQVR 261


>gi|307627452|gb|ADN71756.1| flagellar basal body rod protein FlgG [Escherichia coli UM146]
          Length = 260

 Score =  227 bits (579), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  S  P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSCAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|77457729|ref|YP_347234.1| flagellar basal body rod protein FlgG [Pseudomonas fluorescens
           Pf0-1]
 gi|77381732|gb|ABA73245.1| flagellar basal-body rod protein [Pseudomonas fluorescens Pf0-1]
          Length = 261

 Score =  227 bits (579), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 118/258 (45%), Positives = 160/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL  I+NN+AN++TTG+KR RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTTISNNLANVSTTGFKRDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T   LD+A+ GRG+FQ+  PD T  YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKNFTAGSLQTTEQPLDMAIDGRGFFQILQPDGTTSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +DS GQ+V A G  L P IVIP   +   V R G +      N   Q +G L  A+FIN 
Sbjct: 122 LDSNGQIVNASGFALEPAIVIPNNAQTFTVGRDGTVSITVAGNPAAQVIGNLQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G+NL   T+ SG P +  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAVGNNLFLETAASGAPQVGTPGLNGFGTTLQNTLETSNVSTVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|77918760|ref|YP_356575.1| flagellar basal body rod protein FlgG [Pelobacter carbinolicus DSM
           2380]
 gi|77544843|gb|ABA88405.1| flagellar biosynthesis protein [Pelobacter carbinolicus DSM 2380]
          Length = 261

 Score =  227 bits (579), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   +A GM AQQ N+++IA+N+AN+N+ G+K++RA+F D LYQ  KVAG  S  +  
Sbjct: 2   IRALWTSATGMEAQQVNMDVIAHNLANVNSAGFKKSRADFQDILYQTVKVAG--SDGSSG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  I +G G ++++++ V+T G+   TGN+LD+A+ G G+F++   +    YTRAG+
Sbjct: 60  VEQPTSIQVGLGSRVAAIQKVFTTGDFQQTGNDLDIAIEGSGFFEITLANGDTAYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  G++VT+DG  L P I+IPE   ++ +   G +  +    +    +G + +  F 
Sbjct: 120 FKKDGTGRIVTSDGYPLSPEIIIPENATQVSIGNYGAVEVLLDGQNTPTQIGTITLTRFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL +IG NL   T  +G P+  NP + GF  + QG+LE SNV  ++E+  MI+ QRA
Sbjct: 180 NPAGLNSIGHNLFTETPTTGTPVTGNPGEDGFGSLSQGFLEGSNVSIMEEMVNMIAGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I+ ADEM  +   +
Sbjct: 240 YEINSKAIKTADEMLQMTNNL 260


>gi|296447438|ref|ZP_06889363.1| flagellar basal-body rod protein FlgG [Methylosinus trichosporium
           OB3b]
 gi|296255058|gb|EFH02160.1| flagellar basal-body rod protein FlgG [Methylosinus trichosporium
           OB3b]
          Length = 262

 Score =  227 bits (579), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 135/260 (51%), Positives = 186/260 (71%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ N+E+I+NNIANINTT +KR+RAEF D LYQA+++ G  ++  D 
Sbjct: 1   MRALAIAATGMNAQQQNIEVISNNIANINTTAFKRSRAEFTDLLYQADRLQGVSNRGRDA 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V PEG   G GV+++++R++ TQG +  TGN LDLAL GRGWFQV  PD  ++YTR+GS
Sbjct: 61  TV-PEGAQTGLGVRLTAIRSLQTQGSLAQTGNQLDLALNGRGWFQVTGPDSEILYTRSGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ ++ GQLVT DG  + P I+IP     + VS+SG + AV G  ++ Q +GQL IANF 
Sbjct: 120 FSTNANGQLVTGDGYLVSPTIIIPNNAVSVSVSQSGLVTAVIGGQTNPQQLGQLTIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL  +G NL  +   SG P++  P D G+  + Q YLE+SNVD+VKE+  +I+AQRA
Sbjct: 180 NESGLEALGGNLFRQNQASGTPVVGVPGDPGYGVISQYYLESSNVDSVKELVNLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +E+NSKVI A DEM+  ++K
Sbjct: 240 FELNSKVISAVDEMAGTVSK 259


>gi|167835113|ref|ZP_02461996.1| flagellar basal body rod protein FlgG [Burkholderia thailandensis
           MSMB43]
          Length = 262

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 109/260 (41%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGSLQQTGNSKDVAINGQGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+    + +   G +      +++   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITMPQNATSLTIGSDGVVSVTQPGSNNAVQIGALQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   +KQGY+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETTSSGAPNVSQPGLNGAGTLKQGYVESSNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +T+M
Sbjct: 241 EINSKAVTTSDQMLQTVTQM 260


>gi|203288201|ref|YP_002223216.1| flagellar basal-body rod protein [Borrelia recurrentis A1]
 gi|201085421|gb|ACH94995.1| flagellar basal-body rod protein [Borrelia recurrentis A1]
          Length = 265

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 108/264 (40%), Positives = 157/264 (59%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   +A+GM AQQ N++ IANN++N+NT G+K+ RAEF D +YQ ++ AG+P  + + 
Sbjct: 2   MRALWTSASGMKAQQYNVDTIANNLSNVNTIGFKKIRAEFEDLIYQTQRRAGTP--ATED 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G  +G G ++S+   ++ QG +  T  N D+A+ G G+++V   D T  YTR GS
Sbjct: 60  TVTPLGNQVGHGTKVSATHRLFEQGNLQVTNLNTDVAIEGDGFYKVLLSDGTYGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV--SRSGQILAVTGKNSDFQPVGQLLIAN 178
           F ID+ G LVT  G  L+P I  PEE  +  +  S+ G I     +  +   +GQ+ IA 
Sbjct: 120 FKIDANGHLVTNQGYILLPEISFPEEYIKNSIAISQEGIISVKVNEGLEPIELGQIEIAR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG+N+   T  SG+ I   P   G   +KQG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLNAIGNNIFKETIGSGEEISGIPGSNGMGKLKQGMLEMSNVAIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I  +D M  +   ++
Sbjct: 240 RAYEINSKAIHTSDNMLGIANNLK 263


>gi|292487941|ref|YP_003530816.1| flagellar basal-body rod protein FlgG [Erwinia amylovora CFBP1430]
 gi|292899160|ref|YP_003538529.1| flagellar basal-body rod protein FlgG [Erwinia amylovora ATCC
           49946]
 gi|291199008|emb|CBJ46119.1| flagellar basal-body rod protein FlgG (distal rod protein) [Erwinia
           amylovora ATCC 49946]
 gi|291553363|emb|CBA20408.1| Flagellar basal-body rod protein flgG [Erwinia amylovora CFBP1430]
 gi|312172062|emb|CBX80319.1| Flagellar basal-body rod protein flgG [Erwinia amylovora ATCC
           BAA-2158]
          Length = 260

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLMYQTMRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +  +   ++ QG +  T ++ D+A+ G+G+F V+ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGTRPVATERLHNQGNLSQTDSSKDVAINGQGFFSVQMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT  G  + P IVIP  +  + VSR G +       ++   VGQL ++ F+
Sbjct: 120 FQTDQNGQLVTNAGFPVQPAIVIPANSLSMTVSRDGVVSVTQQGQANPVQVGQLTLSTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  SNP + G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLSSMGENLYQETQASGVPNESNPGNNGAGTLYQGYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + +T++
Sbjct: 240 YEINSKAISTSDQMLAKLTQI 260


>gi|56695100|ref|YP_165447.1| flagellar basal body rod protein FlgG [Ruegeria pomeroyi DSS-3]
 gi|56676837|gb|AAV93503.1| flagellar basal-body rod protein FlgG [Ruegeria pomeroyi DSS-3]
          Length = 261

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 172/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN+NTTGY   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQMRVETISNNLANMNTTGYNARRAEFADLHYQQIARAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V     QG +  TGN+LDLA+ GRG+F+V  P     +TR GS
Sbjct: 60  TVLPTGVQLGLGVRPAAVTVHLEQGALSATGNDLDLAIEGRGYFEVTLPSGQSAFTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG ++VP I IP + R I ++ +G++ A     ++ Q +GQ+ +A F 
Sbjct: 120 LKRSAEGLIVTSDGLSVVPEITIPSDARSISINAAGEVYAYFDDAAEGQLLGQVTLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG PI  NP + G   ++QGYLE S+VDAV+E++E+I AQR 
Sbjct: 180 NAKGLEAIGSNLFKETEASGSPITGNPGEDGLGTLRQGYLEDSSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M S  T++R
Sbjct: 240 YEMNAKVISAVDQMMSATTQVR 261


>gi|120554035|ref|YP_958386.1| flagellar basal body rod protein FlgG [Marinobacter aquaeolei VT8]
 gi|120323884|gb|ABM18199.1| flagellar basal-body rod protein FlgG [Marinobacter aquaeolei VT8]
          Length = 262

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 152/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ  N+  I+NN+AN+NTTG+KR +A F D LYQ  +  G    S   + 
Sbjct: 4   ALWVSKTGLSAQDINMSTISNNLANVNTTGFKRDKAVFQDLLYQINRQPG--GLSTQNSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++      ++QG +  T   LD+A+ GRG+ Q+  PD  + YTR G F 
Sbjct: 62  LPSGLQLGTGVRVVGTVKQFSQGNLQITEQPLDMAINGRGFLQILLPDGQIAYTRDGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++  G +V  DG  L P I +P     I +   G + A+T   +    VGQ+ + +FIN 
Sbjct: 122 LNVNGDVVNPDGYLLEPAINVPNNATNITIGTDGTVTAITDDQAAPVNVGQITLVDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG+NL   T  SG+PI      +G   ++QG LEASNV+ V+E+  MI+ QRAYE
Sbjct: 182 QGLQAIGNNLFKETISSGNPIEGQAGLLGLGTIEQGSLEASNVEVVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+  AD+M   IT 
Sbjct: 242 MNSKVVSTADQMLQFITN 259


>gi|288962678|ref|YP_003452972.1| flagellar basal-body rod protein [Azospirillum sp. B510]
 gi|288914944|dbj|BAI76428.1| flagellar basal-body rod protein [Azospirillum sp. B510]
          Length = 261

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 135/262 (51%), Positives = 181/262 (69%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+   IA+ GM AQQ N+E+I+NNIANINTT YKR+RAEF D +YQAEK  GS S +   
Sbjct: 1   MRVLSIASTGMMAQQLNVEVISNNIANINTTAYKRSRAEFQDLMYQAEKRQGSQS-TDSG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ +SV  + T G +  TGN LDLA+ GRG+F V  P    +YTRAGS
Sbjct: 60  TIVPTGVEVGLGVRPTSVNRINTTGNLTSTGNELDLAIEGRGYFNVTQPGGETVYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +G +VTADG T+ PGI +P+ TRE+ ++RSG++LA     +     GQL +  F+
Sbjct: 120 FKLSPEGTIVTADGFTVAPGITVPQGTREVVINRSGEVLAYVDGKTQPVNQGQLAMTVFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL  +GDNL   T  SG+P        GF  ++Q YLE+SNV+ V+EI+E+ISAQRA
Sbjct: 180 NESGLEALGDNLFRATPASGEPQEGLAGQAGFGTIRQKYLESSNVNVVQEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVIEA D+M+S +T MR
Sbjct: 240 YEMNAKVIEAGDQMASTMTNMR 261


>gi|157147100|ref|YP_001454419.1| flagellar basal body rod protein FlgG [Citrobacter koseri ATCC
           BAA-895]
 gi|157084305|gb|ABV13983.1| hypothetical protein CKO_02877 [Citrobacter koseri ATCC BAA-895]
          Length = 261

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G++AQ   +  I+NN+AN+NTTG+KR RA FAD  YQ ++  G   Q     +
Sbjct: 4   ALWISKTGLAAQDAKMTAISNNLANVNTTGFKRDRAMFADLFYQNQRTPG--GQLDQNNI 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI  G+GV+I   +  +T G + +TG   D+A+ G+G+FQVET D  + YTRAG+F 
Sbjct: 62  APTGIQYGTGVKIVGTQKEFTVGSIQNTGQTFDVAITGQGFFQVETADGDIAYTRAGNFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
               G L  A G  LVP I +PE  +++++ + G I A     +D   +GQL + NF+N 
Sbjct: 122 KTPDGVLTNAQGLPLVPQIELPENVKDLQIGKDGTITATVAGETDPVELGQLTLVNFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG NL   T+ SG+ +   P +     ++QG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAIGGNLYRETAASGEAVEGVPGEDALGQLEQGSLEGSNVQVVEEMVDMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   +T+
Sbjct: 242 MNAKMVSAADDMLKFVTQ 259


>gi|104782840|ref|YP_609338.1| flagellar basal body rod protein FlgG [Pseudomonas entomophila L48]
 gi|95111827|emb|CAK16551.1| Flagellar basal-body rod protein flgG [Pseudomonas entomophila L48]
          Length = 261

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 167/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   +  +  G + +T N LD+A+ GRG+FQ+  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRVVGTQKNFQTGGLQNTENPLDMAINGRGFFQILQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+V ADG  L P IV+P E +   V + G +   T  N   Q +G L  A+FIN 
Sbjct: 122 LNSDGQIVNADGFALEPAIVVPPEAQTFTVGQDGTVSITTAGNPAAQVIGNLQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG+NL   T+ SG P I  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGNNLFLETAASGAPQIGTPGLNGFGTSLQKTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI AAD+M S +T+
Sbjct: 242 MNSKVISAADKMLSFVTQ 259


>gi|94312671|ref|YP_585880.1| flagellar basal body distal rod protein [Cupriavidus metallidurans
           CH34]
 gi|93356523|gb|ABF10611.1| flagellar basal body distal rod protein [Cupriavidus metallidurans
           CH34]
          Length = 261

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQT +++I+NN+AN++TTG+KR+RA F + +YQ  +  G  + S+D+
Sbjct: 2   IRSLWIAKTGLDAQQTQMDVISNNLANVSTTGFKRSRAVFEEMMYQTIRQPG--AMSSDQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ IG+GV+  +   ++TQG    TGN  D+A++G G+FQV  PD T  YTR GS
Sbjct: 60  TVLPSGMQIGTGVRPVATERIHTQGNPQQTGNAKDVAIIGNGFFQVTMPDGTTSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  + P I +P     + ++R G +  +   +++   VGQL +A F 
Sbjct: 120 FQVDQNGQLVTSSGFVINPAITLPANYTSVNIARDGTVTVMQPGSTNAATVGQLQLATFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL ++G+NL  +T  SG P  + P   G   ++  Y+EASNV+ V+E+  MI  QRA
Sbjct: 180 NPTGLESMGENLYVQTDASGAPNTTVPGLNGAGTLQNNYVEASNVNVVEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   +T+M
Sbjct: 240 YEINSKAVQTSDQMLQRLTQM 260


>gi|42522134|ref|NP_967514.1| flagellar basal-body rod protein FlgG [Bdellovibrio bacteriovorus
           HD100]
 gi|39574665|emb|CAE78507.1| flagellar basal-body rod protein FlgG [Bdellovibrio bacteriovorus
           HD100]
          Length = 261

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 117/262 (44%), Positives = 167/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +K+   AA GM+AQQTN+++IANNIAN++T G+KR+RAEF D +YQ +K  G  + S   
Sbjct: 2   LKSLNTAATGMAAQQTNMDVIANNIANVSTAGFKRSRAEFEDLMYQTQKEPG--TASGLN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A  P G+ +G GV+ + V+  +  G+   T N LDL + G G+FQV T D    YTR G+
Sbjct: 60  AYSPNGVQVGLGVRTAGVQKDFAGGQAQITKNPLDLQIEGSGFFQVLTADGETAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  G+LV  +GNTL P I +P     I+V+ +G++  +TG N   Q +GQ+ + NF+
Sbjct: 120 FKKDPNGRLVDKNGNTLQPEITVPANVSGIEVAPTGEVRVITGLNDVPQTIGQIDVVNFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+ +G NL  +T  SG  I S P   G  ++ QG LE+SNV+ V E+  MI+AQRA
Sbjct: 180 NPAGLKAMGKNLFTQTPSSGQAIASRPGLNGTGYLAQGQLESSNVNIVDEMVNMITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
            E NSKV++A+D+M   I  +R
Sbjct: 240 METNSKVMQASDQMLQAINNLR 261


>gi|24112486|ref|NP_706996.1| flagellar basal body rod protein FlgG [Shigella flexneri 2a str.
           301]
 gi|30062614|ref|NP_836785.1| flagellar basal body rod protein FlgG [Shigella flexneri 2a str.
           2457T]
 gi|24051372|gb|AAN42703.1| flagellar basal body rod protein flgG [Shigella flexneri 2a str.
           301]
 gi|30040860|gb|AAP16591.1| flagellar basal body rod protein flgG [Shigella flexneri 2a str.
           2457T]
 gi|281600496|gb|ADA73480.1| Flagellar basal body rod protein flgG [Shigella flexneri 2002017]
 gi|313650470|gb|EFS14877.1| flagellar basal-body rod protein FlgG [Shigella flexneri 2a str.
           2457T]
 gi|332758238|gb|EGJ88561.1| flagellar basal-body rod protein FlgG [Shigella flexneri 4343-70]
 gi|332759659|gb|EGJ89964.1| flagellar basal-body rod protein FlgG [Shigella flexneri 2747-71]
 gi|332761424|gb|EGJ91708.1| flagellar basal-body rod protein FlgG [Shigella flexneri K-671]
 gi|332767686|gb|EGJ97879.1| flagellar basal-body rod protein FlgG [Shigella flexneri 2930-71]
 gi|333005399|gb|EGK24917.1| flagellar basal-body rod protein FlgG [Shigella flexneri K-218]
 gi|333019426|gb|EGK38709.1| flagellar basal-body rod protein FlgG [Shigella flexneri K-304]
          Length = 260

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  Y R GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYIRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|126463746|ref|YP_001044860.1| flagellar basal body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105410|gb|ABN78088.1| flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17029]
          Length = 261

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 168/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQT +++I+NN+AN++TTGY   RA+FAD  YQ     G+ S + D 
Sbjct: 1   MKALQIAATGMSAQQTRVDVISNNLANMSTTGYNARRADFADLHYQQVVRPGTVS-AEDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G GV+ S+V  V +QG +  T  +LDLA+ GRG+ +V  P     YTR G+
Sbjct: 60  RMLPTGVQLGMGVRPSAVSVVLSQGALAQTRGDLDLAIDGRGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +V++DG+ + PGI IP++   I +  +G++          Q +GQ+ +  F 
Sbjct: 120 LKRSAEGLIVSSDGHEVAPGITIPQDAASISIDATGEVWGYFTGQVQPQLLGQISLTGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG NL   T+ SG PI     + GF  ++QGYLE S+VD+V+EI+E+I AQR 
Sbjct: 180 NEKGLEAIGSNLFLETAASGPPIGGVAGEDGFGTLRQGYLEESSVDSVQEITELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M +  +++R
Sbjct: 240 YELNAKVITAADQMLAATSQVR 261


>gi|322421662|ref|YP_004200885.1| flagellar basal-body rod protein FlgG [Geobacter sp. M18]
 gi|320128049|gb|ADW15609.1| flagellar basal-body rod protein FlgG [Geobacter sp. M18]
          Length = 262

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 106/262 (40%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQ N++++ANN+AN +TTG+K++RA+F D +YQ EK  G+P  + + 
Sbjct: 2   IRALWTAASGMQAQQLNIDVVANNLANSSTTGFKKSRADFQDLMYQTEKTTGAP--ATNA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI +G GV+  +V  V+T G +VHTGN LDLA+ G G+ QV+  D +  YTRAGS
Sbjct: 60  TTVPTGIQVGLGVRPGAVAKVFTTGTIVHTGNELDLAIQGDGFLQVQQSDGSTAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              D +G++VT+DG  ++P ++IP     + +   G +       +    VG + +A+F 
Sbjct: 120 LKKDGQGRVVTSDGQPVIPEVLIPSNATSVSIGTDGTVSVQQAGQTAATTVGTIQLASFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL  IG NL   T  SG          G   ++QGY+E SNV  ++E+  MI +QRA
Sbjct: 180 NPSGLNAIGKNLFLPTDSSGAATTGTAGQNGLGSLEQGYIEQSNVSVMEEMVSMIVSQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+A+D+M      ++
Sbjct: 240 YEINSKAIQASDDMLQQAAALK 261


>gi|183220919|ref|YP_001838915.1| flagellar basal body rod protein FlgG [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189911015|ref|YP_001962570.1| flagellar basal body rod protein FlgG [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167775691|gb|ABZ93992.1| Endoflagellar distal basal body rod protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779341|gb|ABZ97639.1| Flagellar basal-body rod protein FlgG (Distal rod protein)
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 265

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 108/265 (40%), Positives = 162/265 (61%), Gaps = 5/265 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++    A GM AQQ +++ +ANN+AN+NTTG+K+ R +F D +YQ + +AG+P+ S   
Sbjct: 2   MRSLWTGATGMIAQQFHIDTVANNLANVNTTGFKKNRVDFEDLVYQHQVLAGTPATSVS- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVG-RGWFQVETPDKTVMYTRAG 119
             +P G+++G GV++++ + ++  G    TGN LDLAL G   +F+++ PD T  Y+R G
Sbjct: 61  -EIPTGVNVGHGVKVAATQKLFEIGSFQATGNKLDLALTGEMAFFKIQMPDGTFSYSRDG 119

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
           SF IDS  Q+VT++G  L P I++PE      + VS  G++    G +     +GQL + 
Sbjct: 120 SFKIDSNQQVVTSNGYLLEPPIILPENAILNTLMVSEEGEVTVKIGNDIRPTTIGQLELY 179

Query: 178 NFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISA 237
            F+N AGL+ +G NL   T  SG  I   P   G+  V QG+LE SNV  V+E+  MI A
Sbjct: 180 RFVNPAGLQAVGKNLFRETVASGQEIPGMPSQEGYGSVLQGFLEMSNVKIVEEMVNMIVA 239

Query: 238 QRAYEMNSKVIEAADEMSSLITKMR 262
           QRAYE NSK I+ +D M S    ++
Sbjct: 240 QRAYESNSKTIQTSDNMLSTAIGLK 264


>gi|197120123|ref|YP_002140550.1| flagellar basal body rod protein FlgG [Geobacter bemidjiensis Bem]
 gi|197089483|gb|ACH40754.1| flagellar basal body rod protein FlgG [Geobacter bemidjiensis Bem]
          Length = 262

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 159/262 (60%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQ N++++ANN+AN  TTG+K++RA+F D +YQ EK  G+P  + + 
Sbjct: 2   IRALWTAASGMQAQQLNIDVVANNLANAATTGFKKSRADFQDLMYQTEKTTGAP--ATNA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+  +V  V+T G ++ TGN LDLA+ G G+ QV+  D +  YTRAG+
Sbjct: 60  TTIPTGIQVGLGVRPGAVTKVFTTGNIIATGNELDLAIQGDGFLQVQQSDGSTAYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D +G++VT+DG  ++P ++IP     + V   G +       +    VG L +A+F 
Sbjct: 120 FKRDGQGRVVTSDGQPVIPEVLIPSNATRVTVGTDGTVSVQQAGQTAATTVGTLQLASFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   T  SG          G   ++QG+LE SNV  ++E+  MI  QRA
Sbjct: 180 NPAGLNAIGKNLFLPTDSSGAATTGTAGQNGLGTIEQGFLENSNVSIMEEMVSMIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+A+DEM      ++
Sbjct: 240 YEINSKAIQASDEMLQQAAGLK 261


>gi|77464904|ref|YP_354408.1| flagellar basal body rod protein FlgG [Rhodobacter sphaeroides
           2.4.1]
 gi|77389322|gb|ABA80507.1| putative flagellar basal body rod protein [Rhodobacter sphaeroides
           2.4.1]
          Length = 261

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 168/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQT +++I+NN+AN++TTGY   RA+FAD  YQ     G+ S + D 
Sbjct: 1   MKALQIAATGMSAQQTRVDVISNNLANMSTTGYNARRADFADLHYQQAVRPGTVS-AEDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G GV+ S+V  V +QG +  T  +LDLA+ GRG+ +V  P     YTR G+
Sbjct: 60  RMLPTGVQLGMGVRPSAVSVVLSQGALAQTRGDLDLAIDGRGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +V++DG+ + PGI IP++   I +  +G++          Q +GQ+ +  F 
Sbjct: 120 LKRSAEGLIVSSDGHEVAPGITIPQDAASISIDATGEVWGYFTGQVQPQLLGQISLTGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG NL   T+ SG PI     + GF  ++QGYLE S+VD+V+EI+E+I AQR 
Sbjct: 180 NEKGLEAIGSNLFLETAASGPPIAGVAGEDGFGTLRQGYLEESSVDSVQEITELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M +  +++R
Sbjct: 240 YELNAKVITAADQMLAATSQVR 261


>gi|238028847|ref|YP_002913078.1| flagellar basal body rod protein FlgG [Burkholderia glumae BGR1]
 gi|237878041|gb|ACR30374.1| Flagellar basal-body rod protein [Burkholderia glumae BGR1]
          Length = 262

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGNLQQTGNSRDVAINGQGFFQVLMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+  + + +   G +      +++   +G + +A FIN
Sbjct: 121 QANNQGQLVTSAGYQVLPAITVPQNAQSLTIGADGVVTVTQPGSTNAVQIGSMQLATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  +G NL A T+ SG P ++ P   G   + QGY+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PEGLNALGQNLFAETTSSGAPNVTTPGLNGAGSLNQGYVESSNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|115353116|ref|YP_774955.1| flagellar basal body rod protein FlgG [Burkholderia ambifaria AMMD]
 gi|170703098|ref|ZP_02893918.1| flagellar basal-body rod protein FlgG [Burkholderia ambifaria
           IOP40-10]
 gi|171321840|ref|ZP_02910741.1| flagellar basal-body rod protein FlgG [Burkholderia ambifaria
           MEX-5]
 gi|172061970|ref|YP_001809622.1| flagellar basal body rod protein FlgG [Burkholderia ambifaria
           MC40-6]
 gi|115283104|gb|ABI88621.1| flagellar basal-body rod protein FlgG [Burkholderia ambifaria AMMD]
 gi|170131995|gb|EDT00503.1| flagellar basal-body rod protein FlgG [Burkholderia ambifaria
           IOP40-10]
 gi|171092878|gb|EDT38130.1| flagellar basal-body rod protein FlgG [Burkholderia ambifaria
           MEX-5]
 gi|171994487|gb|ACB65406.1| flagellar basal-body rod protein FlgG [Burkholderia ambifaria
           MC40-6]
          Length = 262

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+  + + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQILPAITVPQNAQSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVAQPGLNGAGVLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|78777301|ref|YP_393616.1| flagellar basal body rod protein FlgG [Sulfurimonas denitrificans
           DSM 1251]
 gi|78497841|gb|ABB44381.1| Flagellar basal-body rod FlgG [Sulfurimonas denitrificans DSM 1251]
          Length = 262

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 163/262 (62%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A+ GM   QT +   ANNIAN+NT G+K++RAEFAD +Y+    AG  + ++D 
Sbjct: 2   MQSLYTASTGMIGMQTQINTTANNIANVNTIGFKKSRAEFADLMYKVMDYAG--TSTSDV 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +++  V+++G +  T N LD+A+ G+G+F++E PD + +Y+R G+
Sbjct: 60  TKSPTGIEVGLGVRPTAINKVFSEGSLKQTDNELDVAVTGKGFFKLELPDGSEVYSRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  G +V +DG  LVP +VIP +   I +   G +  V    +    +GQ+ + NFI
Sbjct: 120 FKVDENGSIVNSDGYRLVPEVVIPPDATNINIGTDGTVSVVQAGQAQATQIGQMTLTNFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDNL   T  SG P+   P   G   ++QG++E SNV+ V E++++I+ QRA
Sbjct: 180 NPAGLHSMGDNLYIETDSSGQPVEGTPGLDGLGVLRQGFVELSNVELVVELTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           Y+ NSKVI  +DEM      ++
Sbjct: 240 YDSNSKVITTSDEMLQTTNNLK 261


>gi|85058013|ref|YP_453715.1| flagellar basal body rod protein FlgG [Sodalis glossinidius str.
           'morsitans']
 gi|84778533|dbj|BAE73310.1| flagellar basal-body rod protein FlgG [Sodalis glossinidius str.
           'morsitans']
          Length = 260

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++ MIA  G+ AQQTN+++I+NNIAN++T G+KR +A F D LYQ  +  G  ++S+++
Sbjct: 2   MRSLMIAKTGLEAQQTNMDVISNNIANVSTMGFKRQQAVFEDLLYQTVRQPG--AKSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++ QG + +TGN  D+A+ G G+ QV  PD T  YTR GS
Sbjct: 60  TTIPSGLQLGTGVRPVATTRIHLQGGLTNTGNPTDVAIEGSGFLQVLMPDGTNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              D  GQLVT+ G  + P ++IP     + +S+ G +       ++ Q VGQL +A FI
Sbjct: 120 LQRDQYGQLVTSSGYPIQPAVMIPNGASNLTISKDGLVSVALPGQTEPQEVGQLNLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+++G+NL   T  SG P+ + P   G   +KQ +LE SNV+  +E+  MI AQRA
Sbjct: 180 NDAGLQSLGENLYYETPSSGAPMENKPGMNGAGALKQQFLENSNVNVAQELITMIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   + ++
Sbjct: 240 YELNSKAISTSDQMLQRLAQL 260


>gi|20806699|ref|NP_621870.1| flagellar basal body and hook proteins [Thermoanaerobacter
           tengcongensis MB4]
 gi|20515153|gb|AAM23474.1| Flagellar basal body and hook proteins [Thermoanaerobacter
           tengcongensis MB4]
          Length = 266

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/268 (38%), Positives = 143/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAATGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +++G +  TGN LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGRPVNMQVGVGVRPSAIVKDFSEGNLYQTGNPLDLALDGPGFFAVLGPDDKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVP------GIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQL 174
           F +   G           P        ++ +            ++ V   +   Q V  L
Sbjct: 118 FKLSPDGNTFMLVTADGYPVLDDSNNPIVFDGNVNDITVSPLGVIQVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF N  GL ++G+NL   T  SG P   +  +     V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFTNPQGLLSVGNNLYEATEASGQPGTRDDFEGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|157165544|ref|YP_001467096.1| flagellar basal body rod protein FlgG [Campylobacter concisus
           13826]
 gi|112799947|gb|EAT97291.1| flagellar basal-body rod protein FlgG [Campylobacter concisus
           13826]
          Length = 262

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 166/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM A+QT +++ ++NIAN+NT GYK+ RAEFAD +YQ  + AG  + ++  
Sbjct: 2   MRSLYTAATGMIAEQTQIDVTSHNIANVNTYGYKKNRAEFADLMYQVMEYAG--TATSQT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +++  +++QG    T NNLD+ + G G+FQ++ PD T  YTR G+
Sbjct: 60  TTSPTGIEVGLGVRPTAINKIFSQGYFKETSNNLDMVIAGNGFFQIQLPDGTTAYTRNGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D+ G +V +DG  L+P I +P    +I +   G +  +    +D   +GQ+ +ANFI
Sbjct: 120 FKLDANGTIVNSDGYQLIPQITVPANATQISIGTDGTVSVLQAGETDMAQIGQIELANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++GDN   +TS SGD ++      G   ++QG++E SNV  V+E++++I+ QRA
Sbjct: 180 NPAGLHSMGDNNYLQTSASGDVVVGVAGLDGLGTIRQGFVEMSNVQLVEEMTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  +D M  ++  ++
Sbjct: 240 YEANSKAITTSDSMLEIVNGLK 261


>gi|307945666|ref|ZP_07661002.1| flagellar basal-body rod protein FlgG [Roseibium sp. TrichSKD4]
 gi|307771539|gb|EFO30764.1| flagellar basal-body rod protein FlgG [Roseibium sp. TrichSKD4]
          Length = 260

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 133/262 (50%), Positives = 177/262 (67%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQ+ N+E+I+NN+AN+ TTGYKR R +F D +YQ  + AGS + S   
Sbjct: 1   MKALHIAATGMKAQERNVEVISNNVANLRTTGYKRQRVDFQDLMYQNLRRAGSET-STAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ IGSGV++++   + +QG V  TG +LDLA+ G G+FQ+E PD T  YTR GS
Sbjct: 60  TIVPTGVQIGSGVKVAATSRIMSQGAVEQTGKDLDLAVRGEGFFQIEMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  G LVT DG T+VPGI IPE++R I +S  G + AV    +       + +A F+
Sbjct: 120 FERDPNGTLVTVDGYTVVPGITIPEDSRNITISTDGTVSAVDAGGATVNLGQ-IQLARFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IGDNL   T  SG   + NP   GF +V+Q +LE +NVDAV EI+++ISAQRA
Sbjct: 179 NKAGLEAIGDNLFYETEASGPAQVDNPGGNGFGNVQQYFLEMANVDAVTEIADLISAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNS+VI+AADEM S  + +R
Sbjct: 239 YEMNSRVIKAADEMYSTTSNLR 260


>gi|331007439|ref|ZP_08330616.1| Flagellar basal-body rod protein flgG [gamma proteobacterium
           IMCC1989]
 gi|330418746|gb|EGG93235.1| Flagellar basal-body rod protein flgG [gamma proteobacterium
           IMCC1989]
          Length = 261

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 156/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ   L  I+NN+AN +T G+KR R  F D LYQ ++  G   QS+    
Sbjct: 4   ALYVSKTGLSAQDRQLTSISNNLANASTIGFKRDRVNFEDLLYQIQRQPG--GQSSQNTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++ + +  +T G +  T   LDLA+  RG+FQ++ P     YTR G F+
Sbjct: 62  LPSGLQLGTGVRVVATQKQFTGGSLQVTEQPLDLAINNRGFFQIQMPSGETAYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S G +V A G  L P I IPE T  I +S+ G + A     +  Q +GQ+ I +F+N 
Sbjct: 122 LNSNGDIVNASGFLLEPSISIPENTNNITISQDGIVSASILGEATPQELGQITITDFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G N+ A+T+ SGDP      + G   + QG LE SNVD V+E+  MI+ QRAYE
Sbjct: 182 AGLQALGGNVFAQTAASGDPQTGTAGESGLGSIIQGSLENSNVDIVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+  AD+M   I++
Sbjct: 242 MNSKVVSTADQMLQFISQ 259


>gi|254478074|ref|ZP_05091457.1| conserved domain protein [Carboxydibrachium pacificum DSM 12653]
 gi|214035936|gb|EEB76627.1| conserved domain protein [Carboxydibrachium pacificum DSM 12653]
          Length = 266

 Score =  227 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/268 (38%), Positives = 144/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAATGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +++G +  TGN LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGRPVNMQVGVGVRPSAIVKDFSEGNLYQTGNPLDLALDGPGFFAVLGPDDKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVP------GIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQL 174
           F +   G  +        P        ++ +            ++ V   +   Q V  L
Sbjct: 118 FKLSPDGNTLMLVTADGYPVLDDSNNPIVFDGNVNDITVSPLGVIQVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF N  GL ++G+NL   T  SG P   +  +     V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFTNPQGLLSVGNNLYEATEASGQPGTRDDFEGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|309779449|ref|ZP_07674210.1| flagellar basal-body rod protein FlgG [Ralstonia sp. 5_7_47FAA]
 gi|308921690|gb|EFP67326.1| flagellar basal-body rod protein FlgG [Ralstonia sp. 5_7_47FAA]
          Length = 260

 Score =  227 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 171/261 (65%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  I+  GM AQQ+ L++I+NN+AN+NTTG+KR+RA F D LYQ  +  G  +QS+ +
Sbjct: 2   IRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLLYQNVREPG--AQSSQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +I +   ++TQG +  TGN+ D+A+ G G+FQV+ PD T+ YTR GS
Sbjct: 60  TTLPSGMQIGTGTRIVATERLHTQGNLQQTGNSTDVAINGNGFFQVQMPDGTLAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I+++GQLVT+ G  + P + +P+    + + + G +   T    +   VG   +ANFI
Sbjct: 120 FQINAQGQLVTSSGYPVQPAVTVPQNATSLTIGKDGVVTVTTPGTVNNTQVGTFQLANFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGLR++G+NL A T  SG   ++NP   G   + Q Y+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLRSMGENLYAETEASGTANLANPGSNGVGALNQNYVETSNVNVVEEMVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK ++ +D+M   ++++
Sbjct: 240 YEINSKSVQTSDQMLEKLSQL 260


>gi|107023951|ref|YP_622278.1| flagellar basal body rod protein FlgG [Burkholderia cenocepacia AU
           1054]
 gi|105894140|gb|ABF77305.1| Flagellar basal-body rod FlgG [Burkholderia cenocepacia AU 1054]
          Length = 262

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAAAGM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAAAGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+  + + + + G +      +S+   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVLPAITVPQNAQSLTIGKDGVVSVTQPGSSNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PTGLEAKGENLFAETTSSGAPNVSQPGLNGAGVLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|256751339|ref|ZP_05492218.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256749721|gb|EEU62746.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 266

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 102/268 (38%), Positives = 144/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAASGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV++S++   +T G +  T N LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGKPVNMQVGVGVRLSAIVKDFTGGSLQQTDNPLDLALDGEGFFAVLGPDGKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSR------SGQILAVTGKNSDFQPVGQL 174
           F +   G  +        P +           +          +++V   +   Q V  L
Sbjct: 118 FKLSPNGNNLMLVTADGYPVLDDSGNPIVFDSTEKDISVSPMGVISVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G NL   T  SG P   +  +     V QG+LE SN+  VKE+ +M
Sbjct: 178 GIYNFVNTQGLLSVGSNLYEPTEASGQPGTRDDFEGRMGKVMQGFLETSNIQIVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|124268252|ref|YP_001022256.1| flagellar basal body and hook protein [Methylibium petroleiphilum
           PM1]
 gi|124261027|gb|ABM96021.1| flagellar basal body and hook protein [Methylibium petroleiphilum
           PM1]
          Length = 260

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 101/261 (38%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  I+  GM AQQT L+ I++N+AN  T GYKR+ A F D +YQ  +  G  + S+++
Sbjct: 2   MRSLWISKTGMEAQQTQLDHISHNLANSATNGYKRSHAVFEDLMYQTIRQPG--ANSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G G +  +    ++QG +  + N LDLA+ G+G+FQ++ PD T  YTR G+
Sbjct: 60  TQLPTGLQLGLGTRAVATSRQFSQGSLQQSTNPLDLAVKGQGFFQIQLPDGTTGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F + ++GQLVT +G  + PGI IP   + + +   G +       +  Q VGQ+ +A+F+
Sbjct: 120 FQVSAQGQLVTNNGYVVQPGITIPANAQNVTIGADGNVSVTLPGQAAAQTVGQIQLASFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G+NL   T+ SG P    PD  G   + QG++E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLEPRGENLYTETAASGTPNAGAPDSNGLGAIAQGFVEGSNVNVVEELVAMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I+ +D+M   + ++
Sbjct: 240 YELNSKAIQTSDQMLQKLAQL 260


>gi|304397206|ref|ZP_07379085.1| flagellar basal-body rod protein FlgG [Pantoea sp. aB]
 gi|308186395|ref|YP_003930526.1| Flagellar basal-body rod protein flgG [Pantoea vagans C9-1]
 gi|304355355|gb|EFM19723.1| flagellar basal-body rod protein FlgG [Pantoea sp. aB]
 gi|308056905|gb|ADO09077.1| Flagellar basal-body rod protein flgG [Pantoea vagans C9-1]
          Length = 260

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 165/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQ N+++IANN+AN++T G+KR+RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQMNMDVIANNLANVSTNGFKRSRAVFEDLMYQTMRQPG--TQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  T N+ D+A+ G+G+FQ++ PD T  YTR G+
Sbjct: 60  TTLPSGLQIGTGVRPVTTERLHTQGNLSQTSNSKDIAINGQGYFQIQMPDGTSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT  G  + PGI IP     I VSR G +       +    VGQL ++ F+
Sbjct: 120 FQVDQNGQLVTNSGFPVQPGITIPANATSITVSRDGVVSVTQQGQAQAAQVGQLTLSTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG P  S P   G   + QGY E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLDSVGENLYKETQASGAPTDSTPGQNGAGLLYQGYTETSNVNVAEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + +T++
Sbjct: 240 YEINSKAISTSDQMLAKLTQL 260


>gi|170722889|ref|YP_001750577.1| flagellar basal body rod protein FlgG [Pseudomonas putida W619]
 gi|169760892|gb|ACA74208.1| flagellar basal-body rod protein FlgG [Pseudomonas putida W619]
          Length = 261

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 166/258 (64%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +  G +  T N LD+A+ GRG+FQV  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKNFQTGSLQTTENPLDMAVNGRGFFQVLQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+VTA+G  L P +V+P + +   V + G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LNSDGQIVTANGFALEPAVVVPNDAQTFTVGQDGTVSITTAGNPAAQVIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IGDNL   T+ SG P +  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAIGDNLFLETAASGAPQVGTPGLNGFGTTLQQTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|149201611|ref|ZP_01878585.1| Flagellar distal rod protein [Roseovarius sp. TM1035]
 gi|149144659|gb|EDM32688.1| Flagellar distal rod protein [Roseovarius sp. TM1035]
          Length = 262

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 108/257 (42%), Positives = 159/257 (61%), Gaps = 2/257 (0%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
             +A  G++AQQ  +++I+NN+AN+NTTG+KR RA F   LYQ  + AG+ +  A +   
Sbjct: 6   MHVAKTGLNAQQARIQVISNNLANVNTTGFKRDRANFETLLYQTLRPAGAQTSEATEQTA 65

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
           P   ++G+GV++ S   +YTQG +  T N LDLA+ G+G+FQV  PD  + YTR G+F+ 
Sbjct: 66  PT--TLGTGVRLVSTEKMYTQGSLTTTDNALDLAIDGKGFFQVLMPDGRIGYTRNGTFSQ 123

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
           ++ G L T+ G  + P I IP E   I +SR G I        + + VGQL +A F N  
Sbjct: 124 NADGVLTTSSGYVVQPEIQIPPEATSISISRDGIISVTLPDAVEAEEVGQLTLAQFANPR 183

Query: 184 GLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEM 243
           GL  +G+  +  ++ SG P++ NP + G   + QG LE SNV+ V+E+ EMI AQRAYE+
Sbjct: 184 GLEPVGETFVVESTASGAPVVGNPLEDGMGDLVQGALETSNVNVVQELVEMIEAQRAYEI 243

Query: 244 NSKVIEAADEMSSLITK 260
           NS+ I A+DEM S +  
Sbjct: 244 NSRSISASDEMMSYLAN 260


>gi|167038784|ref|YP_001661769.1| hypothetical protein Teth514_0111 [Thermoanaerobacter sp. X514]
 gi|300913631|ref|ZP_07130948.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X561]
 gi|307723354|ref|YP_003903105.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X513]
 gi|166853024|gb|ABY91433.1| protein of unknown function DUF1078 domain protein
           [Thermoanaerobacter sp. X514]
 gi|300890316|gb|EFK85461.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X561]
 gi|307580415|gb|ADN53814.1| fagellar hook-basal body protein [Thermoanaerobacter sp. X513]
          Length = 266

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 102/268 (38%), Positives = 144/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSAASGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +T+G +  T N LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGKPVNMQVGVGVRPSAIVKDFTEGSLQQTENPLDLALDGEGFFAVLGPDGKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSR------SGQILAVTGKNSDFQPVGQL 174
           F +   G  +        P +           +          +++V   +   Q V  L
Sbjct: 118 FKLSPNGNNLMLVTADGYPVLDDSGNPIVFDSTEKDISVSPMGVISVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G NL   T  SG P   +  +     V QG+LE SN+  VKE+ +M
Sbjct: 178 GIYNFVNTQGLLSVGSNLYEPTEASGQPGTRDDFEGRMGKVMQGFLETSNIQIVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|326796595|ref|YP_004314415.1| flagellar basal-body rod protein FlgG [Marinomonas mediterranea
           MMB-1]
 gi|326547359|gb|ADZ92579.1| flagellar basal-body rod protein FlgG [Marinomonas mediterranea
           MMB-1]
          Length = 261

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A   A  G++A    L +I+NN+AN++TTG+K+ RA F + +YQ  K  G    SA    
Sbjct: 4   ALWTAKTGLTAMDRQLSVISNNLANVSTTGFKKERAVFENLMYQTLKSPG--GLSAQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ IG+GV+++ ++  + +G+   T  NLD+A+ G G+FQ+   D T  YTR GSF 
Sbjct: 62  LPSGLQIGAGVRVTGMQKNFEEGDYNVTDRNLDVAIQGAGFFQITRSDGTTAYTRDGSFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+GQ+V + GN L P I    +  +I +   G +  +    +D + +G + IANFIN 
Sbjct: 122 LNSEGQMVDSSGNLLDPQISFDSDVVDITIGDDGTVSVLRAGETDQEEIGSITIANFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   TS SG PI+  P + G   + QG LEASNV++V+E+  MI+ QRAYE
Sbjct: 182 AGLYFLGGNLYEETSASGAPIVGVPGEEGLGELGQGMLEASNVNSVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD M   +T+
Sbjct: 242 MNSKVISTADGMLGFVTQ 259


>gi|300722680|ref|YP_003711970.1| flagellar basal-body rod cell-distal protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629187|emb|CBJ89783.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Xenorhabdus nematophila ATCC 19061]
          Length = 260

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 167/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+  QQTN+++IANN+AN++T+G+KR R    + +YQ E+  G  + S+++
Sbjct: 2   IRSLWIAKTGLDVQQTNMDVIANNLANVSTSGFKRQRVVSEELIYQTERQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +  +   +++QG +  T N  D+A+ G+G+FQ++ PD T  YTR GS
Sbjct: 60  TNLPSGLQIGTGARPVATERLHSQGNLAQTNNTKDVAIKGQGFFQIQMPDGTTGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  +VP I+IP+   +I ++R G I       +  Q VGQL +  FI
Sbjct: 120 FQVDQNGQLVTAGGFQVVPAIIIPDNATKIGIARDGIISVNVQGQNAPQQVGQLTLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL +IG+NL   T+ SG P+ + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NESGLESIGENLYLETNSSGVPVENAPGINGTGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T++
Sbjct: 240 YEINSKAVSTSDQMLQKLTQL 260


>gi|82544456|ref|YP_408403.1| flagellar basal body rod protein FlgG [Shigella boydii Sb227]
 gi|81245867|gb|ABB66575.1| cell-distal portion of basal-body rod [Shigella boydii Sb227]
 gi|320186975|gb|EFW61688.1| Flagellar basal-body rod protein FlgG [Shigella flexneri CDC
           796-83]
 gi|332094081|gb|EGI99133.1| flagellar basal-body rod protein FlgG [Shigella boydii 3594-74]
          Length = 260

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 108/261 (41%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMQQKLTQL 260


>gi|217076897|ref|YP_002334613.1| flagellar basal-body rod protein FlgG [Thermosipho africanus
           TCF52B]
 gi|217036750|gb|ACJ75272.1| flagellar basal-body rod protein FlgG [Thermosipho africanus
           TCF52B]
          Length = 261

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 163/262 (62%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +     AA GM AQQ  L+ ++NNIAN++T GYK+ ++EF D LY   K AG  + +A  
Sbjct: 2   INGLYTAATGMWAQQFKLDTLSNNIANVDTAGYKKVKSEFQDLLYDYSKNAG--AATAQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           ++ P G+ +G G ++S+   ++TQG +  TGN+LDLA+ G G+FQ++  D  + YTR G 
Sbjct: 60  SLHPTGLYVGHGTKLSATTRIFTQGNLERTGNSLDLAISGDGFFQIQLQDGRIAYTRDGQ 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  G+++T++GN L P IV+P+    + +S  G + A     +  Q +G + +  FI
Sbjct: 120 FKIDGNGRIITSNGNLLSPNIVVPQNAVSLSISPDGIVTAELQDGT-LQNLGTITLVRFI 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL+ IGDNL   T  SG P+       GF  + QGY+E SNVD VKE+ +MISA RA
Sbjct: 179 NPSGLKAIGDNLFLETPASGTPVEGTAGQDGFGSILQGYVEKSNVDIVKEMVDMISAMRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NS+ I+ ADEM    + M+
Sbjct: 239 YELNSRTIQTADEMLRTASSMK 260


>gi|219684180|ref|ZP_03539124.1| flagellar basal-body rod protein FlgG [Borrelia garinii PBr]
 gi|219672169|gb|EED29222.1| flagellar basal-body rod protein FlgG [Borrelia garinii PBr]
          Length = 265

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 106/264 (40%), Positives = 162/264 (61%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILMPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE  +    +S  G +   T  +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIQNSITISEQGIVSVKTDNSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEITGIPGSEGMGILRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|186477699|ref|YP_001859169.1| flagellar basal body rod protein FlgG [Burkholderia phymatum
           STM815]
 gi|184194158|gb|ACC72123.1| flagellar basal-body rod protein FlgG [Burkholderia phymatum
           STM815]
          Length = 262

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 164/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  ++ I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDTISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +S+GQLVT+ G  ++P I IP+    + +   G +   T  ++    +G L IA FIN
Sbjct: 121 QTNSQGQLVTSSGYQVLPAITIPQNATSLTIGSDGVVSVTTAGSTATTQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PTGLDAKGENLFAETTSSGTPNVATPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|83944162|ref|ZP_00956618.1| flagellar basal-body rod protein FlgG [Sulfitobacter sp. EE-36]
 gi|83845029|gb|EAP82910.1| flagellar basal-body rod protein FlgG [Sulfitobacter sp. EE-36]
          Length = 261

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 178/262 (67%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQQTN+++IANNIAN NTTG+K  RA F D +YQ+   AGS + S + 
Sbjct: 1   MKALGIAATGMLAQQTNVDVIANNIANANTTGFKSGRAAFQDLVYQSFASAGSLT-SEEG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G  IG GVQ + V     QG ++ T N LDLA+ GRG+F V  PD T  +TR G+
Sbjct: 60  TARPVGTDIGLGVQAAGVIRHNIQGGLIQTENQLDLAIEGRGYFTVNRPDGTQAFTRDGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F + ++GQLVT +G  + P I++PE TR++++++ G ++A    + +   +GQL  A F+
Sbjct: 120 FQLSAEGQLVTLNGYEVEPAIIVPELTRQVEINQEGVVMAYVENDPEPVELGQLNFATFL 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL+ +T+ SG+P+ + P   G    +QGYLE SNV+ +++I+++ISAQRA
Sbjct: 180 NEAGLKPVGDNLMEQTAASGEPVQNVPGTPGVGITRQGYLEQSNVNIIQQITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK IE AD++ +   +++
Sbjct: 240 YEMNSKAIETADQIMTTTNQIK 261


>gi|78067835|ref|YP_370604.1| flagellar basal body rod protein FlgG [Burkholderia sp. 383]
 gi|77968580|gb|ABB09960.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 262

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP+    + + + G +      +++   +G L +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVLPAITIPQNATSLTIGKDGVVTVTQAGSTNSVQIGSLQVATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL + T+ SG P +S P   G   + Q Y+E+SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEARGENLFSETTSSGAPNVSQPGLNGAGTLSQNYVESSNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|78221652|ref|YP_383399.1| flagellar basal body rod protein FlgG [Geobacter metallireducens
           GS-15]
 gi|78192907|gb|ABB30674.1| Flagellar basal-body rod FlgG [Geobacter metallireducens GS-15]
          Length = 262

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 161/262 (61%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQTN++++ANN+AN+NT G+K++RA+F D +YQ  K  GSPS   + 
Sbjct: 2   IRALWTAASGMQAQQTNIDVVANNLANVNTAGFKKSRADFQDLMYQNMKTTGSPS--TNT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP GI IG G ++++V  ++T G +  TGN LD+A+ G G++Q++ PD T  YTR+G+
Sbjct: 60  TQVPSGIQIGLGAKLAAVTKIFTIGNINQTGNELDMAIEGDGFYQIQMPDGTTTYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS+G++VT+DG  L+P IVIP     I +   G +            VG + +A F 
Sbjct: 120 FKRDSQGRVVTSDGYPLIPEIVIPNNATAINIGNDGTVSVSQAGQKSPTNVGNIQLAMFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL  IG NL   +  SG+     P   G     QG+LE SNV  ++E+  MI+ QRA
Sbjct: 180 NPSGLLAIGKNLFQESDSSGNATTGTPGQNGLGTTAQGFLEMSNVSVMEEMVNMITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK ++ ADEM      ++
Sbjct: 240 YEVNSKAVQTADEMLQTANSLK 261


>gi|219685570|ref|ZP_03540386.1| flagellar basal-body rod protein FlgG [Borrelia garinii Far04]
 gi|219672848|gb|EED29871.1| flagellar basal-body rod protein FlgG [Borrelia garinii Far04]
          Length = 265

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 104/264 (39%), Positives = 161/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  P+ T  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPNGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE  +    +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIQNSITISEQGIVSVKIDNSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++QG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEITGIPGSEGMGILRQGILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|77463650|ref|YP_353154.1| flagellar distal rod protein [Rhodobacter sphaeroides 2.4.1]
 gi|126462482|ref|YP_001043596.1| flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17029]
 gi|221639493|ref|YP_002525755.1| Flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides
           KD131]
 gi|332558506|ref|ZP_08412828.1| FlgG [Rhodobacter sphaeroides WS8N]
 gi|11095160|gb|AAG29749.1|AF205139_1 flagellar distal rod protein [Rhodobacter sphaeroides]
 gi|77388068|gb|ABA79253.1| Flagellar distal rod protein [Rhodobacter sphaeroides 2.4.1]
 gi|126104146|gb|ABN76824.1| flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17029]
 gi|221160274|gb|ACM01254.1| Flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides
           KD131]
 gi|332276218|gb|EGJ21533.1| FlgG [Rhodobacter sphaeroides WS8N]
          Length = 262

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 160/259 (61%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            A  +A+ G++AQQT +++I+NN+AN+NTTG+KR RA F   LYQ  K  G+ +  A   
Sbjct: 4   NAMHVASTGLNAQQTRMQVISNNLANVNTTGFKRDRANFESLLYQTWKPGGAQTSEATAM 63

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P    +G+GV++ S   +YTQG + +T N LDLA+ G G+FQV  PD  + YTR G+F
Sbjct: 64  TSPSA--VGTGVRVVSTEKLYTQGSLANTDNALDLAIDGPGFFQVLMPDGRMGYTRNGTF 121

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           + +++G + T  G  + P I IPE    + +S  G +  +    ++ Q VGQ+ +A F N
Sbjct: 122 SQNAEGTITTPSGYVVQPEIQIPEGAVSVTISSDGIVSVLMPDETEAQEVGQMTLATFAN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ +G+     T  SG+ +I NP + GF  + QG LEASNV+ V+E+ +MI  QRAY
Sbjct: 182 PRGLQPVGETFAVETGASGEAVIGNPVEPGFGKLVQGSLEASNVNVVQELVDMIETQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           E+NSK I A+DEM   ++ 
Sbjct: 242 EVNSKSISASDEMMQYLSN 260


>gi|203284668|ref|YP_002222408.1| flagellar basal-body rod protein [Borrelia duttonii Ly]
 gi|201084111|gb|ACH93702.1| flagellar basal-body rod protein [Borrelia duttonii Ly]
          Length = 265

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 108/264 (40%), Positives = 157/264 (59%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   +A+GM AQQ N++ IANN++N+NT G+K+ RAEF D +YQ ++ AG+P  + + 
Sbjct: 2   MRALWTSASGMKAQQYNVDTIANNLSNVNTIGFKKIRAEFEDLIYQTQRRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G  +G G ++S+   ++ QG +  T  N D+A+ G G+++V   D T  YTR GS
Sbjct: 60  TVTPLGNQVGHGTKVSATHRLFEQGNLQVTNLNTDVAIEGDGFYKVLLSDGTYGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV--SRSGQILAVTGKNSDFQPVGQLLIAN 178
           F ID+ G LVT  G  L+P I  PEE  +  +  S+ G I     +  +   +GQ+ IA 
Sbjct: 120 FKIDANGNLVTNQGYILLPEISFPEEYIKNSIAISQEGIISVKVNEGLEPIELGQIEIAR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG+N+   T  SG+ I   P   G   +KQG LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLNAIGNNIFKETIGSGEEISGIPGSNGMGKLKQGMLEMSNVAIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I  +D M  +   ++
Sbjct: 240 RAYEINSKAIHTSDNMLGIANNLK 263


>gi|194432508|ref|ZP_03064795.1| flagellar basal-body rod protein FlgG [Shigella dysenteriae 1012]
 gi|194419395|gb|EDX35477.1| flagellar basal-body rod protein FlgG [Shigella dysenteriae 1012]
 gi|332092914|gb|EGI97982.1| flagellar basal-body rod protein FlgG [Shigella dysenteriae 155-74]
          Length = 260

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 158/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+G +  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGGRSVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSISIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|134297196|ref|YP_001120931.1| flagellar basal body rod protein FlgG [Burkholderia vietnamiensis
           G4]
 gi|134140353|gb|ABO56096.1| flagellar basal-body rod protein FlgG [Burkholderia vietnamiensis
           G4]
          Length = 262

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+  + + + + G +      +++   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQILPAITVPQNAQSLTIGKDGVVSVTQPGSNNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVSQPGLNGAGVLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK +  +D+M   +T+M+
Sbjct: 241 EINSKAVTTSDQMLQTVTQMK 261


>gi|323697472|ref|ZP_08109384.1| flagellar basal-body rod protein FlgG [Desulfovibrio sp. ND132]
 gi|323457404|gb|EGB13269.1| flagellar basal-body rod protein FlgG [Desulfovibrio desulfuricans
           ND132]
          Length = 260

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 102/262 (38%), Positives = 151/262 (57%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   +A GM A QT ++ ++NN+AN++TT +K++RAEF D +YQ  K+AG   ++AD 
Sbjct: 2   MRSLWTSATGMIAMQTQIDTLSNNLANVSTTAFKKSRAEFEDLMYQTLKIAG--GENADG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G+ IG GV+  SV   +TQG+  +TGN LD+A+ G G+FQV       +YTR GS
Sbjct: 60  TQTPVGMQIGMGVRPVSVHKFFTQGDFQNTGNPLDMAIEGEGFFQVMVN-GDEVYTRDGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS G++VTA G  L P   +P ET  I +S +G I A+    +       + +  F 
Sbjct: 119 FELDSDGRVVTAGGYPLQPEFTVPPETSSISISETGTISALDKDGT-VLATADIDLYRFQ 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G N    +  SG  +   P D  +  + QG+LE SNV+ V E+  +I  QRA
Sbjct: 178 NPAGLIATGRNFYRESDASGVAVAGTPGDDNYGTIAQGFLEGSNVEMVDEMVGLIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           +E+NSK I  +D M      ++
Sbjct: 238 FEINSKAITTSDGMLQTAINIK 259


>gi|317047693|ref|YP_004115341.1| flagellar basal-body rod protein FlgG [Pantoea sp. At-9b]
 gi|316949310|gb|ADU68785.1| flagellar basal-body rod protein FlgG [Pantoea sp. At-9b]
          Length = 260

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTN+++IANN+AN++T G+KR+RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRSRAVFEDLMYQTVRQPG--TQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  T N+ DLA+ G+G+F+V+ PD T  YTR GS
Sbjct: 60  TTLPSGMQIGTGVRPVTTERLHTQGNLSQTSNSKDLAINGQGYFEVQMPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT  G T+ PGI IP     I VSR G +       ++   VGQL ++ F+
Sbjct: 120 FQVDQNGQLVTNSGYTVQPGITIPANATSITVSRDGIVSVTQQGQTNPTQVGQLTLSTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T  SG    S P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLDSLGENLYQETQASGAATQSTPGQNGAGLLYQGYVETSNVNVAEELVSMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M + +T++
Sbjct: 240 YEINSKAVSTSDQMLAKLTQL 260


>gi|254488392|ref|ZP_05101597.1| flagellar basal-body rod protein FlgG [Roseobacter sp. GAI101]
 gi|214045261|gb|EEB85899.1| flagellar basal-body rod protein FlgG [Roseobacter sp. GAI101]
          Length = 261

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 119/262 (45%), Positives = 165/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN++TTGY   RAEF+D  YQ    AGS S ++D 
Sbjct: 1   MRALKIAATGMSAQQMRVETISNNLANMSTTGYNARRAEFSDLHYQQLARAGSVS-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V     QG +  TG +LDLA+ G+G+ +V  P     YTR G 
Sbjct: 60  TVLPTGVQLGLGVRPAAVSMQLAQGSLSVTGGDLDLAIEGKGFLEVTLPSGQAAYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                +G +VT+DG  + P IVIPE+ R I ++ SG++ A    N   Q +GQ  ++ F 
Sbjct: 120 LKRTGEGLIVTSDGFPVAPEIVIPEDARSISINASGEVFAYFDGNIAAQLLGQFTMSGFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG  +++ P   G   ++QGYLE S+VDAV+EI+E+I AQR 
Sbjct: 180 NAKGLEAIGGNLFVETEASGAALVATPGLNGLGTLRQGYLEDSSVDAVREITELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI AAD+M    T++R
Sbjct: 240 YEMNAKVISAADQMMGATTQIR 261


>gi|222824019|ref|YP_002575593.1| flagellar distal rod protein FlgG [Campylobacter lari RM2100]
 gi|222539241|gb|ACM64342.1| flagellar distal rod protein FlgG [Campylobacter lari RM2100]
          Length = 264

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 103/264 (39%), Positives = 169/264 (64%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA+GM +QQT +++ +NNI+N+NT GYK++RAEFAD +YQ  K AG  + ++  
Sbjct: 2   LRSLYTAASGMVSQQTQIDVTSNNISNVNTVGYKKSRAEFADLMYQTMKYAG--TSTSST 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVG-RGWFQVETPDKTVMYTRA 118
              P GI +G G +++++  ++++G +  T     D+A+ G  G+FQ++ PD T+ YTR 
Sbjct: 60  TKHPSGIEVGLGSRVTAISKIFSEGSLKQTSTAGLDMAIAGNNGFFQIQMPDGTIAYTRN 119

Query: 119 GSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           G F  D++G +V +DG  L+P + IPE+   I V+  G I  +   N+    +GQ+ + N
Sbjct: 120 GQFTKDAEGNIVNSDGYRLLPEMTIPEDATAINVASDGTISVMQPGNTAETQIGQIELVN 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           FIN AGL  +GDNLL  T  SG PI     + GF+ +K G++E SNV  V+E++++I+ Q
Sbjct: 180 FINPAGLHALGDNLLVETDASGAPIAGIAGENGFSPIKHGFVELSNVQLVEEMTDLITGQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE  SK I  +D+M  ++ +++
Sbjct: 240 RAYEAGSKAITTSDDMLGIVNQLK 263


>gi|261856358|ref|YP_003263641.1| flagellar basal-body rod protein FlgG [Halothiobacillus
           neapolitanus c2]
 gi|261836827|gb|ACX96594.1| flagellar basal-body rod protein FlgG [Halothiobacillus
           neapolitanus c2]
          Length = 262

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 114/258 (44%), Positives = 163/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  IA  G+ AQQT + +I+NN+AN+NTTG+K+ RA F D +YQ  +  G  + +  +  
Sbjct: 5   ALWIAKTGLDAQQTRMSVISNNLANVNTTGFKQDRAVFEDLIYQNYRQVG--AANTQQNE 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           VP G++IG+GV++ +    +TQG +V T N LDLA+ GRG+FQV  PD +V YTR GSF+
Sbjct: 63  VPTGLNIGTGVKVVATEKNHTQGNLVTTNNALDLAINGRGFFQVLQPDGSVAYTRDGSFS 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +DS GQ+VTA+G  L P I +P+  + I V + G +       +    VG + +A+F+N 
Sbjct: 123 LDSNGQVVTANGYPLQPAITVPQGAQSITVGKDGTVSVQLAGQAQPSQVGTIDLADFVNP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IGDNL   +  SG P  S P   G  +++QG LE+SNV+ V+E+  MI  QRAYE
Sbjct: 183 AGLQPIGDNLFLESGSSGAPQTSTPGLNGVGNMQQGMLESSNVNVVEELVSMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSK I A   M   + +
Sbjct: 243 MNSKAISATSSMLQTLNQ 260


>gi|190574261|ref|YP_001972106.1| flagellar basal body rod protein FlgG [Stenotrophomonas maltophilia
           K279a]
 gi|194365678|ref|YP_002028288.1| flagellar basal body rod protein FlgG [Stenotrophomonas maltophilia
           R551-3]
 gi|190012183|emb|CAQ45806.1| putative flagellar basal-body rod protein [Stenotrophomonas
           maltophilia K279a]
 gi|194348482|gb|ACF51605.1| flagellar basal-body rod protein FlgG [Stenotrophomonas maltophilia
           R551-3]
          Length = 261

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 102/259 (39%), Positives = 146/259 (56%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  IA  G+ AQQ  + +++NN+AN NTTG+K+ RA F D LYQ  +  G    S+ + 
Sbjct: 3   QALWIAKTGLDAQQMRMSVVSNNLANTNTTGFKQDRASFEDLLYQQVRQPG--GSSSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ +    + QG    TG  LD+ + GRG+F+V+ PD +  YTR GSF
Sbjct: 61  QLPTGLQLGTGVRVVATAKNFEQGGQQQTGRALDVMVNGRGFFEVQMPDGSSAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+   +LVT  G  + PGI IPE  + + +   G I       +    VG L + +F+N
Sbjct: 121 KINQDSELVTNSGYPVQPGIQIPEGAQSVTIGTDGTISVKMADGAASVEVGALTLTDFVN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+  G+NL   T+ SG     NP   G   V QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLQARGENLFLETTASGPAQNGNPGLNGLGTVVQGALEGSNVNVVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDSMLGYLNN 259


>gi|150020364|ref|YP_001305718.1| flagellar basal-body rod protein FlgG [Thermosipho melanesiensis
           BI429]
 gi|149792885|gb|ABR30333.1| flagellar basal-body rod protein FlgG [Thermosipho melanesiensis
           BI429]
          Length = 261

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 162/262 (61%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +     AA GM AQQ  L+ ++NNIAN++T GYK+ + EF D LY   K AG  + +A  
Sbjct: 2   INGLYTAATGMWAQQFKLDTLSNNIANVDTAGYKKVKTEFQDLLYDYSKNAG--AATAQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           ++ P G+ +G G ++S+   ++TQG +  TGN+LD+A+ G G+FQ++  D  + YTR G 
Sbjct: 60  SIHPTGLYVGHGTKLSATTRIFTQGNLERTGNSLDIAISGDGFFQIQLQDGRIAYTRDGQ 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  G+++T++GN L P IV+P+    I +S  G + A     +  Q +G + +  FI
Sbjct: 120 FKIDGNGRIITSNGNLLSPNIVVPQNAVAINISPDGIVTAELQDGT-LQNLGTITLVRFI 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL+ IGDNL   T  SG P+       GF  + QGY+E SNVD VKE+ +MISA RA
Sbjct: 179 NPSGLKAIGDNLYLETPASGAPVEGTAGQDGFGSILQGYVEKSNVDIVKEMVDMISAMRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NS+ ++ ADEM    + M+
Sbjct: 239 YELNSRTVQTADEMLRTASNMK 260


>gi|254500847|ref|ZP_05112998.1| flagellar basal-body rod protein FlgG [Labrenzia alexandrii DFL-11]
 gi|222436918|gb|EEE43597.1| flagellar basal-body rod protein FlgG [Labrenzia alexandrii DFL-11]
          Length = 260

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 175/262 (66%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQ+ N+E+I+NN+AN+ TTGYK+ RA+F D LYQ  +  G+ + S D 
Sbjct: 1   MRALYTAATGMKAQEYNVEVISNNVANMRTTGYKKQRADFQDLLYQNLRRMGTET-SDDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP GI IG+GV+++S   V +QG + +TG  LD+A+ G G+FQ++ P     Y+R GS
Sbjct: 60  TIVPTGIQIGTGVKLASTGRVMSQGSMENTGKELDIAIRGEGFFQIQLPGGATGYSRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D  GQLVT DG  L P I IPE TR++ ++ SG++  V    +       + +A F+
Sbjct: 120 FERDQNGQLVTIDGYQLDPNITIPENTRDLTIAPSGKVQGVDEAGATVDLGQ-IQLARFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IGDNL   T  SG P   NP++ G+   +Q +LE +NVDAV EI+++ISAQRA
Sbjct: 179 NKAGLEAIGDNLFLETDASGAPQTGNPNEDGYGSTQQFFLEMANVDAVTEIADLISAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+AAD+M S  T++R
Sbjct: 239 YEMNSKVIQAADQMYSTTTQIR 260


>gi|182412221|ref|YP_001817287.1| flagellar basal-body rod protein FlgG [Opitutus terrae PB90-1]
 gi|177839435|gb|ACB73687.1| flagellar basal-body rod protein FlgG [Opitutus terrae PB90-1]
          Length = 261

 Score =  225 bits (574), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 162/261 (62%), Gaps = 5/261 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +   AA GM AQQ NL  IANN+AN+NT G+KR++ EF D LYQ    A   + S    +
Sbjct: 4   SLYSAATGMEAQQLNLNTIANNLANVNTPGFKRSKIEFQDLLYQKPTRASG-TDSGGGNI 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           VP G+ +G+G ++++   V+TQG++  TG  LDLA+ G G+F+++ PD T  YTR GSF 
Sbjct: 63  VPTGLEVGNGSRVAATSKVFTQGQLTSTGEKLDLAIQGDGFFEIQRPDGTFAYTRDGSFK 122

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++++GQ+VT DG  +      IP  T  + +S +GQ+       +      +L +  F N
Sbjct: 123 LNAQGQVVTIDGLPVLSGFQAIPAGTEGVAISDNGQVTLTGANGTTT---FRLSVTRFAN 179

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GLR++G NL   T+ SG P I  P + G+  + QGY+E+SNV+ V+E+  +I AQRAY
Sbjct: 180 PSGLRSVGGNLYEETAASGTPEIGQPGEQGYGQIMQGYIESSNVNIVEEMVNLIVAQRAY 239

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NSK I+ +DEM   + +M+
Sbjct: 240 EINSKSIQTSDEMLQNVAQMK 260


>gi|83858806|ref|ZP_00952328.1| flagellar basal-body rod protein FlgG [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853629|gb|EAP91481.1| flagellar basal-body rod protein FlgG [Oceanicaulis alexandrii
           HTCC2633]
          Length = 261

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 121/262 (46%), Positives = 170/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQ   +E+I++N+AN+NT  +KR RAEF D LYQ     G+ S +A  
Sbjct: 1   MRALSTAATGMEAQSLAVEVISHNLANMNTIAFKRQRAEFEDLLYQTISQPGANSSNA-G 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV   SV  +  QG +  T N  D+A+ G+G+F+V+ PD    YTRAG+
Sbjct: 60  TIVPTGVQVGLGVNAGSVYRITEQGGMSETNNPYDVAISGQGYFRVQLPDGNDAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++   G++VTADG  ++PGIVIP E R++ ++  GQ+  +       Q VGQ  +A F 
Sbjct: 120 FSLSPNGEIVTADGYAVMPGIVIPAEARQVVINNQGQVQVLLDGQPQPQVVGQFELATFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNLL  ++ SG P +  P D GF  ++Q ++E SNVDAV EI+ +I AQRA
Sbjct: 180 NEAGLEQIGDNLLLESAASGAPNLGAPTDPGFGSLRQRFVEVSNVDAVTEITSLIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN++VI AADEM +  + +R
Sbjct: 240 YEMNARVITAADEMLATSSNLR 261


>gi|257457574|ref|ZP_05622741.1| flagellar basal-body rod protein FlgG [Treponema vincentii ATCC
           35580]
 gi|257444960|gb|EEV20036.1| flagellar basal-body rod protein FlgG [Treponema vincentii ATCC
           35580]
          Length = 264

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 103/263 (39%), Positives = 154/263 (58%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM++QQ N++ +ANN+AN+NT+G+K+ RAEF D LYQ  + AG+P  + +  
Sbjct: 3   RSLWTAATGMNSQQANIDTVANNLANVNTSGFKKQRAEFEDLLYQTIRAAGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           + P G+ +G G ++++ +  + QG +  TG + D+A+ G G+F+V   D T  YTR GSF
Sbjct: 61  ITPVGVEMGHGAKLAATQRNFEQGSLQQTGVSTDVAIAGEGFFRVLQYDGTYAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            ID+  QLVT++G   +P I+ PE      I +S+ G++    G+  D   VGQ+ +  F
Sbjct: 121 KIDADRQLVTSNGLRCLPEIIFPENYLPHTIAISQDGRVSVRVGEQDDPVEVGQIELYRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
            N  GL   G NL  +T  SG  I   P   GF   +  +LE SNV  V E+  MI AQR
Sbjct: 181 QNPVGLSAQGSNLFRQTPASGQAIAGRPGFNGFGKTEHKFLEMSNVSTVSEMVNMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE NSK I+ +D M      ++
Sbjct: 241 AYEFNSKAIQTSDNMLGTAVGLK 263


>gi|295678056|ref|YP_003606580.1| flagellar basal-body rod protein FlgG [Burkholderia sp. CCGE1002]
 gi|295437899|gb|ADG17069.1| flagellar basal-body rod protein FlgG [Burkholderia sp. CCGE1002]
          Length = 262

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 165/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV+ PD    YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGAGFFQVQMPDGQTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP     + +   G +      +S+ Q +G + +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPANATSLTIGSDGSVSITVAGSSNTQQLGTMQLATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL + G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDSKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|253702432|ref|YP_003023621.1| flagellar basal body rod protein FlgG [Geobacter sp. M21]
 gi|251777282|gb|ACT19863.1| flagellar basal-body rod protein FlgG [Geobacter sp. M21]
          Length = 262

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 105/262 (40%), Positives = 158/262 (60%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM AQQ N++++A+N+AN  TTG+K++RA+F D +YQ EK  G+P  + + 
Sbjct: 2   IRALWTAASGMQAQQLNIDVVAHNLANAATTGFKKSRADFQDLMYQTEKTTGAP--ATNA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+  +V  V+T G ++ TGN LDLA+ G G+ QV+  D +  YTRAG+
Sbjct: 60  TTIPTGIQVGLGVRPGAVTKVFTTGNIIATGNELDLAIQGDGFLQVQQSDGSTAYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              D +G++VT+DG  ++P ++IP     + V   G +       +    VG L +A+F 
Sbjct: 120 LKRDGQGRVVTSDGQPVIPEVLIPSNATRVTVGTDGTVSVQQAGQTAATTVGTLQLASFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   T  SG          G   ++QG+LE SNV  ++E+  MI  QRA
Sbjct: 180 NPAGLNAIGKNLFLPTDSSGAATTGTAGQNGLGTIEQGFLENSNVSIMEEMVSMIVGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I+A+DEM      ++
Sbjct: 240 YEINSKAIQASDEMLQQAAGLK 261


>gi|90415316|ref|ZP_01223250.1| flagellar basal-body rod protein FlgG (distal rod protein) [marine
           gamma proteobacterium HTCC2207]
 gi|90332639|gb|EAS47809.1| flagellar basal-body rod protein FlgG (distal rod protein) [marine
           gamma proteobacterium HTCC2207]
          Length = 261

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +  IA  G++AQQT + +I+NN+AN+NTTG+K+ RA F D LYQ    AG    +  +  
Sbjct: 4   SLWIAKTGLTAQQTRMSVISNNLANVNTTGFKKDRAVFEDLLYQNIVPAGGQVDAESET- 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P G+ +G+G ++ +   ++ QG ++ T N LDLA+ G G+F V+  D T+ Y+R GSF 
Sbjct: 63  -PTGLMLGTGTRVVATEKLHAQGNIITTENALDLAISGDGYFSVQQADGTIAYSRDGSFK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           + ++G LVTA G TL+P I +P+    + + R G +            +GQL ++ F+N 
Sbjct: 122 LSAEGNLVTAGGQTLLPAITVPQNAASLTIGRDGVVTVELSNGGGSSQIGQLQLSRFVNN 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL+ IG NL+ +T+ SGDP++  P   G   + QG LEASNV+ V+E+  MI  QRAYE
Sbjct: 182 SGLQPIGRNLMQQTNASGDPLVVLPGADGAGMLMQGALEASNVNVVEEMVNMIETQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK I AAD M   +  
Sbjct: 242 VNSKAISAADGMLRFLNN 259


>gi|259417939|ref|ZP_05741858.1| flagellar basal-body rod protein FlgG [Silicibacter sp. TrichCH4B]
 gi|259346845|gb|EEW58659.1| flagellar basal-body rod protein FlgG [Silicibacter sp. TrichCH4B]
          Length = 261

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 117/262 (44%), Positives = 163/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN+NTT Y   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQLRVETISNNLANMNTTAYNARRAEFADLHYQQISRAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V     QG +  TGN LD+A+ G G+F+V  P     YTR GS
Sbjct: 60  TVLPTGVQVGLGVRPAAVSVYLNQGALSQTGNELDVAIDGNGYFEVTLPSGETAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F   ++G +VT DG  + P I IPE+   I ++  G++ A      + + +GQL ++ F 
Sbjct: 120 FKRSAEGLIVTNDGYPVSPEITIPEDANSISINAEGEVYAYFNDTVEAELLGQLTLSGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL  +T  SG P  + P   G   ++Q YLE S+VDAV+EI+E+I AQR 
Sbjct: 180 NPKGLEAVGSNLFKQTEASGQPNTTEPGADGVGTLRQKYLEDSSVDAVREITELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI A D+M S  T++R
Sbjct: 240 YEMNSKVISAVDQMMSATTQVR 261


>gi|119477951|ref|ZP_01618051.1| Flagellar basal body rod protein [marine gamma proteobacterium
           HTCC2143]
 gi|119448864|gb|EAW30106.1| Flagellar basal body rod protein [marine gamma proteobacterium
           HTCC2143]
          Length = 261

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 154/259 (59%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  I+  G+SAQ T L  I+NN+AN  T GYKR    F D LYQ  +  G  +QS+   
Sbjct: 3   QALWISKTGLSAQDTRLATISNNLANAATVGYKRDSVVFEDLLYQIRRQPG--AQSSQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++   +  ++ G V  T   LDLA+VGRG+F++  PD T  Y+R G F
Sbjct: 61  QLPSGLQVGTGVRVIGTQKEFSDGSVQITEKPLDLAIVGRGFFEILMPDGTSAYSRNGQF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I++ G++V A G  L P I +P++ + + +S  G + A     +  Q +G + + NFIN
Sbjct: 121 QINADGEIVNARGLLLQPSITVPDDAQTVSISSDGIVEAQIAGQAAAQTLGNITVTNFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL++IG NL   T+ SG P    P   G   ++QG LE SNVD V+E+  MI+ QR Y
Sbjct: 181 PTGLQSIGSNLFIETAASGTPQQGEPGIDGLGRLEQGALENSNVDVVEELVSMITTQRTY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   I++
Sbjct: 241 EMNSKVISTADQMLQYISQ 259


>gi|313682110|ref|YP_004059848.1| flagellar basal-body rod protein flgg [Sulfuricurvum kujiense DSM
           16994]
 gi|313154970|gb|ADR33648.1| flagellar basal-body rod protein FlgG [Sulfuricurvum kujiense DSM
           16994]
          Length = 262

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 167/262 (63%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   ++ GM + QT ++  ANNIAN+NT GYK++RAEFAD +Y+    AG  + ++D 
Sbjct: 2   MQSLYTSSTGMLSMQTQIDTTANNIANVNTMGYKKSRAEFADLMYKVMTYAG--TSTSDT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P GI +G GV+ +S+  ++T+G +  T N+LDLA+ G+G+F++E P+ T +Y+R GS
Sbjct: 60  TKSPTGIEVGLGVRPTSINKIFTEGSLKQTDNSLDLAITGKGFFKLELPNGTEVYSRNGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID  G +V +DG  LVP +VIPE+   I +   G +       +    VGQ+ + +FI
Sbjct: 120 FKIDENGTIVNSDGYKLVPEVVIPEDATNISIGTDGIVSVTQSGQAQATQVGQISLTSFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  +GDNL   T  SG PI   P + G  +++QG++E SNV  V E++++I+ QRA
Sbjct: 180 NPAGLHAMGDNLFVETDSSGQPIEGTPGENGIGNIRQGFVELSNVQLVVELTDLITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           Y+ NSKVI  +DEM +    ++
Sbjct: 240 YDANSKVITTSDEMLATTNGLK 261


>gi|83955138|ref|ZP_00963794.1| flagellar basal-body rod protein FlgG [Sulfitobacter sp. NAS-14.1]
 gi|83840467|gb|EAP79640.1| flagellar basal-body rod protein FlgG [Sulfitobacter sp. NAS-14.1]
          Length = 261

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 177/262 (67%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQQTN+++IANNIAN NTTG+K  RA F D +YQ+   AGS + S + 
Sbjct: 1   MKALGIAATGMLAQQTNVDVIANNIANANTTGFKSGRAAFQDLVYQSFASAGSLT-SEEG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G  IG GVQ + V     QG ++ T N LDLA+ GRG+F V  PD T  +TR G+
Sbjct: 60  TARPVGTDIGLGVQAAGVIRHNIQGGLIQTENQLDLAIEGRGYFTVNRPDGTQAFTRDGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F + ++GQLVT +G  + P I++PE TR++++++ G ++A      +   +GQL  A F+
Sbjct: 120 FQLSAEGQLVTLNGYEVEPAIIVPELTRQVEINQEGVVMAYVENAPEPVELGQLNFATFL 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL+ +GDNL+ +T+ SG+P+ + P   G    +QGYLE SNV+ +++I+++ISAQRA
Sbjct: 180 NEAGLKPVGDNLMEQTAASGEPVQNVPGTPGVGITRQGYLEQSNVNIIQQITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK IE AD++ +   +++
Sbjct: 240 YEMNSKAIETADQIMTTTNQIK 261


>gi|304392506|ref|ZP_07374446.1| flagellar basal-body rod protein FlgG [Ahrensia sp. R2A130]
 gi|303295136|gb|EFL89496.1| flagellar basal-body rod protein FlgG [Ahrensia sp. R2A130]
          Length = 262

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 134/263 (50%), Positives = 189/263 (71%), Gaps = 2/263 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQ NL++IA+NIANINTTG+KR R EF D +Y  E++ G P+++   
Sbjct: 1   MRALSIAATGMQAQQKNLDVIAHNIANINTTGFKRGRVEFTDLIYDTERLNGIPNRANS- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A VPEG   G GV+ +SVRNV+ QG+V  TGN  DLAL G GWFQ+E      +Y R+G+
Sbjct: 60  ANVPEGAHFGLGVRTASVRNVHLQGQVAQTGNRFDLALTGNGWFQIENAAGETVYQRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN +  G+LVT DG  + PGI +P+ T +I ++ SG + A  G  ++ Q +GQL +A F 
Sbjct: 120 FNTNGAGELVTQDGLRVQPGITVPDNTTDIFINASGAVFARVGGAAEQQEIGQLSLATFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL  +GDNL A++  SG+P +  P D G+A ++QGYLE+SNV++VKEI+++I+AQR 
Sbjct: 180 NDVGLTPLGDNLFAQSDASGEPQVGTPGDPGYATIRQGYLESSNVESVKEITQLIAAQRG 239

Query: 241 YEMNSKVIEAADEMSSLIT-KMR 262
           YEMNSKVI+AAD+M+S+++  +R
Sbjct: 240 YEMNSKVIQAADDMASIVSRNLR 262


>gi|254445900|ref|ZP_05059376.1| flagellar basal-body rod protein FlgG [Verrucomicrobiae bacterium
           DG1235]
 gi|198260208|gb|EDY84516.1| flagellar basal-body rod protein FlgG [Verrucomicrobiae bacterium
           DG1235]
          Length = 260

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 107/260 (41%), Positives = 159/260 (61%), Gaps = 4/260 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +   AA+GM AQQTNL +I+NNIAN++TTG+K+++ EF D  YQ  K  G+ S      +
Sbjct: 4   SLYSAASGMEAQQTNLNVISNNIANVSTTGFKKSKVEFQDMFYQVPKSVGADS---GGNI 60

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P GI +G+G Q+ S   V+TQG+V  TG  LD+A+VG G+F+V  PD   +YTR G+F 
Sbjct: 61  LPTGIQVGTGTQVVSTSKVFTQGQVSQTGEQLDVAIVGDGFFRVTGPDNETLYTRDGAFK 120

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +   G++  + G T +     P  T ++ ++ +G +  +   +SD    GQL  A F N 
Sbjct: 121 VGPTGEVTNSQGMTAIDFAAPPAGTTKVVINDTGGVTYL-ADDSDVLGRGQLQTARFRNS 179

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL  +G NL   T  SG P + NP   G   ++QGYLE SNV+ V+E+  MI AQRAYE
Sbjct: 180 SGLLALGGNLFRETDASGAPTVGNPGADGSGTLQQGYLETSNVNIVEEMVNMILAQRAYE 239

Query: 243 MNSKVIEAADEMSSLITKMR 262
           +NSK I+ +D M   + +++
Sbjct: 240 INSKSIQTSDSMMQQVAQLK 259


>gi|254292905|ref|YP_003058928.1| flagellar basal body rod protein FlgG [Hirschia baltica ATCC 49814]
 gi|254041436|gb|ACT58231.1| flagellar basal-body rod protein FlgG [Hirschia baltica ATCC 49814]
          Length = 261

 Score =  225 bits (573), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 127/262 (48%), Positives = 171/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQ N+E+I+NNIAN+NTTGYKR RAEF D LY   +  G  S  A+ 
Sbjct: 1   MRALSTAATGMQAQQLNVEVISNNIANMNTTGYKRQRAEFQDLLYTNMEKMGVSSSDAN- 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ IG+GV+  SV  +  QG V  T N+ D+A+ G G+F V+ PD    YTRAG+
Sbjct: 60  TIVPTGVQIGTGVKAGSVYRITEQGPVQQTSNSYDVAMQGDGYFIVQLPDGRDAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+++  GQ+VT DG T+ PGI +PE+T  + ++  G + A T   +D   +G L +A F+
Sbjct: 120 FSVNGDGQIVTEDGYTVSPGINVPEDTLSVTINAQGTVTATTAGATDPTDLGALELARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IGDNLL  T  SG   +     +GF  + QG+LE SNV+AV EIS +I+AQRA
Sbjct: 180 NPAGLDAIGDNLLLETVASGAANVGQAGALGFGTILQGFLETSNVNAVTEISALINAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI A DEM    ++++
Sbjct: 240 YEMNSKVITATDEMLQTTSQLK 261


>gi|296534160|ref|ZP_06896654.1| flagellar basal-body rod protein FlgG [Roseomonas cervicalis ATCC
           49957]
 gi|296265515|gb|EFH11646.1| flagellar basal-body rod protein FlgG [Roseomonas cervicalis ATCC
           49957]
          Length = 262

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 124/262 (47%), Positives = 170/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  GM AQQTN+E+I+NNIAN++TT YKR RAEF D LY+  +  GS S S   
Sbjct: 1   MRSLNIAGTGMMAQQTNVEVISNNIANMSTTAYKRRRAEFQDLLYENLRRTGSQS-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G  +G GV+ +++  +  QG++  T N+ DLA+ G G+F V+ P     YTRAGS
Sbjct: 60  TVLPSGAQLGLGVRTAAIYRIGAQGDLSQTQNSFDLAIRGNGYFPVQMPTGETAYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +   G +VTADG  +  GIVIP   R++ ++ +G++L      +  Q VGQL +  F 
Sbjct: 120 FGLSDAGMIVTADGFQVGAGIVIPAGARDVTINATGEVLVKIDGQAALQNVGQLQLGTFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDN+   T  SG   + NP   G+  V QGYLE SNV+ V+EI+ +I+AQRA
Sbjct: 180 NEGGLEAIGDNMFLETPASGGVTLGNPGAAGYGQVLQGYLETSNVNVVQEITALITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI A+DEM S +++MR
Sbjct: 240 YEMNSKVITASDEMLSTLSRMR 261


>gi|295688784|ref|YP_003592477.1| flagellar basal-body rod protein FlgG [Caulobacter segnis ATCC
           21756]
 gi|295430687|gb|ADG09859.1| flagellar basal-body rod protein FlgG [Caulobacter segnis ATCC
           21756]
          Length = 262

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 128/262 (48%), Positives = 174/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GMSAQQ N+E+I+NNIAN+NT G+KR RAEF D LYQ  + AGS S S+D 
Sbjct: 1   MQALRTAASGMSAQQLNVEVISNNIANMNTVGFKRQRAEFQDLLYQTIERAGSQS-SSDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+  SV  +  QG    T N LDLA+ G+G+ Q+  P     YTRAG+
Sbjct: 60  NIVPTGVQVGGGVKAGSVYRITEQGTPTLTDNPLDLAIQGKGYLQILLPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ + +GQ+VT DG T+ PGI +P+   +I +S++G +      +   Q +GQL +ANF+
Sbjct: 120 FSTNDQGQIVTEDGYTVQPGITVPQNAIDIIISKTGMVQVKLDGDPQPQTIGQLQLANFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDNL   T+ SG   ++ P   GF  + Q Y EASNVD+V EI+ +I+AQRA
Sbjct: 180 NEGGLEAIGDNLFLETAASGAANLAAPGQPGFGVLMQHYTEASNVDSVSEITALITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  AD+M    ++MR
Sbjct: 240 YEMNSKVISTADQMLQTTSQMR 261


>gi|42526518|ref|NP_971616.1| flagellar basal body rod protein FlgG [Treponema denticola ATCC
           35405]
 gi|41816711|gb|AAS11497.1| flagellar basal-body rod protein FlgG [Treponema denticola ATCC
           35405]
 gi|325473456|gb|EGC76651.1| flagellar basal-body rod protein FlgG [Treponema denticola F0402]
          Length = 264

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 106/263 (40%), Positives = 156/263 (59%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM+ QQ N++ +ANN+AN+NT+G+K+ RAEF D +YQ  K AG+P  + +  
Sbjct: 3   RSLWTAATGMNTQQANIDTVANNLANVNTSGFKKQRAEFEDLIYQTVKTAGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           + P G+ +G G ++++ + ++ QG + +TG   D+A+ G G+F+V   D T  YTR GSF
Sbjct: 61  ITPVGVQMGHGARLAATQRIFEQGSLQNTGVTSDIAIQGEGFFRVLQYDGTYAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKV--SRSGQILAVTGKNSDFQPVGQLLIANF 179
            ID+  QLVT++G  ++P I+ PE  RE  +  SR G++    G   D   VGQ+ +  F
Sbjct: 121 KIDADRQLVTSNGLRVLPEIIFPEGYRENTIAVSRDGRVTVKVGDIDDPIEVGQIELYRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
            N AGL   G NL  +T  SG  I   P   GF   +  +LE SNV  V E+  MI AQR
Sbjct: 181 QNNAGLSAEGSNLFRQTPASGTAIPGRPGFTGFGRTEHKFLEMSNVSTVSEMVNMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE NSK I+ +D M      ++
Sbjct: 241 AYEFNSKAIQTSDNMLGTAVSLK 263


>gi|291617022|ref|YP_003519764.1| FlgG [Pantoea ananatis LMG 20103]
 gi|291152052|gb|ADD76636.1| FlgG [Pantoea ananatis LMG 20103]
 gi|327393473|dbj|BAK10895.1| flagellar basal-body rod protein FlgG [Pantoea ananatis AJ13355]
          Length = 260

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 164/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQ N+++IANN+AN++T G+KR+RA F D +YQ  +  G  +QS+++
Sbjct: 2   IRSLWIAKTGLDAQQMNMDVIANNLANVSTNGFKRSRAVFEDLMYQTMRQPG--TQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  T N+ D+A+ G+G+FQ++ PD T  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRPVTTERLHTQGNLSQTNNSKDIAINGQGFFQIQMPDGTSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT  G  + PGI IP     I VSR G +       +    VGQL ++ F+
Sbjct: 120 FQVDQNGQLVTNSGFPVQPGITIPANATSITVSRDGVVSVTQQGQTQAAQVGQLTLSTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G+NL   T  SG P  S P   G   + QGY E SNV+  +E+  MI  QRA
Sbjct: 180 NNAGLDSVGENLYKETQASGAPTDSTPGQNGAGLLYQGYAETSNVNVAEELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M + +T++
Sbjct: 240 YEINSKAISTSDQMLAKLTQL 260


>gi|22127325|ref|NP_670748.1| flagellar basal body rod protein FlgG [Yersinia pestis KIM 10]
 gi|45442798|ref|NP_994337.1| flagellar basal body rod protein FlgG [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51597635|ref|YP_071826.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           IP 32953]
 gi|108809053|ref|YP_652969.1| flagellar basal body rod protein FlgG [Yersinia pestis Antiqua]
 gi|108810750|ref|YP_646517.1| flagellar basal body rod protein FlgG [Yersinia pestis Nepal516]
 gi|145597819|ref|YP_001161895.1| flagellar basal body rod protein FlgG [Yersinia pestis Pestoides F]
 gi|150260247|ref|ZP_01916975.1| lateral flagellar basal body rod protein [Yersinia pestis
           CA88-4125]
 gi|153947407|ref|YP_001399636.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           IP 31758]
 gi|162421910|ref|YP_001604845.1| flagellar basal body rod protein FlgG [Yersinia pestis Angola]
 gi|165925150|ref|ZP_02220982.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939077|ref|ZP_02227629.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008679|ref|ZP_02229577.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212222|ref|ZP_02238257.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399088|ref|ZP_02304612.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419078|ref|ZP_02310831.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425222|ref|ZP_02316975.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167466335|ref|ZP_02331039.1| flagellar basal-body rod protein FlgG [Yersinia pestis FV-1]
 gi|186896769|ref|YP_001873881.1| flagellar basal body rod protein FlgG [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927914|ref|YP_002345789.1| flagellar basal body rod protein FlgG [Yersinia pestis CO92]
 gi|229837410|ref|ZP_04457573.1| Flagellar basal-body rod protein flgG [Yersinia pestis Pestoides A]
 gi|229840625|ref|ZP_04460784.1| Flagellar basal-body rod protein flgG [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842824|ref|ZP_04462976.1| Flagellar basal-body rod protein flgG [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900947|ref|ZP_04516071.1| Flagellar basal-body rod protein flgG [Yersinia pestis Nepal516]
 gi|270487670|ref|ZP_06204744.1| flagellar basal-body rod protein FlgG [Yersinia pestis KIM D27]
 gi|294502791|ref|YP_003566853.1| putative flagellar basal-body rod protein [Yersinia pestis Z176003]
 gi|21960406|gb|AAM86999.1|AE013948_7 flagellar biosynthesis protein, cell-distal portion of basal-body
           rod [Yersinia pestis KIM 10]
 gi|45437664|gb|AAS63214.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51590917|emb|CAH22573.1| putative flagellar basal-body rod protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774398|gb|ABG16917.1| flagellar basal-body rod protein [Yersinia pestis Nepal516]
 gi|108780966|gb|ABG15024.1| putative flagellar basal-body rod protein [Yersinia pestis Antiqua]
 gi|115346525|emb|CAL19402.1| putative flagellar basal-body rod protein [Yersinia pestis CO92]
 gi|145209515|gb|ABP38922.1| flagellar basal-body rod protein [Yersinia pestis Pestoides F]
 gi|149289655|gb|EDM39732.1| lateral flagellar basal body rod protein [Yersinia pestis
           CA88-4125]
 gi|152958902|gb|ABS46363.1| flagellar basal-body rod protein FlgG [Yersinia pseudotuberculosis
           IP 31758]
 gi|162354725|gb|ABX88673.1| flagellar basal-body rod protein FlgG [Yersinia pestis Angola]
 gi|165913033|gb|EDR31658.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923350|gb|EDR40501.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992018|gb|EDR44319.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206968|gb|EDR51448.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166963072|gb|EDR59093.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051592|gb|EDR63000.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055985|gb|EDR65766.1| flagellar basal-body rod protein FlgG [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186699795|gb|ACC90424.1| flagellar basal-body rod protein FlgG [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682286|gb|EEO78378.1| Flagellar basal-body rod protein flgG [Yersinia pestis Nepal516]
 gi|229690091|gb|EEO82148.1| Flagellar basal-body rod protein flgG [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696991|gb|EEO87038.1| Flagellar basal-body rod protein flgG [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229705533|gb|EEO91543.1| Flagellar basal-body rod protein flgG [Yersinia pestis Pestoides A]
 gi|262360823|gb|ACY57544.1| putative flagellar basal-body rod protein [Yersinia pestis D106004]
 gi|262364768|gb|ACY61325.1| putative flagellar basal-body rod protein [Yersinia pestis D182038]
 gi|270336174|gb|EFA46951.1| flagellar basal-body rod protein FlgG [Yersinia pestis KIM D27]
 gi|294353250|gb|ADE63591.1| putative flagellar basal-body rod protein [Yersinia pestis Z176003]
 gi|320016709|gb|ADW00281.1| Flagellar basal-body rod protein flgG [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 261

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   +  I+NN+AN+NT G+KR R  FAD  YQ ++  G+P    +   
Sbjct: 4   ALWVSKTGLAAQDAKMGAISNNLANVNTDGFKRDRVVFADLFYQNQRTPGAPLDQNNTT- 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI  GSGVQI   +  +T G +  T  ++D+A+ G+G+FQ+ET D  + YTRAG+  
Sbjct: 63  -PSGIQFGSGVQIVGTQKQFTVGNIKVTKGDMDVAITGQGFFQIETADGGIAYTRAGNLT 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            ++ G LV A G  L+P I +P  ++++ + + G + A  G  ++   VGQ+ + NFIN 
Sbjct: 122 TNADGVLVNAQGMPLIPQIELPTGSKQLHIGKDGTVTATVGGETEPVEVGQITLVNFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG NL   T+ SG+ +   P +  F  ++QG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAIGGNLYRETAASGEAVEGVPGEEAFGQLEQGALEGSNVQVVEEMVDMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   +++
Sbjct: 242 MNAKMVSAADDMLKFVSQ 259


>gi|332296516|ref|YP_004438439.1| flagellar basal-body rod protein FlgG [Thermodesulfobium narugense
           DSM 14796]
 gi|332179619|gb|AEE15308.1| flagellar basal-body rod protein FlgG [Thermodesulfobium narugense
           DSM 14796]
          Length = 262

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 163/262 (62%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM +Q TN+++I NN+AN+NTTG+K ARAEF D +YQ  + AG  + SA  
Sbjct: 1   MRALWTAASGMISQTTNVDVITNNLANVNTTGFKTARAEFEDLMYQEVRPAG--ATSASG 58

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ IG G +  +   ++T+G +  TGN LDLA+ G G+FQV  PD +  YTRAG+
Sbjct: 59  NMLPTGLEIGLGSRPVATVRIFTEGPLQQTGNQLDLAIQGDGFFQVTLPDGSTAYTRAGN 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++DS G++VT +G  L P IV+P     I V + G + A     +  Q +G + +A FI
Sbjct: 119 FSLDSAGEIVTPEGYLLQPSIVVPTNAVSISVGKDGSVSAKMQDGT-VQDLGTIQLARFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G NL   T  SGD I+  P   G   V+QG LE SNV  V+E+  +I+A+RA
Sbjct: 178 NPSGLTSLGSNLYQSTPASGDAILGTPGTQGIGWVEQGMLEMSNVQVVEEMVNLITAERA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE  +K +   D+M S    ++
Sbjct: 238 YESCAKGMTVCDQMLSDANNVK 259


>gi|254477684|ref|ZP_05091070.1| flagellar basal-body rod protein FlgG [Ruegeria sp. R11]
 gi|214031927|gb|EEB72762.1| flagellar basal-body rod protein FlgG [Ruegeria sp. R11]
          Length = 261

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 170/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ  +E I+NN+AN+NTTGY   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMTAQQLRVETISNNLANMNTTGYNARRAEFADLHYQQVTRAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ S++     QG +  TGN+LD+A+ G+G+ +V  P     YTR GS
Sbjct: 60  TVLPTGVQVGLGVRASAISIHLAQGALTQTGNDLDVAIDGKGYLEVTLPSGQSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG T+ P I IP + R + ++  G++ A   + ++ Q +GQL +A F 
Sbjct: 120 LKRSAEGLIVTSDGFTVSPDITIPADARNVSINADGEVYAYFDETAEGQLMGQLTLAGFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL   T  SG   +++P + G   ++QGYLEAS+VDAV+E++E+I AQR 
Sbjct: 180 NPKGLEALGSNLFVETEASGAATVASPGENGLGTLRQGYLEASSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M    T++R
Sbjct: 240 YEMNAKVISAVDQMMGATTQVR 261


>gi|254511992|ref|ZP_05124059.1| flagellar basal-body rod protein FlgG [Rhodobacteraceae bacterium
           KLH11]
 gi|221535703|gb|EEE38691.1| flagellar basal-body rod protein FlgG [Rhodobacteraceae bacterium
           KLH11]
          Length = 261

 Score =  225 bits (572), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 170/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ  +E I+NN+AN+NTTGY   RAEFAD  YQ    AG+ S ++D 
Sbjct: 1   MRALKIAATGMTAQQMRVETISNNLANMNTTGYNTRRAEFADLHYQQVARAGAVS-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P GI +G GV+ ++V     QG +  TG++LD+A+ GRG+ +V  P+    YTR GS
Sbjct: 60  TVLPTGIQLGLGVRPAAVTVQLEQGGLSATGSDLDVAIEGRGYLEVTLPNGQSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG  + P I IP++ R I ++ +G++ A     ++ Q +G+  +A+F 
Sbjct: 120 LKRSAEGLIVTSDGFAVAPEITIPDDARSISINAAGEVYAYFDDTAEGQLLGEFTMASFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL   T  SG P++  P + G   ++QGYLE S+VDAV+E++E+I AQR 
Sbjct: 180 NAKGLEAVGSNLFKETEASGAPVVGRPGEDGLGTLRQGYLEDSSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M    T++R
Sbjct: 240 YEMNAKVISAVDQMMGATTQVR 261


>gi|260574401|ref|ZP_05842405.1| flagellar basal-body rod protein FlgG [Rhodobacter sp. SW2]
 gi|259023297|gb|EEW26589.1| flagellar basal-body rod protein FlgG [Rhodobacter sp. SW2]
          Length = 261

 Score =  225 bits (572), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 163/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M A  IAA+GM+AQQ  +++++NN+AN++TTGY   RA+FAD  YQ     G+ S + D 
Sbjct: 1   MNALQIAASGMAAQQMRVDVVSNNLANMSTTGYNARRADFADLHYQQLARPGTVS-AQDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G GV+ ++V  V  QG +  TG +LDLA+ G+G+ +V  P     YTR G+
Sbjct: 60  TILPTGVQLGLGVRPAAVSMVMAQGTLAQTGGDLDLAIEGQGYLEVTLPSGASAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                 G +VT++G+ + PGI IP + R + ++  G++ A          +GQL +  F 
Sbjct: 120 LKRTGDGLIVTSEGHQVAPGITIPADARSLSINADGEVYAYFVDQVQPSLLGQLNLVGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG NL   +  SG  I+  P   G   ++QGYLE S+VDAV+E++E+I AQR 
Sbjct: 180 NEKGLEAIGSNLFLESPASGAAIVGTPGQDGLGTLRQGYLEESSVDAVREVTELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M S  T++R
Sbjct: 240 YELNAKVITAADQMLSATTQLR 261


>gi|229591869|ref|YP_002873988.1| flagellar basal body rod protein FlgG [Pseudomonas fluorescens
           SBW25]
 gi|229363735|emb|CAY51140.1| flagellar basal-body rod protein [Pseudomonas fluorescens SBW25]
          Length = 261

 Score =  225 bits (572), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 163/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL  I+NN+AN++TTG+KR RAEF D LYQ +K  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTTISNNLANVSTTGFKRDRAEFQDLLYQIKKQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GVQI   +  ++ G +  TG  LD+A+ GRG+FQ+  PD T  YTR G+F+
Sbjct: 62  LPSGLQLGTGVQIVGTQKNFSAGNLQQTGQPLDMAINGRGFFQILQPDGTTSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +DS GQ+VTA+G  L P +V+P + +   V   G +      N   Q +G L  A+FIN 
Sbjct: 122 LDSNGQIVTANGFALEPAVVVPADAKTFTVGNDGTVSITVAGNPASQVIGNLQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G+NL   T+ SG P I  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAMGNNLFLETASSGAPQIGTPGLNGFGTTLQSTLETSNVSTVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|146278639|ref|YP_001168798.1| flagellar basal body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556880|gb|ABP71493.1| flagellar basal-body rod protein FlgG [Rhodobacter sphaeroides ATCC
           17025]
          Length = 261

 Score =  225 bits (572), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 117/262 (44%), Positives = 170/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GMSAQQT +++I+NN+AN++TTGY   RA+FAD  YQ     G+ S + D 
Sbjct: 1   MKALQIAATGMSAQQTRVDVISNNLANMSTTGYNPRRADFADLHYQQMVRPGTVS-AEDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G GV+ S+V  V +QG +  T  +LDLA+ GRG+ +V  P     YTR GS
Sbjct: 60  RMLPTGVQLGMGVRPSAVSVVLSQGALAQTRGDLDLAIDGRGYIEVTLPSGQSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                +G +VT+DG+ + PGI IPE+   + ++ SG++ A        Q +GQ+ ++ F 
Sbjct: 120 LKRSGEGLVVTSDGHEVAPGITIPEDAASVAINGSGEVWAYFSGQVQPQLMGQITLSGFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG NL   T+ SG PI   P + GF  ++QGYLE S+VD+V+EI+E+I AQR 
Sbjct: 180 NEKGLEAIGSNLFVETAASGAPIAGTPGEDGFGTLRQGYLEESSVDSVQEITELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M +   +++
Sbjct: 240 YELNAKVITAADQMLAATAQVK 261


>gi|209521591|ref|ZP_03270289.1| flagellar basal-body rod protein FlgG [Burkholderia sp. H160]
 gi|209497974|gb|EDZ98131.1| flagellar basal-body rod protein FlgG [Burkholderia sp. H160]
          Length = 262

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 110/260 (42%), Positives = 165/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGAGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP     + +   G +      +S+ Q +G + +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPTNATSLTIGSDGSVSITVAGSSNTQQLGTMQLATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVSQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|261341492|ref|ZP_05969350.1| flagellar basal-body rod protein FlgG [Enterobacter cancerogenus
           ATCC 35316]
 gi|288316288|gb|EFC55226.1| flagellar basal-body rod protein FlgG [Enterobacter cancerogenus
           ATCC 35316]
          Length = 261

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G++AQ   +  I+NN+AN+NTTG+KR R  FAD  YQ ++  G   Q      
Sbjct: 4   ALWISKTGLAAQDAKMSAISNNLANVNTTGFKRDRVMFADLFYQNQRTPG--GQLDQNNT 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI  G+GV+I   +  ++ G + +TG  LD+A+ G+G+FQVET D  + YTRAG+F 
Sbjct: 62  SPTGIQFGTGVKILGTQKEFSTGNIQNTGQKLDVAITGQGFFQVETSDGDIAYTRAGNFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +  G L  A G  LVP I +P+  ++I++ + G + A     +D   +GQ+ + NF+N 
Sbjct: 122 KNPDGMLTNAQGLPLVPQIELPDNVKDIQIGKDGTVTATVAGETDPVELGQITLVNFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG NL   T+ SG+ +     +  F  ++QG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAIGGNLYRETAASGEAVEGVAGEEAFGQLEQGSLEGSNVQVVEEMVDMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   +T+
Sbjct: 242 MNAKMVSAADDMLKFVTQ 259


>gi|163738060|ref|ZP_02145476.1| flagellar basal-body rod protein FlgG [Phaeobacter gallaeciensis
           BS107]
 gi|163742544|ref|ZP_02149930.1| flagellar basal-body rod protein FlgG [Phaeobacter gallaeciensis
           2.10]
 gi|161384129|gb|EDQ08512.1| flagellar basal-body rod protein FlgG [Phaeobacter gallaeciensis
           2.10]
 gi|161388676|gb|EDQ13029.1| flagellar basal-body rod protein FlgG [Phaeobacter gallaeciensis
           BS107]
          Length = 261

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 114/262 (43%), Positives = 170/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ  +E I+NN+AN+NTTGY   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMTAQQLRVETISNNLANMNTTGYNARRAEFADLHYQQVTRAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ S++     QG +  TGN+LD+A+ G+G+ +V  P     YTR G+
Sbjct: 60  TVLPTGVQVGLGVRASAISIHLAQGALSQTGNDLDVAIDGKGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG T+ P I IP + R + ++  G++ A   + ++ Q +GQL +A F 
Sbjct: 120 LKRSAEGLVVTSDGFTVSPDITIPSDARNVSINADGEVYAYFDETAEGQLMGQLTLAGFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL   T  SG   +++P + G   ++QGYLEAS+VDAV+E++E+I AQR 
Sbjct: 180 NPKGLEALGSNLFVETEASGAATVASPGENGLGTLRQGYLEASSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M    T++R
Sbjct: 240 YEMNAKVISAVDQMMGATTQVR 261


>gi|148546709|ref|YP_001266811.1| flagellar basal body rod protein FlgG [Pseudomonas putida F1]
 gi|148510767|gb|ABQ77627.1| flagellar basal-body rod protein FlgG [Pseudomonas putida F1]
          Length = 261

 Score =  224 bits (571), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 117/258 (45%), Positives = 165/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+SAQ TNL +I+NN+AN++TTG+KR RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALWVAKTGLSAQDTNLTVISNNLANVSTTGFKRDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +  G +  T N LD+A+ GRG+FQ+  PD TV YTR G+F+
Sbjct: 62  LPSGLQVGTGVRIVGTQKNFQTGSLQTTENPLDMAVNGRGFFQILQPDGTVSYTRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S GQ+V ADG  L P IV+P + +   V + G +   T  N   Q +G +  A+FIN 
Sbjct: 122 LNSDGQIVNADGLALEPAIVVPNDAQTFTVGQDGTVSITTAGNPAAQVIGNIQTADFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ +G+NL   T+ SG P +  P   GF    Q  LE SNV  V+E+  MI+ QRAYE
Sbjct: 182 AGLQAMGNNLFLETAASGAPQVGTPGLNGFGTTLQQTLENSNVSTVEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  AD+M S +T+
Sbjct: 242 MNSKVISTADQMLSFVTQ 259


>gi|307266107|ref|ZP_07547652.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306918889|gb|EFN49118.1| flagellar basal-body rod protein FlgG [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 266

 Score =  224 bits (571), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 102/268 (38%), Positives = 142/268 (52%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A    A GM+AQQ N+++IANN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   MRALWSVATGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLIYQTLQREN----VYGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +T+G +  T N LDLAL G G+F V  PD  V YTR GS
Sbjct: 58  QGKPVNMQVGVGVRPSAIVKDFTEGSLQQTENPLDLALDGEGFFAVLGPDDKVYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSR------SGQILAVTGKNSDFQPVGQL 174
           F + + G  +        P +           +          +++V   +   Q V  L
Sbjct: 118 FKLSADGNTLMLVTADGYPVLDDSGNPIVFDSTEKDISVSPMGVISVKNPDGTTQEVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF+N  GL ++G NL   T  SG P   +        V QG+LE SNV  VKE+ +M
Sbjct: 178 GIYNFVNPQGLLSVGSNLYEPTEASGQPGTRDDFQGRMGKVMQGFLETSNVQVVKEMVDM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AADEM  +   +R
Sbjct: 238 IAAQRAYEINSKAIQAADEMLGIANNLR 265


>gi|226225711|ref|YP_002759817.1| flagellar basal-body rod protein FlgG [Gemmatimonas aurantiaca
           T-27]
 gi|226088902|dbj|BAH37347.1| flagellar basal-body rod protein FlgG [Gemmatimonas aurantiaca
           T-27]
          Length = 262

 Score =  224 bits (571), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 158/259 (61%), Gaps = 2/259 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A   AA GM AQQT  E+IA+N+AN+NT G+KR+RA F D LYQ  +  G      +   
Sbjct: 4   ALRAAATGMMAQQTRTEVIAHNLANVNTPGFKRSRAHFEDLLYQTVQ--GQQVLGENDTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +   I +G G +++ V+ ++ QG +  TG NLD+A+ G G+FQ++ P     Y+R GS  
Sbjct: 62  ITPAIQVGRGTRLAGVQRLHEQGPIEETGRNLDIAIEGEGFFQIQLPSGETAYSRDGSLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I  +G LVT+ G  L P + IP++  E  VS +G +    G +     +G++ +A F N 
Sbjct: 122 ISDQGVLVTSAGYALQPPVRIPDDASEFTVSATGVVSVRRGNDIQPTEIGRIELARFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL ++G NLLA T+ SG P++  P+D G   ++Q  LE SNV+ V+E+ EMI+A RAYE
Sbjct: 182 SGLLSLGQNLLAPTAASGQPVVGYPNDAGMGRLQQNSLEGSNVEIVQEMVEMIAAMRAYE 241

Query: 243 MNSKVIEAADEMSSLITKM 261
           +NSK I+ ADEM  +   +
Sbjct: 242 INSKAIKTADEMGQIANNI 260


>gi|254521223|ref|ZP_05133278.1| flagellar basal-body rod protein FlgG [Stenotrophomonas sp. SKA14]
 gi|219718814|gb|EED37339.1| flagellar basal-body rod protein FlgG [Stenotrophomonas sp. SKA14]
          Length = 257

 Score =  224 bits (571), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 2/257 (0%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
             IA  G+ AQQ  + +++NN+AN NTTG+K+ RA F D LYQ  +  G    S+ +  +
Sbjct: 1   MWIAKTGLDAQQMRMSVVSNNLANTNTTGFKQDRASFEDLLYQQVRQPG--GSSSAQTQL 58

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
           P G+ +G+GV++ +    + QG    TG  LD+ + GRG+F+V+ PD +  YTR GSF I
Sbjct: 59  PTGLQLGTGVRVVATAKNFEQGGQQQTGRALDVMVNGRGFFEVQMPDGSSAYTRDGSFKI 118

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
           +   +LVT  G  + PGI IPE  + + +   G I       +    VG L + +F+N A
Sbjct: 119 NQDSELVTNSGYPVQPGIQIPEGAQSVTIGTDGTISVKMADGAASVEVGALTLTDFVNPA 178

Query: 184 GLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEM 243
           GL+  G+NL   T+ SG     NP   G   V QG LE SNV+ V+E+  MI  QRAYEM
Sbjct: 179 GLQARGENLFLETTASGPAQNGNPGLNGLGTVVQGALEGSNVNVVEELVSMIETQRAYEM 238

Query: 244 NSKVIEAADEMSSLITK 260
           N+K I   D M   +  
Sbjct: 239 NAKAISTTDSMLGYLNN 255


>gi|254251193|ref|ZP_04944511.1| flagellar basal-body rod protein [Burkholderia dolosa AUO158]
 gi|124893802|gb|EAY67682.1| flagellar basal-body rod protein [Burkholderia dolosa AUO158]
          Length = 262

 Score =  224 bits (571), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 109/260 (41%), Positives = 164/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN +T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANTSTNGFKASRAVFEDLLYQTIRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GVQ  +   +YTQG +  TGN+ D+A+ G G+FQV  PD T  YTR GSF
Sbjct: 61  ELPSGLQLGTGVQQVATERLYTQGGLTQTGNSKDVAINGAGFFQVLMPDGTNAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P+    + + + G +      +++   +G L IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQILPAITVPQNATSLTIGKDGVVSVTQPGSNNAVQIGSLQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLEAKGENLFAETTSSGAPNVSQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +T+M
Sbjct: 241 EINSKAVTTSDQMLQTVTQM 260


>gi|21242725|ref|NP_642307.1| flagellar basal body rod protein FlgG [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78047584|ref|YP_363759.1| flagellar basal body rod protein FlgG [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294624042|ref|ZP_06702805.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294665577|ref|ZP_06730858.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|325927973|ref|ZP_08189194.1| flagellar basal-body rod protein FlgG [Xanthomonas perforans
           91-118]
 gi|21108201|gb|AAM36843.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas axonopodis pv. citri str. 306]
 gi|78036014|emb|CAJ23705.1| flagella basal body rod protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292601661|gb|EFF45635.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292604675|gb|EFF48045.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|325541658|gb|EGD13179.1| flagellar basal-body rod protein FlgG [Xanthomonas perforans
           91-118]
          Length = 261

 Score =  224 bits (571), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 149/259 (57%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + +I+NN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 3   QALWVAKTGLDAQQTRMSVISNNLANTNTTGFKRDRAAFEDLLYQQVRAPG--GSTSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V+ PD T  YTR G+F
Sbjct: 61  QLPTGLQLGTGVRVVSTFKGFDQGSQQQTGRALDVMVNGRGFFEVQMPDGTSAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+++G+LVT  G  L PGI +PE  + + +   G I       +  Q +G L + +FIN
Sbjct: 121 QINAQGELVTNSGYPLQPGIQVPEGAQSLTIGNDGTISVTLAGQAAAQEIGALTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+  G+NL   T+ SG      P   G     QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQAKGENLFVETTASGPAQNGTPGLNGLGTTVQGALEGSNVNTVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDSMLGYLNN 259


>gi|87306343|ref|ZP_01088490.1| flagellar hook basal body protein flgG [Blastopirellula marina DSM
           3645]
 gi|87290522|gb|EAQ82409.1| flagellar hook basal body protein flgG [Blastopirellula marina DSM
           3645]
          Length = 266

 Score =  224 bits (571), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 158/262 (60%), Gaps = 5/262 (1%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
              AA GM   QT L++I+NN+AN+NTT +K+ R  F D  Y    + G    S++    
Sbjct: 6   LYTAATGMQTLQTKLDVISNNLANVNTTAFKKDRINFEDLFYDNRVLPGKLDGSSN--PT 63

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
           P G  IG GV++ S +  Y QG    T  +LD  + G+G+FQV  P     YTRAG+F+I
Sbjct: 64  PTGTHIGMGVRVQSTQTDYQQGAFRETDRSLDWTIRGKGFFQVLDPTGQTYYTRAGNFSI 123

Query: 124 DSKGQLVTAD---GNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           ++ G++VT     G  L P I IP++T  I+VS  G +          + VGQ+ +ANFI
Sbjct: 124 NANGEIVTGSAGVGRPLEPSITIPQDTTGIEVSSDGIVSVQRPGQQTLEEVGQIQLANFI 183

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +GDNL + T+ S   I+ NP+  GF  V++G+LEASNV+ V+E+ ++I+ QRA
Sbjct: 184 NPEGLLKLGDNLYSETNASSAAIVGNPNIDGFGSVEKGFLEASNVEPVQELVDLITTQRA 243

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           +E+NS+ ++A D++  L++ +R
Sbjct: 244 FELNSQTVQAGDQILQLVSNLR 265


>gi|149189838|ref|ZP_01868118.1| putative flagellar basal-body rod protein [Vibrio shilonii AK1]
 gi|148836324|gb|EDL53281.1| putative flagellar basal-body rod protein [Vibrio shilonii AK1]
          Length = 261

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 156/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G+     ++  
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPGAQVDQVNQ-- 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +TG +LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPTGVQLGSGVRVVGTQKVFTQGSAQNTGQDLDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I IP+    + V   G + A T      Q +GQ+ +A F+N 
Sbjct: 122 VNSEGLMVNSQGLPLEPQIQIPDNALTLSVGVDGTVTATTADGPAPQDLGQITLAKFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG NL   T  SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAIGGNLFKETEASGQAEELIAGEEGAGSIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|51599025|ref|YP_073213.1| flagellar basal body rod protein FlgG [Borrelia garinii PBi]
 gi|51573596|gb|AAU07621.1| flagellar basal-body rod protein [Borrelia garinii PBi]
          Length = 265

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 103/264 (39%), Positives = 160/264 (60%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N++ IANN++N+NTTG+K+ RAEF D +YQ +  AG+P  + + 
Sbjct: 2   MRALWTAASGMTAQQYNVDTIANNLSNVNTTGFKKIRAEFEDLIYQTQNRAGTP--ATEN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G G +I++ + ++ QG++  T    D+A+ G G++++  PD +  YTR GS
Sbjct: 60  TLRPLGNQVGHGTKIAATQRIFEQGKMQSTNLLTDVAIEGDGFYKILLPDGSYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F IDS  +LVT+ G  ++P I  PEE  +    +S  G +      +++   +GQ+ I+ 
Sbjct: 120 FKIDSNRELVTSQGYKVLPNIFFPEEYIQNSITISEQGIVSVKIDNSNEPIELGQIEISR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T+ SG  I   P   G   ++Q  LE SNV   +E+  MI AQ
Sbjct: 180 FVNPAGLSAIGSNLFKETAGSGQEIAGIPGSEGMGILRQSILEMSNVSIAEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+NSK I+ +D M  +   ++
Sbjct: 240 RAYEINSKAIQTSDNMLGIANNLK 263


>gi|254470407|ref|ZP_05083811.1| flagellar basal-body rod protein FlgG [Pseudovibrio sp. JE062]
 gi|211960718|gb|EEA95914.1| flagellar basal-body rod protein FlgG [Pseudovibrio sp. JE062]
          Length = 260

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 128/262 (48%), Positives = 174/262 (66%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQ+ N+E+I+NN+AN+ TTGYKR RA+F D LY+ ++  G+ + S   
Sbjct: 1   MKALHIAATGMKAQELNVEVISNNVANMRTTGYKRQRADFQDLLYENQRRMGTET-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ IGSGV+ ++   + + G V  TGN  D+ + G G+FQ++ PD T+ YTR GS
Sbjct: 60  TIVPNGVQIGSGVRTAATTRIMSPGSVTQTGNEYDVTIRGEGFFQIQRPDGTIGYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F     GQLVT DG  + PGI IP+  R++ ++  G + A+   N     +GQL  A F 
Sbjct: 120 FARSQTGQLVTKDGYPVQPGITIPDNARDVTINVQGLVQAMD-DNDQVLNLGQLETARFT 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IGDNL   T  SG P ++NP   GF ++ Q +LE+SNVDAV E+S +ISAQRA
Sbjct: 179 NQAGLEAIGDNLFLETPASGPPQLNNPGTAGFGNILQRHLESSNVDAVTELSSLISAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSK+I+AADEM S  T +R
Sbjct: 239 YEMNSKIIKAADEMYSTTTNLR 260


>gi|163856437|ref|YP_001630735.1| flagellar basal body rod protein FlgG [Bordetella petrii DSM 12804]
 gi|163260165|emb|CAP42467.1| flagellar basal-body rod protein FlgG [Bordetella petrii]
          Length = 261

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 101/262 (38%), Positives = 159/262 (60%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+  QQT++++I+NN+AN+ T G+KR RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWIAKTGLEGQQTSMDVISNNLANVQTNGFKRGRAIFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+++S   V+TQG + +TG+ LD+A+ G+G+ QV+ PD T  YTR G+
Sbjct: 60  NQLPTGLQLGTGVRVASTERVFTQGNLNNTGSELDIAIDGKGFLQVDLPDGTQAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
             +D  GQL TA G  + P I +P+    + + + G +       +       QL +A F
Sbjct: 120 LQVDQNGQLTTAGGYVIQPPINVPDNALSLTIGKDGTVSVTQPGAAGLNVQIGQLQLATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL+++G+NL   T  SG   I  P   G   + Q Y+E SNV+  +E+  MI+ QR
Sbjct: 180 INPPGLQSVGENLYLETDSSGPANILQPGIDGAGSILQQYVETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|118588711|ref|ZP_01546119.1| Flagellar basal-body rod FlgG [Stappia aggregata IAM 12614]
 gi|118438697|gb|EAV45330.1| Flagellar basal-body rod FlgG [Stappia aggregata IAM 12614]
          Length = 260

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 129/262 (49%), Positives = 180/262 (68%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM AQ+ N+E+I+NN+AN+ TTG+K+ RA+F D LYQ  +  G+ + S   
Sbjct: 1   MKALHIAATGMKAQELNVEVISNNVANMRTTGFKKQRADFQDLLYQNLRRMGTET-SDSG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP GI IGSGV+I++   + +QG +  TG  LDLA+ G G+FQ++ PD T  YTR GS
Sbjct: 60  TIVPTGIQIGSGVKIAATGRIMSQGSLEQTGKELDLAIRGEGFFQIDMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ GQLVT DG ++ PGI IP+  +++ +S +G +  V  +  +   +GQ+ +A F+
Sbjct: 120 FERDANGQLVTIDGYSVNPGITIPQTVKDVTISNTGVVQGVD-QAGNTVQLGQIQLARFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IGDNL   T  SG P  SNP D  +  V+Q +LE +NVDAV EI+++ISAQRA
Sbjct: 179 NKAGLEAIGDNLYLETDASGAPETSNPGDESYGTVQQYFLEMANVDAVTEIADLISAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNS++I+AADEM S  T +R
Sbjct: 239 YEMNSQIIQAADEMYSTTTNLR 260


>gi|119384847|ref|YP_915903.1| flagellar basal body rod protein FlgG [Paracoccus denitrificans
           PD1222]
 gi|119374614|gb|ABL70207.1| flagellar basal-body rod protein FlgG [Paracoccus denitrificans
           PD1222]
          Length = 261

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 167/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA+GMSAQQ  +++I+NN+AN++TTGY   RAEFAD  YQ     G+ + + + 
Sbjct: 1   MRALQIAASGMSAQQMRVDVISNNLANMSTTGYNARRAEFADLQYQQATRPGTLT-ATNG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A+VP G+ +G GV+ +SV  +  QG  V T  +LD+A+ G G+ +V  P     YTR GS
Sbjct: 60  AMVPAGVQLGLGVRPASVTVMLAQGTPVQTNGDLDIAIEGNGYLEVTLPSGISAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++GQ+VT++G  LVP I IPE+ R I ++  GQ+ A      + + +GQ+ +ANF+
Sbjct: 120 LKRSAEGQVVTSEGYPLVPDITIPEDARSIAINADGQVFAYFDDRVEPENLGQITLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G N+   T  SG P ++ P   G   ++ G+LE S+VD V+EI+E+I AQR 
Sbjct: 180 NGKGLEAVGSNMFLETPASGAPQVAAPGQEGLGTIRAGFLEESSVDPVREIAELIKAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M     ++R
Sbjct: 240 YELNSKVITAADQMLGTTVQVR 261


>gi|21231395|ref|NP_637312.1| flagellar basal body rod protein FlgG [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768552|ref|YP_243314.1| flagellar basal body rod protein FlgG [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991639|ref|YP_001903649.1| flagellar basal body rod protein FlgG [Xanthomonas campestris pv.
           campestris str. B100]
 gi|325916945|ref|ZP_08179189.1| flagellar basal-body rod protein FlgG [Xanthomonas vesicatoria ATCC
           35937]
 gi|21113060|gb|AAM41236.1| flagellar biosynthesis, cell-distal portion of basal-body rod
           [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66573884|gb|AAY49294.1| flagellar biosynthesis, cell-distal portion of basal-body rod
           [Xanthomonas campestris pv. campestris str. 8004]
 gi|167733399|emb|CAP51600.1| unnamed protein product [Xanthomonas campestris pv. campestris]
 gi|325536848|gb|EGD08600.1| flagellar basal-body rod protein FlgG [Xanthomonas vesicatoria ATCC
           35937]
          Length = 261

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 102/259 (39%), Positives = 149/259 (57%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + +I+NN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 3   QALWVAKTGLDAQQTRMSVISNNLANTNTTGFKRDRAAFEDLLYQQVRAPG--GSTSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V+ PD T  YTR G+F
Sbjct: 61  QLPTGLQLGTGVRVVSTFKGFDQGSQQQTGRALDVMVNGRGFFEVQMPDGTSAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+++G++VT  G  L PGI +PE  + + +   G I       +  Q +G L + +FIN
Sbjct: 121 QINAQGEVVTNSGYPLQPGIQVPEGAQSLTIGNDGTISVTLAGQAAAQEIGALTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+  G+NL   T+ SG      P   G     QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQAKGENLFVETTASGPAQNGTPGLNGLGTTVQGALEGSNVNTVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDSMLGYLNN 259


>gi|325923276|ref|ZP_08184949.1| flagellar basal-body rod protein FlgG [Xanthomonas gardneri ATCC
           19865]
 gi|325546203|gb|EGD17384.1| flagellar basal-body rod protein FlgG [Xanthomonas gardneri ATCC
           19865]
          Length = 261

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 102/259 (39%), Positives = 150/259 (57%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + +I+NN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 3   QALWVAKTGLDAQQTRMSVISNNLANTNTTGFKRDRAAFEDLLYQQVRAPG--GSTSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V+ PD T  YTR G+F
Sbjct: 61  QLPTGLQLGTGVRVVSTFKGFDQGSQQQTGRALDVMVNGRGFFEVQMPDGTSAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+++G++VT  G  L PGI +PE  + + +   G I       +  Q +G L + +FIN
Sbjct: 121 QINAQGEVVTNSGYPLQPGIQVPEGAQSLTIGNDGTISVTLAGQAAAQEIGALTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL++ G+NL   T+ SG      P   G     QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQSKGENLFVETTASGPAQNGTPGLNGLGTTVQGALEGSNVNTVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDSMLGYLNN 259


>gi|300024606|ref|YP_003757217.1| flagellar basal-body rod protein FlgG [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526427|gb|ADJ24896.1| flagellar basal-body rod protein FlgG [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 262

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 145/260 (55%), Positives = 189/260 (72%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQTN+E+IANN+ANINTTG+KRARAEF D LYQ ++ AG+ ++  D 
Sbjct: 1   MRALSIAATGMSAQQTNVEVIANNVANINTTGFKRARAEFTDLLYQTDRAAGTLARD-DD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++PEG  IG GV+  ++R++  QG +  T N LDLAL GRG+FQV+  +  ++YTRAG+
Sbjct: 60  TMIPEGNQIGLGVRTVAIRHLSMQGALAPTSNKLDLALDGRGYFQVQGENNEILYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN D+ GQLVT +GN ++P I IP    +++++ SGQ+ A+ G     Q +GQL IANF 
Sbjct: 120 FNKDANGQLVTLEGNVVIPNITIPSTATDVQINASGQVYAIIGATGQQQLLGQLSIANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  +G NL      SG  +I NP D GFA + QGYLE+SNVD VKEI+E+I+AQRA
Sbjct: 180 NETGLDALGGNLFRENQASGAAVIGNPGDSGFAKIHQGYLESSNVDPVKEITELIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI AAD+M S ITK
Sbjct: 240 YEMNSKVISAADDMFSTITK 259


>gi|262653|gb|AAB24739.1| flagellar basal body distal rod protein [Caulobacter vibrioides]
          Length = 262

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 165/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+E+I+NNIAN+NT G+KR RAEF D LYQ  + AGS S S+D 
Sbjct: 1   MQALRTAASGMAAQQLNVEVISNNIANMNTVGFKRQRAEFQDLLYQTIERAGSQS-SSDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+  SV  +  QG    T + LDLA+ G+G+  +  P     YTRAG+
Sbjct: 60  NIVPTGVQVGGGVKAGSVYRITEQGTPTLTDSPLDLAIQGKGYMPILLPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ + +GQ+VT DG  + PGI IP+   +I +S+SG +          Q VGQ+ +ANF+
Sbjct: 120 FSTNDQGQIVTEDGYLVQPGITIPQNATDITISKSGLVQVKLDGQPQPQTVGQIQLANFL 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IGDNL   T+ SG   +        A       EASNVDAV EI+ +I+AQRA
Sbjct: 180 NEGGLEAIGDNLFLETAASGAATLVRRASRALACCCSTDTEASNVDAVSEITALITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  AD+M    +++R
Sbjct: 240 YEMNSKVISTADQMLQATSQLR 261


>gi|323527711|ref|YP_004229864.1| flagellar basal-body rod protein FlgG [Burkholderia sp. CCGE1001]
 gi|323384713|gb|ADX56804.1| flagellar basal-body rod protein FlgG [Burkholderia sp. CCGE1001]
          Length = 262

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 107/260 (41%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S  + 
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P     + +   G +      +++ Q +G + +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITVPTNATSLTIGSDGAVSITVAGSTNTQQLGTMQLATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|260762610|ref|ZP_05874944.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260673033|gb|EEX59854.1| flagellar basal-body rod protein FlgG [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 243

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 134/244 (54%), Positives = 180/244 (73%), Gaps = 2/244 (0%)

Query: 20  IIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVR 79
           +IANNIANINTTG+KRARAEF D LYQ+E+ AG P+Q A++A+VPEG  +G GVQ ++VR
Sbjct: 1   MIANNIANINTTGFKRARAEFTDLLYQSERTAGVPNQ-ANQAIVPEGALVGLGVQTAAVR 59

Query: 80  NVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVP 139
           N++ QG    TGN  D+AL GRGWFQ+++P    +YTRAG+FN ++ GQLVT DGN + P
Sbjct: 60  NLHIQGSFNQTGNPYDVALTGRGWFQIQSPTGETLYTRAGAFNKNADGQLVTLDGNPVEP 119

Query: 140 GIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVS 199
            I IP +  E+ ++ +GQ+ A      +   +GQL +ANF NEAGL  +G NL   T  S
Sbjct: 120 AITIPPDAIEVTITDTGQVFAKLQDQINQVDLGQLTLANFTNEAGLEPLGGNLYRETEAS 179

Query: 200 GDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLIT 259
           G P++  P D G+  +KQGYLEASNVD VKEI+++I+AQRAYEMNSKVI+AADEM++ ++
Sbjct: 180 GGPLVGVPGDPGYGSIKQGYLEASNVDPVKEITDLITAQRAYEMNSKVIQAADEMAATVS 239

Query: 260 -KMR 262
             +R
Sbjct: 240 KNLR 243


>gi|332088746|gb|EGI93858.1| flagellar basal-body rod protein FlgG [Shigella boydii 5216-82]
          Length = 260

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 159/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  IA  G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++
Sbjct: 2   ISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD +  YTR GS
Sbjct: 60  TTLPSGLQIGTGVRSVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVTA G  + P I IP     I + R G +       +    VGQL +  F+
Sbjct: 120 FQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IG+NL   T  SG P  S P   G   + QGY++ SNV+  +E+  MI  QRA
Sbjct: 180 NDTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVDTSNVNVAEELVNMIQVQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +   D+M   +T++
Sbjct: 240 YEINSKAVSTTDQMLQKLTQL 260


>gi|311105937|ref|YP_003978790.1| flagellar basal-body rod protein FlgG [Achromobacter xylosoxidans
           A8]
 gi|310760626|gb|ADP16075.1| flagellar basal-body rod protein FlgG [Achromobacter xylosoxidans
           A8]
          Length = 261

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 155/262 (59%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+  QQT++++I+NN+AN++T G+KR RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWIAKTGLEGQQTSMDVISNNLANVSTNGFKRGRAVFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G ++++   ++T G + +TG+ +D+A+ GRG+ Q+E PD T  YTR G+
Sbjct: 60  TQLPSGLQLGTGARVAATERIHTAGNLNNTGSEMDIAINGRGFLQIELPDGTQAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
              D  GQL T  G  + P + IP+    I +   G +       +       QL IA F
Sbjct: 120 LQRDQNGQLTTVSGYVIQPPMNIPDNALSISIGNDGIVSVTQPGAAGINVQIGQLQIATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL++IG+NL   T  SG   +  P   G   + Q Y+E SNV+  +E+  MI+ QR
Sbjct: 180 INPTGLQSIGENLYLETDASGPANLLQPGVDGAGSIMQKYVETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|332284021|ref|YP_004415932.1| flagellar basal body rod protein FlgG [Pusillimonas sp. T7-7]
 gi|330427974|gb|AEC19308.1| flagellar basal body rod protein FlgG [Pusillimonas sp. T7-7]
          Length = 261

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 162/262 (61%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ +QQTN+++I+NN+AN+NTTG+KR+RA F D +YQ  +  G+   +A++
Sbjct: 2   IRSLWIAKTGLESQQTNMDVISNNLANVNTTGFKRSRANFEDLMYQTIRQPGAQVGAANQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ IG+GV+  +   ++TQG +  TGN++D+A+ G+G+ QVE PD T  YTR GS
Sbjct: 62  --LPSGLQIGTGVRTVATERIHTQGNLKDTGNSMDIAIQGKGFLQVEMPDGTFAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
             +D  GQLVTA G  + P I IP+    I ++R G +       +       QL +  F
Sbjct: 120 LQVDQNGQLVTAGGYPIQPPINIPDNALTITIARDGMVSVTQPGATGANVEVGQLQLNTF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL++ G+NL   T  SG    + P   G   V Q Y E SNV+  +E+  MI+ QR
Sbjct: 180 INPTGLQSAGENLYVETDASGPANFAQPGLDGAGLVLQQYTETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK IE +D+M + +T++
Sbjct: 240 AYEMNSKAIETSDQMLARLTQL 261


>gi|126730134|ref|ZP_01745946.1| flagellar basal-body rod protein FlgG [Sagittula stellata E-37]
 gi|126709514|gb|EBA08568.1| flagellar basal-body rod protein FlgG [Sagittula stellata E-37]
          Length = 261

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 114/262 (43%), Positives = 163/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN++N++TTGY   RAEFAD  YQ    AG+ + +++ 
Sbjct: 1   MRALKIAATGMSAQQMRVEVISNNLSNMSTTGYNARRAEFADLHYQQMARAGTVN-ASNG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P GI +G GV+ ++V    +QG +  TG +LD+A+ G G+ +V  P     YTR G 
Sbjct: 60  TVLPTGIQLGLGVRPAAVSVQLSQGALSATGGDLDVAIEGNGYLEVTLPSGQAAYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                +G +VT+DG+ + P I IP++ R I ++  G++ A     +  Q +GQ  +A F 
Sbjct: 120 LKRTGEGLIVTSDGHPVAPEITIPDDARRISINADGEVYAYFAGQAQAQLLGQFTLAGFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG  I S P   G   ++QGYLE S+VDAVKEI+++I AQR 
Sbjct: 180 NAKGLEAIGSNLFVETEASGPAIQSTPGQDGLGTLRQGYLEDSSVDAVKEITDLIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M     ++R
Sbjct: 240 YELNSKVISAADQMLGATAQVR 261


>gi|308050022|ref|YP_003913588.1| flagellar basal-body rod protein FlgG [Ferrimonas balearica DSM
           9799]
 gi|307632212|gb|ADN76514.1| flagellar basal-body rod protein FlgG [Ferrimonas balearica DSM
           9799]
          Length = 261

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 162/259 (62%), Gaps = 2/259 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G  + +  +  
Sbjct: 4   ALWVSKTGLTAQDTKMTTIANNLANVNTTGFKRDRVSFNDLFYQTQRQPG--AMADQQNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I+  + V+T G+++ T   LDLA++G+G+FQVE P+    YTR G F 
Sbjct: 62  LPSGLQLGTGVRITGTQKVFTTGDIITTNQPLDLAIMGQGFFQVEQPNGDFAYTRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            ++ G +VT++G  LVP + IPE+   + V   G + A    ++  Q +GQ+ +ANF N 
Sbjct: 122 RNADGLVVTSEGMPLVPAVEIPEDALTVTVGSDGIVTAQIAGDAVPQELGQITLANFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G+NL   T+ SG  I   P D     +KQG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEAFGNNLYRETAASGVAIEGIPGDAAIGQLKQGTLEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITKM 261
           MN+KV+ + D+M   + ++
Sbjct: 242 MNAKVVSSTDDMLKYLNQV 260


>gi|187925759|ref|YP_001897401.1| flagellar basal body rod protein FlgG [Burkholderia phytofirmans
           PsJN]
 gi|187716953|gb|ACD18177.1| flagellar basal-body rod protein FlgG [Burkholderia phytofirmans
           PsJN]
          Length = 262

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 109/260 (41%), Positives = 165/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S    
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP     + +   G +      +++ Q +G + IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPNNATSLTIGSDGVVSITVAGSTNSQQLGSMQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|296157454|ref|ZP_06840289.1| flagellar basal-body rod protein FlgG [Burkholderia sp. Ch1-1]
 gi|295892226|gb|EFG72009.1| flagellar basal-body rod protein FlgG [Burkholderia sp. Ch1-1]
          Length = 262

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 109/260 (41%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S    
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++PGI IP     + +   G +      +++ Q +G + +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPGITIPNNATSLTIGSDGVVSITVAGSTNSQQLGSMQVATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|91785632|ref|YP_560838.1| flagellar basal body rod protein FlgG [Burkholderia xenovorans
           LB400]
 gi|91689586|gb|ABE32786.1| flgG; flagellar basal-body rod protein [Burkholderia xenovorans
           LB400]
          Length = 262

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 109/260 (41%), Positives = 165/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S    
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTIRQPG--ANSTQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I IP     + +   G +      +++ Q +G + IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITIPNNATSLTIGSDGVVSITVAGSTNSQQLGSMQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|170694394|ref|ZP_02885548.1| flagellar basal-body rod protein FlgG [Burkholderia graminis C4D1M]
 gi|170140817|gb|EDT08991.1| flagellar basal-body rod protein FlgG [Burkholderia graminis C4D1M]
          Length = 262

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 166/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ+ +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S    
Sbjct: 3   RSLYIAATGMNAQQSQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P     + +   G +      +++ Q +G + IA FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITVPTNATSLTIGSDGVVSITVAGSTNSQQLGSMQIATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|197104381|ref|YP_002129758.1| flagellar basal-body rod protein FlgG [Phenylobacterium zucineum
           HLK1]
 gi|196477801|gb|ACG77329.1| flagellar basal-body rod protein FlgG [Phenylobacterium zucineum
           HLK1]
          Length = 262

 Score =  223 bits (569), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 169/262 (64%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+E+I+NNIAN+NT  +KR RAEF D LYQ  + AG  S S   
Sbjct: 1   MQALRTAATGMAAQQLNVEVISNNIANMNTVAFKRQRAEFQDLLYQTFEAAGVQS-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G+GV+  SV  + TQG +  T N LD+A+ GRG+FQV  P     YTRAG+
Sbjct: 60  TIVPTGVQVGAGVKAGSVYRIATQGTLTRTENKLDMAIDGRGFFQVLLPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
            +++ +GQLVT DG  + PGI IP++  ++ +S+SGQ+       +    VGQL +A F+
Sbjct: 120 LSVNDQGQLVTQDGYPIEPGITIPQDAVDVAISKSGQVQVTQAGQTAPTIVGQLELATFL 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL+  G NL   T+ SG P    P + G   + QGY EASNVDAV EI+ +I AQRA
Sbjct: 180 NEGGLQAQGSNLFKETAASGPPTNGIPGENGVGELIQGYTEASNVDAVAEITALIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  AD M +   +++
Sbjct: 240 YEMNSKVISTADNMLATANQVK 261


>gi|307731361|ref|YP_003908585.1| flagellar basal-body rod protein FlgG [Burkholderia sp. CCGE1003]
 gi|307585896|gb|ADN59294.1| flagellar basal-body rod protein FlgG [Burkholderia sp. CCGE1003]
          Length = 262

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 107/260 (41%), Positives = 165/260 (63%), Gaps = 2/260 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++  IAA GM+AQQ  +++I+NN+AN++T G+K +RA F D LYQ  +  G  + S    
Sbjct: 3   RSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLLYQTVRQPG--ANSTQNT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P GI +G+GVQ  +   +YTQG +  TGN+ D+A+ G+G+FQV+ PD T  YTR GSF
Sbjct: 61  ELPSGIQLGTGVQQVATERLYTQGNLQQTGNSKDVAINGQGFFQVQMPDGTTAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
             +++GQLVT+ G  ++P I +P     + +   G +      +++ Q +G + +A FIN
Sbjct: 121 QTNAQGQLVTSSGYQVIPAITVPSNATSLTIGSDGAVSISVAGSTNTQQLGTMQLATFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G+NL A T+ SG P ++ P   G   + QGY+EASNV+ V+E+  MI  QRAY
Sbjct: 181 PAGLDAKGENLFAETASSGAPNVAQPGLNGAGTLNQGYVEASNVNVVQELVNMIQTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITKM 261
           E+NSK +  +D+M   +++M
Sbjct: 241 EINSKAVTTSDQMLQTLSQM 260


>gi|27904804|ref|NP_777930.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|38372207|sp|Q89AH7|FLGG_BUCBP RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|27904202|gb|AAO27035.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 260

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 160/259 (61%), Gaps = 2/259 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + A  IA  G+ AQQ N+ +IANN+AN+NT G+KR++A F D +Y   +  G  S+S+++
Sbjct: 2   IPALWIAKTGLDAQQINMNVIANNLANVNTNGFKRSKAIFEDLIYHTVQQPG--SKSSEE 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + P G  +G+GV+  +    ++QG +  T +  D+A+ G G+FQV+ PD    YTR GS
Sbjct: 60  TISPSGFQLGTGVRPITTEREHSQGNLSKTNSLKDVAINGNGFFQVQLPDGNAAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F I+  GQLVT +G  + P I  P     + VSR G I     + +    VG+L +ANF+
Sbjct: 120 FQINPNGQLVTNNGFLIQPVINFPANGNNMSVSRDGIITVRIPEQTQPIRVGKLYLANFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N++GL NIG+NL   T  SG+P IS+P   G   + Q Y+E SNV+  +E+  MI AQRA
Sbjct: 180 NDSGLSNIGENLYQETEASGNPSISSPGSHGTGLLYQSYVETSNVNIAEELVNMIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT 259
           YE+NSKVI  AD+M   ++
Sbjct: 240 YEINSKVITTADQMLQKLS 258


>gi|289666050|ref|ZP_06487631.1| flagellar basal body rod protein FlgG [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289670510|ref|ZP_06491585.1| flagellar basal body rod protein FlgG [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 261

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 150/259 (57%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + +I+NN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 3   QALWVAKTGLDAQQTRMSVISNNLANTNTTGFKRDRAAFEDLLYQQVRAPG--GSTSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V+ PD T  YTR G+F
Sbjct: 61  QLPTGLQLGTGVRVVSTFKGFDQGSQQQTGRALDVMVNGRGFFEVQMPDGTSAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+++GQLVT  G  L PGI +PE  + + +   G I       +  Q +G L + +FIN
Sbjct: 121 QINAQGQLVTNSGYPLQPGIQVPEGAQSLTIGNDGTISVTLAGQAAAQEIGALTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+  G+NL   T+ SG      P   G  +  QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQAKGENLFVETTASGPAQNGTPGLNGLGNTVQGALEGSNVNTVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDSMLGYLNN 259


>gi|89092138|ref|ZP_01165093.1| flagellar basal-body rod protein FlgG [Oceanospirillum sp. MED92]
 gi|89083873|gb|EAR63090.1| flagellar basal-body rod protein FlgG [Oceanospirillum sp. MED92]
          Length = 261

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 163/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  GM+AQ TNL++I+NN+AN++T G+K+    F D +YQ  +  G  +Q+A++A 
Sbjct: 4   ALNVAKTGMTAQDTNLKVISNNLANVSTVGFKKDAVVFEDLMYQIRRQPG--AQTAEEAQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G GV+    + ++  GE+  T    D+A+ GRG+ QV  P+    YTR G  +
Sbjct: 62  LPSGLQVGLGVRTVGTQKLFGTGEIEITEEAFDVAINGRGFLQVTLPNGDTAYTRNGQLH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +++  +LVT +G  + P I +P E     +S  G +  VT  N+    +GQL +A+F+N 
Sbjct: 122 LNADNELVTPEGYQINPAITLPGEVVNFSISTDGVVEVVTAGNNTPTQIGQLQMADFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+++G NL   T  SG PIISNP + G   + QG LE SNV++V+E+ +MI+ QRAYE
Sbjct: 182 QGLQSLGQNLYQETGASGAPIISNPGENGTGILVQGALEGSNVNSVQELVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI  ADEM S +++
Sbjct: 242 MNSKVISTADEMLSYVSQ 259


>gi|217976225|ref|YP_002360372.1| flagellar basal body rod protein FlgG [Methylocella silvestris BL2]
 gi|217501601|gb|ACK49010.1| flagellar basal-body rod protein FlgG [Methylocella silvestris BL2]
          Length = 262

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 139/260 (53%), Positives = 184/260 (70%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQ  N+ +IANNIANINTTG+KRARAEF D LYQAE++ G  S+    
Sbjct: 1   MKALSIAATGMAAQDLNVAVIANNIANINTTGFKRARAEFTDLLYQAERLQGVSSRGQSN 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + PEG  +G GV+ +S+RN++ QG + +TGN LD AL GRGWFQV   +   +YTRAG+
Sbjct: 61  TI-PEGAQLGLGVRTASIRNLHIQGTLTNTGNKLDWALNGRGWFQVTDANGDTVYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN +  GQ+VT+DG  + P +++P    ++ VS+SG + A        Q +GQ+ +ANF 
Sbjct: 120 FNTNGTGQIVTSDGYIVSPTMIVPTNAVDVTVSQSGMVSATLSGQPAPQQLGQISLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G+NL  +T  SG PI+  P D GFA V Q YLE+SNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLTPLGNNLYRQTEASGSPIVGVPGDPGFATVSQSYLESSNVDPVKEITDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI+AA EM S ++K
Sbjct: 240 YEMNSKVIQAASEMESTVSK 259


>gi|85859196|ref|YP_461398.1| flagellar basal-body rod protein [Syntrophus aciditrophicus SB]
 gi|85722287|gb|ABC77230.1| flagellar basal-body rod protein [Syntrophus aciditrophicus SB]
          Length = 260

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 101/262 (38%), Positives = 158/262 (60%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   AA GM AQQ   +++ANN+AN+NT G+K++RA+F D +YQ    AG  S+++  
Sbjct: 2   IRSLWTAATGMQAQQVEQDVVANNLANVNTVGFKKSRADFQDLMYQLSTKAG--SETSSG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +  GI IG GV+  + + +++QG+   TGN+ D A+ G G+FQ++    T +YTRAG+
Sbjct: 60  NQLTVGIEIGMGVKPVATQKIFSQGDYQQTGNSFDWAIEGDGFFQLDDN-GTTVYTRAGN 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G L   DG  L+P + IP++     +   G       +N +    G++ +A FI
Sbjct: 119 FKVNRDGVLCNTDGLQLIPEVSIPQDAVTFTLDSGGT-WTAADENGNTLATGRIELAKFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL +IG NL  +T  SG+P+  NP + G     Q +LE SNV+ + E+ +MI  QRA
Sbjct: 178 NPAGLSSIGRNLFEKTEGSGEPLTGNPGEDGLGTTSQRFLEMSNVNVIDEMVKMIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSK I  AD M S+I  ++
Sbjct: 238 YEINSKSIVTADNMLSMINNLK 259


>gi|293605005|ref|ZP_06687401.1| flagellar basal-body rod protein FlgG [Achromobacter piechaudii
           ATCC 43553]
 gi|292816610|gb|EFF75695.1| flagellar basal-body rod protein FlgG [Achromobacter piechaudii
           ATCC 43553]
          Length = 261

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 155/262 (59%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+  QQT++++I+NN+AN++T G+KR RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWIAKTGLEGQQTSMDVISNNLANVSTNGFKRGRAVFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G ++++   ++T G + +TG  +D+A+ GRG+ QVE PD T  YTR G+
Sbjct: 60  TQLPSGLQLGTGARVAATERIHTAGNLNNTGGEMDIAINGRGFLQVELPDGTQGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
              D  GQL T  G  + P + +P+    I + + G +       +       QL IA F
Sbjct: 120 LQRDQNGQLTTVSGYVIQPPMNVPDNALSISIGKDGIVSVTQPGAAGVNVQIGQLQIATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL++IG+NL   T  SG   +  P   G   + Q Y+E SNV+  +E+  MI+ QR
Sbjct: 180 INPTGLQSIGENLYLETDASGPANLLQPGVDGAGSIMQNYVETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|90577346|ref|ZP_01233157.1| putative flagellar basal-body rod protein [Vibrio angustum S14]
 gi|90440432|gb|EAS65612.1| putative flagellar basal-body rod protein [Vibrio angustum S14]
          Length = 261

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 152/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQLNQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G G+FQ+E  D  VM++R G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNSQNTQQQLDLAVMGSGFFQIENSDGEVMFSRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V   G  L P I IPEE   I +   G + A    +   Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNGQGLPLQPQIQIPEEANTISIGVDGIVTATLAGDPQPQELGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  IG NL   T  SG P        G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAIGGNLYKETQASGQPQEMIAGADGAGSLKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|99082800|ref|YP_614954.1| flagellar basal body rod protein FlgG [Ruegeria sp. TM1040]
 gi|99039080|gb|ABF65692.1| Flagellar basal-body rod protein flgG [Ruegeria sp. TM1040]
          Length = 261

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 116/262 (44%), Positives = 163/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN+NTT Y   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQLRVETISNNLANMNTTAYNARRAEFADLHYQQISRAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V     QG +  TGN LDLA+ G G+F+V  P     YTR GS
Sbjct: 60  TVLPTGVQVGLGVRPAAVSVYLNQGALSQTGNELDLAIDGNGYFEVTLPSGETAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F   ++G +VT DG  + P I +PE+ + I ++  G++ A      + + +GQ  ++ F 
Sbjct: 120 FKRSAEGLIVTNDGYPVSPEITVPEDAKSISINGEGEVYAYFNDTIEAELLGQFTLSGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL  +T  SG P  + P   G   ++Q YLE S+VDAV+EI+E+I AQR 
Sbjct: 180 NPKGLEAMGGNLFKQTEASGQPNTTEPGADGIGFLRQKYLEDSSVDAVREITELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI A D+M S  T++R
Sbjct: 240 YEMNSKVISAVDQMMSATTQVR 261


>gi|238752865|ref|ZP_04614330.1| Lateral flagellar rod protein (FlgG-like) [Yersinia rohdei ATCC
           43380]
 gi|238708904|gb|EEQ01157.1| Lateral flagellar rod protein (FlgG-like) [Yersinia rohdei ATCC
           43380]
          Length = 261

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 97/258 (37%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   +  I+NN+AN+NT G+KR R  F D  YQ ++  G+P        
Sbjct: 4   ALWVSKTGLAAQDAKMNAISNNLANVNTDGFKRDRVVFEDLFYQNQRTPGTPLD--QNNA 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI +GSGV++   +  +T G +  T   LD+A+ G+G+FQ+ET D  + YTRAG+  
Sbjct: 62  TPNGIQLGSGVKVVGTQKQFTVGNIKVTKGELDVAIAGKGFFQIETSDGGLAYTRAGNLA 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I++ G LV A G  L+P I +P  +  + + + G + A  G  S+   +GQ+ + +F+N 
Sbjct: 122 INADGVLVNAQGMPLIPQIELPAGSSNLAIGKDGTVTAQVGGESEPAELGQITLVDFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G N+   T  SG  +   P +  F  ++ G LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNMYKETVASGTAVEGVPGEEAFGQLEHGSLEGSNVQVVEEMVDMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   +T+
Sbjct: 242 MNAKMVSAADDMLKFVTQ 259


>gi|238762358|ref|ZP_04623329.1| Lateral flagellar rod protein (FlgG-like) [Yersinia kristensenii
           ATCC 33638]
 gi|238699343|gb|EEP92089.1| Lateral flagellar rod protein (FlgG-like) [Yersinia kristensenii
           ATCC 33638]
          Length = 261

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 97/258 (37%), Positives = 151/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G++AQ   +  I+NN+AN+NT G+KR R  F D  YQ ++  GSP        
Sbjct: 4   ALWISKTGLAAQDAKMNAISNNLANVNTDGFKRDRVVFEDLFYQNQRSPGSPLN--QNTA 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI  GSGV++   +  +T G +  T    D+A+ G+G+FQ+ET D  + YTRAG+ +
Sbjct: 62  TPNGIQFGSGVKVVGTQKQFTVGNIKVTKGEFDVAIAGQGFFQIETADGGLAYTRAGNLS 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I++ G L  A G  L+P I +P    ++ + + G + A  G  ++   +GQ+ + NF+N 
Sbjct: 122 INADGVLTNAQGMPLIPQIELPAGANDLAIGKDGTVTARLGGEAEPAELGQITLVNFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G N+   T  SG  +   P +  F  ++ G LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNMYKETVASGTAVEGVPGEEAFGQLEHGSLEGSNVQVVEEMVDMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   +T+
Sbjct: 242 MNAKMVSAADDMLKFVTQ 259


>gi|268589980|ref|ZP_06124201.1| flagellar basal-body rod protein FlgG [Providencia rettgeri DSM
           1131]
 gi|291314698|gb|EFE55151.1| flagellar basal-body rod protein FlgG [Providencia rettgeri DSM
           1131]
          Length = 260

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 100/261 (38%), Positives = 162/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQTNL++I+NN+AN++T G+KR RA F D +YQ  +  G  + S+++
Sbjct: 2   IRSLWIAKTGLDAQQTNLDVISNNLANVSTNGFKRQRAVFEDLMYQNIRQPG--AMSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G +  +   ++ QG +  TGN  D+A+ G+G+  V+ PD T  YTR G+
Sbjct: 60  TSLPSGLQMGTGSRPVATMRIHAQGALNKTGNTNDIAIRGQGFLHVQMPDGTDAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              +  GQLVT+ G  +VP I+IP+    + ++R G +      ++  Q +GQ+ +  FI
Sbjct: 120 LQPNQDGQLVTSSGYQIVPAIMIPDNANSLSIARDGTVTITVYGDNQPQQIGQITLTTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL ++G+NL   T+ SG P  S P   G   + Q  LE SNV+  +E+  MI  QRA
Sbjct: 180 NDAGLESMGENLYMETASSGAPNESAPGTNGAGLLYQNMLETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK + A+D+M   +T++
Sbjct: 240 YEINSKAVSASDQMLQRLTQL 260


>gi|89072313|ref|ZP_01158892.1| putative flagellar basal-body rod protein [Photobacterium sp.
           SKA34]
 gi|89051845|gb|EAR57297.1| putative flagellar basal-body rod protein [Photobacterium sp.
           SKA34]
          Length = 261

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 152/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQLNQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G G+FQ+E  D  VM++R G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNSQNTQQQLDLAVMGSGFFQIENSDGEVMFSRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V   G  L P I IPEE   I +   G + A    +   Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNGQGLPLQPQIQIPEEANTISIGVDGIVTATLAGDPQPQELGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG P        G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLYKETQASGQPQEMIAGIDGAGSLKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|303248239|ref|ZP_07334502.1| flagellar basal-body rod protein FlgG [Desulfovibrio fructosovorans
           JJ]
 gi|302490377|gb|EFL50288.1| flagellar basal-body rod protein FlgG [Desulfovibrio fructosovorans
           JJ]
          Length = 260

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 95/262 (36%), Positives = 152/262 (58%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A  GM A Q  ++ ++NN+AN+NT G+K++RAEF D +YQ  +VAG  +++   
Sbjct: 2   MRSLWTATTGMVAMQMQIDTMSNNLANVNTVGFKKSRAEFEDLMYQTLQVAG--TETTGG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++V   +TQG++ +TGN LD+A+ G+G+F+V   +   +YTRAGS
Sbjct: 60  NRIPTGLQVGLGVKPTTVHKFFTQGDLQNTGNQLDIAIQGQGFFKV-DVNGRELYTRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +V++ G  L P   +P +T+ I ++ +G +  +     D      + +  FI
Sbjct: 119 FKLNQDGTIVSSGGYPLQPTFSVPTDTKTITITENGHLSCLDLNG-DTLAETDIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +G+   G NL + T  SG      P D     + QGYLE SNV+ V E+  +I  QRA
Sbjct: 178 NPSGMTAEGRNLYSTTQASGTANEVTPGDQNAGTLAQGYLEMSNVELVDEMVGLIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  AD M      ++
Sbjct: 238 YEANSKAITTADGMLQTAVNVK 259


>gi|149912834|ref|ZP_01901368.1| flagellar basal-body rod protein FlgG [Roseobacter sp. AzwK-3b]
 gi|149813240|gb|EDM73066.1| flagellar basal-body rod protein FlgG [Roseobacter sp. AzwK-3b]
          Length = 261

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 164/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ  +E I+NN+AN++TTGY   RAEF+D  YQ     G+ + ++D 
Sbjct: 1   MRALKIAATGMTAQQLRVETISNNLANMSTTGYNTRRAEFSDLHYQQMARPGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V     QG +  T  +LDLA+ G G+ +V  P     YTR G+
Sbjct: 60  TVLPTGVQLGLGVRPAAVSIHLAQGSLSATNGDLDLAIDGNGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               + G +VT+DG +LVP I IP + R I ++ +G++ A   + ++ Q +G++ +A F 
Sbjct: 120 LKRSADGLIVTSDGFSLVPEITIPADVRSISINAAGEVFAYFAETTEAQQIGEITLAGFS 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL   G+NL   T  SG  ++S P   G   ++QGYLE S+VD V+E++E+I AQR 
Sbjct: 180 NPKGLEAAGNNLFLETEASGPSLVSTPGQDGLGTLRQGYLEDSSVDPVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M     ++R
Sbjct: 240 YELNAKVISAADQMLGATAQVR 261


>gi|146295641|ref|YP_001179412.1| hypothetical protein Csac_0595 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409217|gb|ABP66221.1| protein of unknown function DUF1078 domain protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 267

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 96/270 (35%), Positives = 145/270 (53%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A   +     
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRADVIA----G 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   +++G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFSEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +  +G+I     +        
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDETGRITYKDAEGQIQDSGF 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SGDP+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSAASGDPVSEEEIEGPKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSMANNLK 266


>gi|84624090|ref|YP_451462.1| flagellar basal body rod protein FlgG [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|161898985|ref|YP_201214.2| flagellar basal body rod protein FlgG [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|166712060|ref|ZP_02243267.1| flagellar basal body rod protein FlgG [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188576758|ref|YP_001913687.1| flagellar basal body rod protein FlgG [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188576950|ref|YP_001913879.1| flagellar basal body rod protein FlgG [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|84368030|dbj|BAE69188.1| flagellar biosynthesis cell-distal portion of basal-body rod
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521210|gb|ACD59155.1| flagellar basal-body rod protein FlgG [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188521402|gb|ACD59347.1| flagellar basal-body rod protein FlgG [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 261

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 151/259 (58%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQQT + +I+NN+AN NTTG+KR RA F D LYQ  +  G    ++ + 
Sbjct: 3   QALWVAKTGLDAQQTRMSVISNNLANTNTTGFKRDRAAFEDLLYQQVRAPG--GSTSAQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ S    + QG    TG  LD+ + GRG+F+V+ PD T  YTR G+F
Sbjct: 61  QLPTGLQLGTGVRVVSTFKGFDQGSQQQTGRALDVMVNGRGFFEVQMPDGTSAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I+++GQLVT  G  L PGI +PE  + + +   G I       +  Q +G L + +FIN
Sbjct: 121 QINAQGQLVTNSGYPLQPGIQVPEGAQSLTIGNDGTISVTLAGQAAAQEIGALTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL++ G+NL   T+ SG      P   G  +  QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQSKGENLFVETTASGPAQNGTPGLNGLGNTVQGALEGSNVNTVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDAMLGYLNN 259


>gi|329898287|ref|ZP_08272370.1| Flagellar basal-body rod protein flgG [gamma proteobacterium
           IMCC3088]
 gi|328920852|gb|EGG28295.1| Flagellar basal-body rod protein flgG [gamma proteobacterium
           IMCC3088]
          Length = 261

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +  +A  G++AQQ  + +IANN+AN+NT G+K+ RA F D LYQ  +  G+ + +  + +
Sbjct: 4   SLWVAKTGLTAQQMRMTVIANNLANVNTVGFKKDRAVFEDLLYQNVRQPGASADA--QTI 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P G+ +G+G +I +   ++ QG ++ T N LDLA+ GRG+FQ++  D T  YTR GSF 
Sbjct: 62  APTGLMLGTGTRIIATEKIHRQGNMISTENALDLAIAGRGFFQIQQADGTFAYTRDGSFK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++ +GQ++TA G  +VP I +P  +  + V R G + A     +    +GQ+ +A FINE
Sbjct: 122 LNDQGQVITASGQLMVPAITVPVNSASLTVGRDGTVDAELEAGAGKVTLGQIQLARFINE 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL++IG NL   T+ SG   +  P   G   + QG LEASNV+ V+E+  MI  QRAYE
Sbjct: 182 AGLQSIGRNLYRETTASGPVEVGVPGISGIGELTQGSLEASNVNVVEEMVNMIETQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK I AAD M   +  
Sbjct: 242 VNSKAISAADGMLRFLNN 259


>gi|260779345|ref|ZP_05888237.1| flagellar basal-body rod protein FlgG [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605509|gb|EEX31804.1| flagellar basal-body rod protein FlgG [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 261

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +       
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--ALVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPAGVQLGSGVRVVGTQKVFTQGNTQNTSQELDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I IPE    + V   G + A T  ++  Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNSQGLPLEPQIQIPENALSVSVGVDGTVSATTADSTAPQELGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETEASGQADELIAGEDGVGSIKQGSLEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|296531727|ref|ZP_06894555.1| flagellar basal-body rod protein FlgG [Roseomonas cervicalis ATCC
           49957]
 gi|296267943|gb|EFH13742.1| flagellar basal-body rod protein FlgG [Roseomonas cervicalis ATCC
           49957]
          Length = 260

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 172/262 (65%), Gaps = 2/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTN+E+IA+NIAN++TT + R +AEF D LYQ+ +  GS S S   
Sbjct: 1   MRAMNIAATGMQAQQTNVEVIAHNIANVSTTAFTRRKAEFQDLLYQSGERVGSAS-SEAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G  +G GV+ S++  +  QG +  TGN  DLAL GRG+F ++ PD TV YTR GS
Sbjct: 60  TLLPVGTQVGLGVRNSAINRITVQGTLNETGNRYDLALEGRGYFGIDLPDGTVAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +  +GQ+VT +G  + P I +P + R++ V+++G++L         Q  G+L +  F 
Sbjct: 120 FKLSQEGQIVTTEGYPIQPAINVPIDARDVTVNQAGEVLVTQANGQQ-QNAGRLNLFLFP 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IG N    T  SG P    P D G+A V+QGYLEASNV+ V+EI+++I+AQRA
Sbjct: 179 NEAGLEAIGGNKFLETEASGQPNQGLPSDPGYARVRQGYLEASNVNVVQEITQLIAAQRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVIEA D+M      +R
Sbjct: 239 YEMNSKVIEATDQMLQTANNVR 260


>gi|126738578|ref|ZP_01754283.1| flagellar basal-body rod protein FlgG [Roseobacter sp. SK209-2-6]
 gi|126720377|gb|EBA17083.1| flagellar basal-body rod protein FlgG [Roseobacter sp. SK209-2-6]
          Length = 261

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 161/262 (61%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN+NTT Y   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQLRVETISNNLANMNTTAYNARRAEFADLHYQQVSRAGTIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ +++     QG +  T ++LD+A+ G+G+ +V  P     YTR G+
Sbjct: 60  TVLPTGVQVGLGVRPAAISVHLNQGALKQTNSDLDVAIEGKGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG  + P I IP +   I ++  G++ A   +++  Q +GQ  +A F 
Sbjct: 120 LKRSAEGLIVTSDGYPVSPEITIPNDALSISINPEGEVYAYFDESTAGQLLGQFNLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL   T  SG    S   + G   ++QGYLE S+VD+V+E++E+I AQR 
Sbjct: 180 NPKGLEALGSNLFIATEASGAANTSTAGEDGLGSLRQGYLEGSSVDSVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M    T++R
Sbjct: 240 YEMNAKVISAVDQMMGATTQVR 261


>gi|309388846|gb|ADO76726.1| flagellar basal-body rod protein FlgG [Halanaerobium praevalens DSM
           2228]
          Length = 260

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 166/262 (63%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + A   +A GM++QQTN+++I+NN+AN+NT+G+K+++  FAD +Y   +  G+P+  A  
Sbjct: 2   ISALWTSATGMNSQQTNIDVISNNLANVNTSGFKKSKINFADLIYTQMRQPGTPN--AQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A VP GI IG G +++S + ++TQG + +T + LD+ + G G F+V+ PD    YTR GS
Sbjct: 60  AEVPTGIEIGHGSKVNSTQKIFTQGNIQNTDSPLDMVIEGDGLFRVQLPDGNFAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  DS G +VT+DG  L PG  IP+E  EI ++  G I A+    +    +GQ+ +  F 
Sbjct: 120 FKQDSNGNVVTSDGYQLDPGFQIPQEATEISITSDGTINALVDGENQ--QLGQIQLYRFA 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL + G NL + T  SG  +   P + GF  V QG+LE SNV  V+E+  MI+AQRA
Sbjct: 178 NPAGLSSEGRNLYSDTVASGQAMQGVPGEQGFGTVTQGFLEMSNVKVVEEMVNMIAAQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I+A+DEM     +++
Sbjct: 238 YETNSKSIQASDEMLQTANQLK 259


>gi|254421122|ref|ZP_05034846.1| flagellar basal-body rod protein FlgG [Brevundimonas sp. BAL3]
 gi|196187299|gb|EDX82275.1| flagellar basal-body rod protein FlgG [Brevundimonas sp. BAL3]
          Length = 262

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 126/262 (48%), Positives = 172/262 (65%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM+AQQ N+E+I+NNIAN+NT G+K+ RAEF D LYQ  +  G+ S S+  
Sbjct: 1   MQALRTAASGMAAQQLNVEVISNNIANMNTVGFKKQRAEFQDLLYQNVERMGAQS-SSQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP GI IG+GV+  +V  V  QG    TGN+ D+A+ G+G+FQ+  P   + YTRAG+
Sbjct: 60  TVVPTGIQIGAGVKAGAVYRVTEQGTPAQTGNDYDMAIDGKGYFQITLPSGEIGYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
             ++ +GQ+VT DG  L P + IP++  ++ +S+SG +       +    VGQ+ +A F 
Sbjct: 120 LQVNQEGQIVTDDGYALQPAVTIPQDATDVTISKSGLVQVTQAGQTAPTTVGQIELATFF 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNLL  T+ SG   I  P   GF  + QGY EASNVD+V EIS +I AQRA
Sbjct: 180 NEAGLEAIGDNLLLETAASGAANIGTPGSPGFGKILQGYTEASNVDSVAEISALIIAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  AD M S+  +++
Sbjct: 240 YEMNSKVISTADNMLSVTAQVK 261


>gi|187478187|ref|YP_786211.1| flagellar basal body rod protein FlgG [Bordetella avium 197N]
 gi|115422773|emb|CAJ49301.1| flagellar basal-body rod protein [Bordetella avium 197N]
          Length = 261

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 97/262 (37%), Positives = 161/262 (61%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+ +QQT++++I++N+AN+ T G+KR RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWIAKTGLESQQTSMDVISHNLANVQTNGFKRERAVFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G ++++ + +++ G + +TG  +D+A+ GRG+FQV+ PD T  YTR G 
Sbjct: 60  NQLPTGLQLGTGARVAATQRLHSAGNLNNTGAEMDVAIQGRGFFQVDLPDGTQAYTRDGG 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
             +D  GQL T  G  + P I +P+    + +++ G +      N+       QL +A F
Sbjct: 120 LGMDQNGQLTTMGGYVIQPPINVPDNALSMAINKEGVVSVTLPGNAGVNVQIGQLQVATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL+++G+NL   T  SG   +  P   G   + Q Y+E SNV+  +E+  MI+AQR
Sbjct: 180 INPAGLQSVGENLYLETDASGPANLLQPGADGAGSIMQNYVETSNVNVAEELVNMITAQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|149191155|ref|ZP_01869413.1| putative flagellar basal-body rod protein [Vibrio shilonii AK1]
 gi|148834993|gb|EDL51972.1| putative flagellar basal-body rod protein [Vibrio shilonii AK1]
          Length = 261

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 151/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  GM+AQ   +  I+NN+ANINT G+KR R  F D  Y  +K AG  +++ +   
Sbjct: 4   ALWISKTGMAAQDAKMTAISNNLANINTVGFKRDRVVFEDLFYSVDKQAG--TETTELNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI +G+GV++     V+TQG V +T    DLA++G G+FQ+E  D  ++YTR G F 
Sbjct: 62  HPTGIQLGNGVRVVGTEKVFTQGNVQNTNQQFDLAILGDGFFQIENSDGELLYTRNGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +S GQLV   G  L+P IVIP E   + ++  G   A      + + +GQ+ I  F+N 
Sbjct: 122 TNSDGQLVNTQGYPLIPEIVIPPEATLVSITADGVATATIPGQVNPEALGQITIVKFMNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G NL A T  SG+ +       G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLAAQGGNLFAETEGSGEAVELVAGTEGSGQLKQGALEGSNVQVVEEMVDMIATQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           M++K++ AADEM   I +
Sbjct: 242 MSAKMVSAADEMLQYIAQ 259


>gi|323704841|ref|ZP_08116418.1| flagellar basal-body rod protein FlgG [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535767|gb|EGB25541.1| flagellar basal-body rod protein FlgG [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 266

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 99/268 (36%), Positives = 144/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM+AQQ N+++I+NN+AN+NTT +KR RAEF D +YQ  +           
Sbjct: 2   IRALWSAASGMNAQQLNVDVISNNLANVNTTAFKRDRAEFQDLIYQTLQTE----DVNGG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +++G +  T N LD+AL G G+F V  PD    YTR GS
Sbjct: 58  QGKPVNMQVGVGVRPSAIVKDFSEGSLQETDNPLDVALDGEGFFAVLGPDGNTYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQ------ILAVTGKNSDFQPVGQL 174
           F +       T       P +           ++         +++V   +   Q V  L
Sbjct: 118 FKLSVDQNTATLTTADGYPVLDDGGNPITFDSTQKDISISPLGVISVKNSDGTQQDVATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF N  GL + GDNL   T+ SGDP   +       +V+QG+LE SNV  V E+  M
Sbjct: 178 GIYNFQNPDGLLDKGDNLYEATAASGDPGTRDDFQGRMGNVRQGFLETSNVQVVNEMVNM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AAD+M S+   +R
Sbjct: 238 IAAQRAYELNSKAIQAADDMLSIANNLR 265


>gi|154249604|ref|YP_001410429.1| flagellar basal-body rod protein FlgG [Fervidobacterium nodosum
           Rt17-B1]
 gi|154153540|gb|ABS60772.1| flagellar basal-body rod protein FlgG [Fervidobacterium nodosum
           Rt17-B1]
          Length = 261

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 165/262 (62%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +   AA GM  QQ  ++ ++NNIAN++T GYK+ +AEF D +Y   K AG  + +A  
Sbjct: 2   INSLYTAATGMWTQQFKMDTVSNNIANVDTAGYKKIKAEFQDLIYSYSKNAG--AATAQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +  P GI +G GV++++   ++TQG + +TGN LDLA+ G G+FQ++  D  + YTR G 
Sbjct: 60  STTPTGIYVGHGVKLAATTKIFTQGNLENTGNALDLAITGDGFFQIQLQDGRIAYTRDGQ 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +DS+G++VTA+G  L P IV+P+    + VS  G +       +  Q +G + +  F+
Sbjct: 120 FKLDSQGRVVTANGLLLSPAIVVPQNAVSLTVSPDGIVSVELADGT-IQQLGTITLVRFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL++IGDNL  +T+ SG+PI       GF  + QGY+E SNVD VKE+ +MI+A RA
Sbjct: 179 NPAGLKSIGDNLYLQTNASGEPIEGVGGQDGFGTIMQGYVEKSNVDVVKEMVDMITAMRA 238

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NS+ I  AD+M    + +R
Sbjct: 239 YEFNSRSIITADQMLQTASNLR 260


>gi|91794993|ref|YP_564644.1| flagellar basal-body rod FlgG [Shewanella denitrificans OS217]
 gi|91716995|gb|ABE56921.1| Flagellar basal-body rod FlgG [Shewanella denitrificans OS217]
          Length = 261

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G   Q  +   
Sbjct: 4   ALWVSKTGLAAQDTKMTTIANNLANVNTTGFKRDRVAFNDLFYQVQRQPG--GQVDELNQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G +++  + V+T G+V +T   LDLA+ G G+FQVE P+  + YTR G F 
Sbjct: 62  LPSGLQLGTGTRVAGTQKVFTTGDVHNTSQQLDLAIEGNGFFQVEEPNGDLAYTRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
             S+G +VT+ G  LVP IVIPE++  I ++  G ++A    +++ Q +GQ+ + NF N 
Sbjct: 122 RSSEGMMVTSQGLPLVPNIVIPEDSTNITIATDGIVMATIAGDAEPQELGQITLINFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G+NL   T+ SG  +     D     ++QG LE SNV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEARGNNLYRETAASGVAVEGVAGDQALGGLRQGSLEGSNVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|85712256|ref|ZP_01043307.1| Flagella basal body rod protein [Idiomarina baltica OS145]
 gi|85693883|gb|EAQ31830.1| Flagella basal body rod protein [Idiomarina baltica OS145]
          Length = 262

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 161/259 (62%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQ ++ +I+NN+AN +T G+K++RA F D LYQ     G   QSA    
Sbjct: 4   ALWISKTGLDAQQRDISVISNNLANASTVGFKKSRAIFEDLLYQNINQPG--GQSAQDVE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  +TQG V  T N+LD+ + G+G+FQV  PD T+ YTR G F+
Sbjct: 62  LPNGLMLGAGTKVVATQKSHTQGNVQTTDNSLDVMINGKGFFQVLMPDGTLSYTRNGQFS 121

Query: 123 IDSKGQ-LVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G  + + +G  + P I IPE+   + +S+ G++      N+    +GQL +A+FIN
Sbjct: 122 VNEEGTLVTSGNGYPIEPQIQIPEDAISLSISQEGEVTVRQPGNAQNAVIGQLNLASFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL  IG NL   T+VSG P  S P   G  +V+QG LE SNV+  +E+  +I AQR Y
Sbjct: 182 PAGLEPIGQNLYKETAVSGAPQESVPGVDGVGNVRQGMLETSNVNVTEELVNLIEAQRGY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M S I +
Sbjct: 242 EMNSKVISSVDQMLSYINQ 260


>gi|32490792|ref|NP_871046.1| flagellar basal body rod protein FlgG [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25165998|dbj|BAC24189.1| flgG [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 260

 Score =  222 bits (564), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 166/261 (63%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++  IA  G+ AQQ N+++I+NNI+N++T G+KR +A F D LYQ  +  G  ++S+++
Sbjct: 2   IRSLAIAKTGLEAQQINMDVISNNISNVSTNGFKRQKAIFEDLLYQTIRQPG--AKSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G+GV  S+   ++ QG + +TGN  D+A+ G G+FQV   D T MYTR GS
Sbjct: 60  TILPSGLQLGTGVNSSATIKIHLQGGLTNTGNETDIAIQGPGFFQVLMSDGTNMYTRNGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT++G  + P I IP  +  + +S+ G +  +    +  Q VGQL I+ FI
Sbjct: 120 FQLDQYGQLVTSNGYPVQPSITIPNGSSNLTISKDGIVSVMVPGQTQPQEVGQLTISTFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL + G++L   T  SG P  + P   G   +KQ ++E SNV+  +E+  MI  QRA
Sbjct: 180 NSSGLESAGESLYKETQSSGSPADNTPGMNGAGSLKQKFVENSNVNIAEELITMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSKVI  +D+M   ++++
Sbjct: 240 YELNSKVISTSDQMLQRLSQL 260


>gi|89056684|ref|YP_512135.1| flagellar basal body rod protein FlgG [Jannaschia sp. CCS1]
 gi|88866233|gb|ABD57110.1| flagellar basal-body rod protein FlgG [Jannaschia sp. CCS1]
          Length = 261

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 166/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +++I+NNIAN++TTGY   RA+FAD  YQ    AG+ + ++D 
Sbjct: 1   MRALDIAATGMSAQQLRVDVISNNIANMSTTGYSPRRADFADLHYQQMVRAGAIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP G+ IG GV+ ++V   + QG +  TG  LD+A+ GRG+ +V  P     YTR G+
Sbjct: 60  TVVPAGVQIGLGVRPAAVTVTWEQGTLGATGGQLDVAIEGRGYLEVTLPSGDNAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
                 G +VT DG  + PGI IP++ +EI ++ +G++ A        Q +GQL +  F 
Sbjct: 120 LQRTGDGLIVTNDGFEVNPGITIPDDAQEITINANGEVFASFRGEIQPQLLGQLNMVRFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL  IG NL   T  SG P+  +P + G    +QGY+E S+VDAV+EI+++I AQR 
Sbjct: 180 NDNGLEAIGSNLFLETGASGAPLAGDPGEDGMGTFRQGYVEQSSVDAVREITDLIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KV+ AAD++    T++R
Sbjct: 240 YELNAKVLTAADQILGATTQVR 261


>gi|257095357|ref|YP_003168998.1| flagellar basal-body rod protein FlgG [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047881|gb|ACV37069.1| flagellar basal-body rod protein FlgG [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 260

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++   A+ G++AQQ  ++IIANN+AN++T G+K+AR  FAD LYQ  +  G  +QS+  
Sbjct: 2   IRSLWTASTGLTAQQVQIDIIANNLANVSTNGFKQARGIFADLLYQTLRQPG--AQSSQT 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P+G+ IG GV   S   ++TQG +  TGN LD+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  TQIPDGLQIGLGVTPVSTGRIFTQGSLQQTGNALDMAIDGAGFFQVLLPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D++GQ+VTA+G  L P I IP +   + V+  G +       +    +G + +A F+
Sbjct: 120 FQKDNQGQIVTANGYPLQPAITIPAQALTVTVATDGVVSITLPTTTAPVQIGTIQVATFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL+++G+NL   T+ SG    + P   G   V Q Y+EASNV+  +E+  MI  QRA
Sbjct: 180 NNGGLQSVGENLYLETASSGTATPNTPGTNGSGVVVQNYVEASNVNVAQELVLMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+N+KV+  +D+M + +T++
Sbjct: 240 YELNAKVVSTSDQMLARLTQL 260


>gi|330447905|ref|ZP_08311553.1| flagellar basal-body rod protein FlgG [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492096|dbj|GAA06050.1| flagellar basal-body rod protein FlgG [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 261

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 152/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQLNQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G G+FQ+E  D  VMY+R G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNSQNTQQQLDLAVMGSGFFQIENSDGQVMYSRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V   G  L P I IPEE   I +   G + A    + + Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNGQGLPLQPQIQIPEEANSISIGVDGIVTATLAGDPEPQELGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG          G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLYKETQASGQAQEIIAGTDGAGSLKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|238927617|ref|ZP_04659377.1| flagellar basal body rod protein [Selenomonas flueggei ATCC 43531]
 gi|238884542|gb|EEQ48180.1| flagellar basal body rod protein [Selenomonas flueggei ATCC 43531]
          Length = 264

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 103/264 (39%), Positives = 158/264 (59%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ+ ++++A+NIAN+NT G K+ RAEF D +YQ  + AG  +++   
Sbjct: 2   MRALWSAASGMKAQQSQMDVVAHNIANVNTYGGKKVRAEFQDLVYQTLREAG--ARNGAD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +  P  + IG G ++++ + V+TQG +  T N  D+ + G G+F+V  PD T  YTR G+
Sbjct: 60  SQYPTALQIGLGTRLAATQRVFTQGALQTTDNPTDIGIQGEGFFRVTMPDGTTAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETR--EIKVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           + +DS  ++VT+DG  L  GI I +      I +S  G++       +  Q  GQ+ +A 
Sbjct: 120 WKLDSDRRMVTSDGYLLADGITIGQNAPLDSITISGDGRVSYREAGQNQQQEAGQITLAR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  +G NL   +  SG+ I SNP + G   + QG LE SNV  V+E+  MI +Q
Sbjct: 180 FVNPAGLTAVGKNLFVVSDASGEAIESNPGEDGAGTLTQGTLEMSNVQIVEEMVNMIVSQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE NSK I  +D M  +  +++
Sbjct: 240 RAYESNSKAITTSDSMLEIANQLK 263


>gi|323492336|ref|ZP_08097489.1| flagellar basal body rod protein FlgG [Vibrio brasiliensis LMG
           20546]
 gi|323313383|gb|EGA66494.1| flagellar basal body rod protein FlgG [Vibrio brasiliensis LMG
           20546]
          Length = 261

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T    DLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNTQNTSQQYDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I IP+    + V   G + A T  +S  + +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNSQGLPLEPQIQIPDNALSLSVGVDGTVTATTVDSSTPEQLGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETEASGQADELTAGEDGVGIIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|153831580|ref|ZP_01984247.1| flagellar basal-body rod protein FlgG [Vibrio harveyi HY01]
 gi|156976143|ref|YP_001447049.1| flagellar basal body rod protein [Vibrio harveyi ATCC BAA-1116]
 gi|269960118|ref|ZP_06174494.1| Putative flagellar basal-body rod protein flgG [Vibrio harveyi
           1DA3]
 gi|148872090|gb|EDL70907.1| flagellar basal-body rod protein FlgG [Vibrio harveyi HY01]
 gi|156527737|gb|ABU72822.1| hypothetical protein VIBHAR_04914 [Vibrio harveyi ATCC BAA-1116]
 gi|269835089|gb|EEZ89172.1| Putative flagellar basal-body rod protein flgG [Vibrio harveyi
           1DA3]
          Length = 261

 Score =  222 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 152/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNTQNTTQELDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I+S+G +V + G  L P I IP+      V   G +   +  +   Q +GQ+ +A FIN 
Sbjct: 122 INSEGLMVNSQGLPLEPQIQIPDNAISFSVGVDGTVTTTSADDPTPQQLGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETEASGPADELIAGEDGAGSIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|114570497|ref|YP_757177.1| flagellar basal body rod protein FlgG [Maricaulis maris MCS10]
 gi|114340959|gb|ABI66239.1| flagellar basal-body rod protein FlgG [Maricaulis maris MCS10]
          Length = 261

 Score =  221 bits (563), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 121/262 (46%), Positives = 175/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQ N+E+I+NN+AN+NTTG+KR RAEF D LYQ  +  G+ S S   
Sbjct: 1   MRALTTAATGMQAQQLNVEVISNNLANMNTTGFKRQRAEFQDLLYQNVQQMGAAS-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GVQ +S+  +  QG + +TGN  DLA+ G G+F+V+ PD +  +TRAG+
Sbjct: 60  TIVPTGVQVGLGVQTASIYRITEQGALSNTGNPFDLAVSGEGYFRVQMPDGSDGFTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +   G+LVT++G T+ PGI IP   R+I+++  GQ+       +D Q VGQ+ +A F 
Sbjct: 120 FAVSGDGELVTSEGYTVAPGIAIPNGARQIEINIQGQVQVQIDGQTDMQTVGQIELATFF 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  IG NL   T+ SG   +  P   GF  ++QG++E SNV++V EI+ +I AQRA
Sbjct: 180 NQAGLEAIGGNLFLETAASGSASLGTPGSPGFGDIQQGFVETSNVNSVSEITALIQAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN++VI A+DEM +  + +R
Sbjct: 240 YEMNARVITASDEMMAASSNLR 261


>gi|160896077|ref|YP_001561659.1| flagellar basal-body rod protein FlgG [Delftia acidovorans SPH-1]
 gi|160361661|gb|ABX33274.1| flagellar basal-body rod protein FlgG [Delftia acidovorans SPH-1]
          Length = 260

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 161/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  I+  GM AQQT L++I++N+AN++TTGYKRA A F D +YQ  + +G  +Q+ ++
Sbjct: 2   INSLFISKTGMEAQQTQLDVISHNLANVSTTGYKRASAVFEDLIYQNLRQSG--AQTTEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+  +    + QG +  + N LD+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  NQLPTGLHLGLGVRTVATSRNFLQGALQQSNNALDVAIDGNGFFQVNMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++GQLVTA G  +  G+ IP+   ++ +S  G +       +  Q VG + ++ FI
Sbjct: 120 FQVDAQGQLVTASGMPIANGVTIPQGATKVSISPEGVVSVTMAGQAAPQQVGNIAMSQFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL   T+ SG P    P   G   +KQGYLE SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLEPRGQNLFTETASSGQPQQGQPGVNGMGMIKQGYLEGSNVNVVQELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M + + ++
Sbjct: 240 YEMNSKAIQTSDQMLAKLAQL 260


>gi|114762164|ref|ZP_01441632.1| flagellar basal-body rod protein FlgG [Pelagibaca bermudensis
           HTCC2601]
 gi|114545188|gb|EAU48191.1| flagellar basal-body rod protein FlgG [Roseovarius sp. HTCC2601]
          Length = 261

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 160/262 (61%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN++N++TTGY   RAEFAD  YQ    AG+ S +AD 
Sbjct: 1   MRALKIAATGMSAQQMRVEVISNNLSNMSTTGYNARRAEFADLHYQQVARAGTVS-AADG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G G + ++V     QG +  TG +LDLA+ GRG+F+V  P     YTR G+
Sbjct: 60  TMLPTGVQLGLGARPAAVTMKLAQGALSQTGGDLDLAIEGRGYFEVTLPSDLAGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              D +G +VT+DG  + P IVIP++   + ++  G+I A      + Q +GQL +  F 
Sbjct: 120 LKRDGEGLIVTSDGLPVAPEIVIPDDATSLSINAEGEIYAYFNDAVEAQLLGQLTLVGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG PI +     G    + GYLE S+VD V EI+E+I AQR 
Sbjct: 180 NPKGLEAIGGNLFTETEASGPPIQTTAGQDGLGTFRHGYLEDSSVDPVYEITELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M     ++R
Sbjct: 240 YELNSKVISAADQMLGATVQVR 261


>gi|254463756|ref|ZP_05077167.1| flagellar basal-body rod protein FlgG [Rhodobacterales bacterium
           Y4I]
 gi|206684664|gb|EDZ45146.1| flagellar basal-body rod protein FlgG [Rhodobacterales bacterium
           Y4I]
          Length = 261

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 162/262 (61%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E I+NN+AN+NTT Y   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQLRVETISNNLANMNTTAYNARRAEFADLHYQQISRAGTVN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ ++V    +QG +  T N+LD+A+ G G+ +V  P     YTR G+
Sbjct: 60  TVLPTGVQVGLGVRPAAVSVHLSQGALQQTNNDLDVAIDGNGYLEVTLPSGQSAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
               ++G +VT+DG  + P I IP++   I ++  G++      + + Q +GQ  +A+F 
Sbjct: 120 LKRSAEGLIVTSDGFAVSPEITIPDDATSISINAEGEVYGYFQDSPEGQLLGQFTLASFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG   ++   + G   ++QGYLE S+VDAV+E++E+I AQR 
Sbjct: 180 NPKGLEAIGSNLFTETEASGAATVTTAGEDGLGTLRQGYLEGSSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMN+KVI A D+M    T++R
Sbjct: 240 YEMNAKVISAVDQMMGATTQVR 261


>gi|332162899|ref|YP_004299476.1| Lateral flagellar rod protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318604254|emb|CBY25752.1| flagellar basal-body rod protein FlgG [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325667129|gb|ADZ43773.1| Lateral flagellar rod protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863349|emb|CBX73472.1| flagellar basal-body rod protein flgG [Yersinia enterocolitica
           W22703]
          Length = 261

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 96/258 (37%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   +  I+NN+AN+NT G+KR R  F D  YQ ++  G+P        
Sbjct: 4   ALWVSKTGLAAQDAKMNAISNNLANVNTDGFKRDRVVFEDLFYQNQRTPGAPLD--QNNA 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI  GSGV++   +  +T G +  T  +LD+A+ G+G+FQVET D  + YTRAG+ +
Sbjct: 62  TPNGIQFGSGVKVVGTQKQFTVGNIKVTKGDLDVAIAGQGFFQVETSDGGLAYTRAGNLS 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I++ G L  A G  L+P I +P   +++ + + G + A  G +++   +GQ+ + NF+N 
Sbjct: 122 INADGVLTNAQGLPLIPQIELPAGAKDLAIGKDGTVTARLGGDAESAELGQITLVNFVNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G N+   T  SG  +     +  F  ++ G LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNMYKETVASGAAVEGVAGEEAFGQLEHGSLEGSNVQVVEEMVDMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   +T+
Sbjct: 242 MNAKMVSAADDMLKFVTQ 259


>gi|332298514|ref|YP_004440436.1| flagellar basal-body rod protein FlgG [Treponema brennaborense DSM
           12168]
 gi|332181617|gb|AEE17305.1| flagellar basal-body rod protein FlgG [Treponema brennaborense DSM
           12168]
          Length = 264

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 108/263 (41%), Positives = 159/263 (60%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM+ QQ N++ I+NN++N+NTTGYK+ R EF D +YQ  K+AG+P  + +  
Sbjct: 3   RSLWTAATGMNGQQANIDAISNNLSNVNTTGYKQQRVEFEDLIYQNLKLAGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           V P GI +G+GV++ + + + TQG + +TG + D+A+VG G+F+V+  D +  YTR GSF
Sbjct: 61  VTPVGIQMGTGVKVGATQRIITQGSLQNTGVDTDMAVVGEGFFRVQQYDGSFAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETR--EIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            +D  GQLVT++G  ++P I++PE      + VS  G++      N D   VGQL +  F
Sbjct: 121 KVDMNGQLVTSEGLRVMPEIILPEGYNLSTLTVSDDGRVTVKIAGNDDPLTVGQLELYRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
            N  GL   G NL   T+ SG  I   P   G    K  +LE SNV  V E+ +MI AQR
Sbjct: 181 PNAVGLEATGSNLFKVTNASGAAIAGRPGFDGMGVTKHKFLEMSNVSVVNEMVQMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE +SK I+ +D M S    ++
Sbjct: 241 AYEFSSKAIQTSDTMLSSAVNLK 263


>gi|312794499|ref|YP_004027422.1| flagellar basal-body rod protein flgg [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312876700|ref|ZP_07736680.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796540|gb|EFR12889.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312181639|gb|ADQ41809.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 267

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 96/270 (35%), Positives = 142/270 (52%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A         
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRA----DVVAG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   + +G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +  +G+I              
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDETGRITYKDQDGQIQDSGL 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SGDP+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSAASGDPVSEEEIEGQKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSMANNLK 266


>gi|21672606|ref|NP_660673.1| flagellar basal body rod protein FlgG [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008454|sp|Q8K9K4|FLGG_BUCAP RecName: Full=Flagellar basal-body rod protein flgG; AltName:
           Full=Distal rod protein
 gi|21623237|gb|AAM67884.1| flagellar basal-body rod protein FlgG [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 260

 Score =  221 bits (562), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 101/261 (38%), Positives = 161/261 (61%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  I+  G+ AQQ N+ +I+NN+AN++T G+KR+RA F D +YQ  + AG  + S+  
Sbjct: 2   IPSLWISKTGLDAQQINMNVISNNLANVSTNGFKRSRAVFEDLMYQTMRQAG--TNSSID 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  S   +Y+QG +  T ++ D+A+ G G+FQV+ PD  + YTR GS
Sbjct: 60  TTLPSGLQLGTGVRPVSTEKIYSQGNLSKTDSSKDVAINGPGFFQVQLPDGNIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT  G  ++P I IP  +  + + R G +       +    +GQL + NF+
Sbjct: 120 FQLDQNGQLVTNSGYPIIPEINIPPNSINMNIGRDGIVSVTIQGQTQPISIGQLNLINFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G+NL   T  SG+PI + P   G   + QGY+E SNV+  +E+  MI  QRA
Sbjct: 180 NHSGLESLGENLYQETQASGNPIDTTPGLNGTGLLYQGYVETSNVNVAEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK I  +D+M   ++++
Sbjct: 240 YEINSKSINTSDQMLQKLSQL 260


>gi|68164544|gb|AAY87273.1| predicted flagellar basal body rod protein [uncultured bacterium
           BAC17H8]
          Length = 262

 Score =  221 bits (562), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 116/258 (44%), Positives = 163/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +  +A  G++AQQT ++IIANN+AN+NTTG+KR RA F   LYQ  +VAG   Q   +A 
Sbjct: 5   SMHVAKTGLNAQQTRMQIIANNLANVNTTGFKRDRANFETLLYQVRRVAGD--QVTAEAN 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +    S+G+G +I + +  +TQG ++ T N+LDLAL G G+FQV  PD  V YTR G+F+
Sbjct: 63  LTSSFSVGTGARIVNTQKAHTQGSLITTDNSLDLALEGGGFFQVLLPDGRVGYTRNGAFS 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +S+G L T+ G  L P I +P+   +I +SR G +  +       + VGQL IA+F N 
Sbjct: 123 TNSEGVLTTSSGYVLQPEIALPDGVSQINISRDGIVSVLVAGGIGAEAVGQLQIADFTNR 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG++    T  SG PI+ NP D G   V QG LE+SNV+ V E+ EMI  QRAYE
Sbjct: 183 GGLQPIGESFYVETDTSGAPIVGNPQDAGLGRVIQGALESSNVNVVTELVEMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           ++SK I + DEM   I++
Sbjct: 243 VSSKSITSVDEMLRYISQ 260


>gi|260222470|emb|CBA32066.1| Flagellar basal-body rod protein flgG [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 260

 Score =  221 bits (562), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 100/261 (38%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  I+  GM AQQ  L++I+NN+AN++T G+K++ A F D +YQ  +  G  S ++++
Sbjct: 2   INSLWISKTGMEAQQMQLDVISNNLANVSTNGFKKSHAVFEDLMYQNLRQVG--SNTSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + +P G+ +G GV+  +    ++QG +  + NNLD+A+ G G+FQV  PD T  YTR G+
Sbjct: 60  STLPTGLQLGLGVRTVATSRSFSQGNLQQSSNNLDVAIQGNGFFQVTMPDGTTGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ID+ G+LVT++G  ++ GI IP     + +++ G + A+   N   QP+G + +A+FI
Sbjct: 120 FQIDNAGRLVTSNGLPILNGINIPANATSVAIAQDGAVTAMVPGNVAPQPIGTITLASFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G N+ A ++ SG P        G   + QG++E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLEPKGQNIYAESTASGQPNAGTAGANGLGTLAQGFVETSNVNVVQELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M   + ++
Sbjct: 240 YEMNSKAIQTSDQMLQKLGQL 260


>gi|317406199|gb|EFV86448.1| flagellar basal-body rod protein FlgG [Achromobacter xylosoxidans
           C54]
          Length = 261

 Score =  221 bits (562), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 153/262 (58%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  IA  G+  QQT++++I+NN+AN+ T G+KR RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWIAKTGLEGQQTSMDVISNNLANVATNGFKRGRAVFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+G ++++   ++T G + +TG  LD+A+ GRG+ QVE PD T  YTR G+
Sbjct: 60  TQLPSGLQLGTGARVAATERIHTTGGLNNTGGELDVAINGRGFLQVELPDGTQAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
              D  GQL T  G  + P + +P+    I + + G +       +       QL IA F
Sbjct: 120 LQRDQNGQLTTVSGYVIQPPMNVPDNALSISIGKDGIVSVTQPGAAGVNVQIGQLQIATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL+++G+NL   T  SG   +  P   G     Q Y+E SNV+  +E+  MI+ QR
Sbjct: 180 INPTGLQSVGENLYLETDASGPANLLQPGVDGAGTFMQNYVETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|304438315|ref|ZP_07398256.1| flagellar basal-body rod protein FlgG [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304368681|gb|EFM22365.1| flagellar basal-body rod protein FlgG [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 264

 Score =  221 bits (562), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 103/264 (39%), Positives = 158/264 (59%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ+ ++++A+NIAN+NT G K+ RAEF D +YQ  + AG  +++   
Sbjct: 2   MRALWSAASGMKAQQSQMDVVAHNIANVNTYGGKKVRAEFQDLVYQTLREAG--ARNGAD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +  P  + IG G ++++ + V+TQG +  T N  D+ + G G+F+V  PD T  YTR G+
Sbjct: 60  SQYPTALQIGLGTRLAATQRVFTQGALQTTDNPTDIGIQGEGFFRVTMPDGTTAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETR--EIKVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           + +DS  ++VT DG  L  GI I +      I +S  G++       +  Q  GQ+ +A 
Sbjct: 120 WKLDSDRRMVTTDGYLLADGITIGQNAPLDSITISGDGRVSYREAGQNQQQEAGQITLAR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL ++G NL   +  SG+ I SNP + G   + QG LE SNV  V+E+  MI +Q
Sbjct: 180 FVNPAGLTSVGKNLFVVSDASGEAIESNPGEDGAGTLTQGTLEMSNVQIVEEMVNMIVSQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE NSK I  +D M  +  +++
Sbjct: 240 RAYESNSKAITTSDSMLEIANQLK 263


>gi|310816831|ref|YP_003964795.1| flagellar basal-body rod protein FlgG [Ketogulonicigenium vulgare
           Y25]
 gi|308755566|gb|ADO43495.1| flagellar basal-body rod protein FlgG [Ketogulonicigenium vulgare
           Y25]
          Length = 261

 Score =  221 bits (562), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 114/262 (43%), Positives = 174/262 (66%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+   IAA GM AQQT +E+I+NN+AN+NTT Y   RAEFAD  YQ  + AG+ + + D 
Sbjct: 1   MRILDIAATGMLAQQTRVEVISNNLANMNTTAYNPRRAEFADLHYQQVQRAGTVA-ATDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P GI +G GV+ ++V  +  QG V  TG +LD+A+ G+G+F+V  PD  + YTR G+
Sbjct: 60  TILPTGIQLGMGVRTTAVSPMLGQGAVQETGGSLDVAIEGQGYFEVALPDGRIGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
             +   G +VTA G  + PGIVIPE+ + + ++  G++ A      + + +GQL +A F+
Sbjct: 120 LKLTGDGLIVTAGGLEVAPGIVIPEDAQSVAINADGEVYASFTNAVEQEFLGQLNLAMFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  +G NL   T+ SG P+++ P + G   ++QGYLE S VDAV+E++++I+AQR 
Sbjct: 180 NPRGLEAMGSNLYLETAASGQPMVAVPGEDGLGTLRQGYLEQSTVDAVREVTDLIAAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M + + ++R
Sbjct: 240 YELNSKVISAADQMLAAMVQIR 261


>gi|27381984|ref|NP_773513.1| flagellar basal body rod protein FlgG [Bradyrhizobium japonicum
           USDA 110]
 gi|27355154|dbj|BAC52138.1| flagellar basal-body rod protein [Bradyrhizobium japonicum USDA
           110]
          Length = 262

 Score =  221 bits (562), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 138/260 (53%), Positives = 186/260 (71%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MK+  IAA GM+AQQTN+E+IANNIANIN+T YKRARAEF D  YQ +++ G  + +   
Sbjct: 1   MKSLAIAATGMNAQQTNIEVIANNIANINSTSYKRARAEFTDLFYQMDRMQGVANVNGSS 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            + PEG ++G GV+ +++R ++ QG +  TGN  DLA+ GRGWFQV  P+  V YTRAGS
Sbjct: 61  PI-PEGANLGLGVKSAAIRKLHIQGALTQTGNPYDLAINGRGWFQVLGPNNEVQYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++  QLVT DG  L P I IP+ T E+ V+++GQ+ A      + + +GQL +ANF 
Sbjct: 120 FNTNANSQLVTTDGYLLDPAITIPQGTVEVTVNQTGQVFAKLDTEVNPRQIGQLNLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL   T+ SG P++  P D G+  + Q YLEASNVD VKEI+E+ISAQRA
Sbjct: 180 NEAGLEPLGSNLYRETTASGTPVVGLPGDAGYGKINQKYLEASNVDPVKEITELISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMN+KVI+A+DEM+S ++K
Sbjct: 240 YEMNAKVIQASDEMASTVSK 259


>gi|163803171|ref|ZP_02197054.1| putative flagellar basal-body rod protein [Vibrio sp. AND4]
 gi|159173071|gb|EDP57904.1| putative flagellar basal-body rod protein [Vibrio sp. AND4]
          Length = 261

 Score =  221 bits (562), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNTQNTTQELDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I+S+G +V + G  L P I IP++     V   G +   +  + + Q +GQ+ +A FIN 
Sbjct: 122 INSEGLMVNSQGLPLEPQIQIPDDAISFSVGVDGTVTTTSADDPNPQQLGQISLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T+ SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETAASGSADELIAGEDGAGSIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|260429403|ref|ZP_05783380.1| flagellar basal-body rod protein FlgG [Citreicella sp. SE45]
 gi|260420026|gb|EEX13279.1| flagellar basal-body rod protein FlgG [Citreicella sp. SE45]
          Length = 261

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 111/262 (42%), Positives = 159/262 (60%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN++N++TTGY   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQMRVEVISNNLSNMSTTGYNARRAEFADLHYQQIARAGTIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ +G G + ++V     QG +  TG +LD+A+ GRG+F+V  P     YTR G+
Sbjct: 60  TMLPTGVQMGLGARPAAVTMKLEQGALSDTGGDLDIAIEGRGYFEVTLPSGIAGYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              ++ G +VT+DG  + P IVIP++   + ++  G++ A        Q +GQ  I  F 
Sbjct: 120 LKRNADGMIVTSDGLPVSPEIVIPDDAISLSINAEGEVYAYFADAVQAQLLGQFTIVGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG PI +     G    +QGYLE S+VD V EI+E+I AQR 
Sbjct: 180 NPKGLEAIGGNLFTETEASGPPIQTTAGQEGLGTFRQGYLEDSSVDPVYEITELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI AAD+M     ++R
Sbjct: 240 YELNSKVISAADQMLGATVQVR 261


>gi|332704823|ref|ZP_08424911.1| flagellar basal-body rod protein FlgG [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554972|gb|EGJ52016.1| flagellar basal-body rod protein FlgG [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 260

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 102/262 (38%), Positives = 155/262 (59%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQ N++ I+NN+AN+NT G+K++RAEF D +YQ  K+AG  +++   
Sbjct: 2   MRSLWTAATGMVAQQMNIDTISNNLANVNTIGFKKSRAEFEDLMYQTMKIAG--TRTEGG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P GI +G GV+  +V   +TQG+  +T N LD+A+ G G+F +   + T  +TRAG+
Sbjct: 60  NVTPVGIQMGMGVRPMTVHKFFTQGDFQNTSNPLDIAIEGDGFF-LVDFNGTEAFTRAGA 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VTA+G  L P   +P ET  + +S  G + A+  + ++      L +  F 
Sbjct: 119 FKLDNEGRMVTANGYLLQPEFTVPPETVNVVISEQGHLAALDRQGNELSST-DLQLYTFQ 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL  IG NL   T  SG      P +     + QG+LE SNV+ V E+  MI  QRA
Sbjct: 178 NNAGLNAIGRNLFIETEASGPATAGTPGEENVGTLAQGFLEGSNVELVDEMVGMIIGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           +E+NSK I  +D M      ++
Sbjct: 238 FEVNSKAISTSDTMLQTAINVK 259


>gi|260767925|ref|ZP_05876859.1| flagellar basal-body rod protein FlgG [Vibrio furnissii CIP 102972]
 gi|260615955|gb|EEX41140.1| flagellar basal-body rod protein FlgG [Vibrio furnissii CIP 102972]
 gi|315179628|gb|ADT86542.1| flagellar basal-body rod protein FlgG [Vibrio furnissii NCTC 11218]
          Length = 261

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +TG +LDLA++G+G+FQ+E  D  +MY+R G F+
Sbjct: 62  LPTGVQLGSGVRVVGTQKVFTQGNTQNTGQDLDLAVMGQGFFQIENSDGQIMYSRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I +P++   + V   G +   T  +S  Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNSQGLPLQPQIQVPDDAISLSVGVDGTVTITTAADSTPQELGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEALGGNLFRETEASGAADELIAGEDGVGSIKQGVLEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|299066528|emb|CBJ37718.1| Flagellar basal-body rod protein (Distal rod protein) [Ralstonia
           solanacearum CMR15]
          Length = 263

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 93/260 (35%), Positives = 146/260 (56%), Gaps = 1/260 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  + A GM AQQ NL+ IANN+AN+NTTG+K++R  F D + Q E     P+  A    
Sbjct: 4   ALYVGATGMQAQQLNLDTIANNLANVNTTGFKKSRVSFTDLVAQ-EAGRIQPTSDASLGP 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +     +G+GV ISSV  ++  G +  TG++ D+A+ G G+ +V  PD +  +TR G+  
Sbjct: 63  LSALPGLGAGVGISSVAKLFDTGNMQQTGSSFDVAIQGEGFLEVALPDGSRAFTRGGTLK 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S G LVT  G  + PGI +P   +++ ++  G +       S     GQL +A+F + 
Sbjct: 123 VNSDGMLVTQAGYVVKPGISVPSNAKDLTIAADGHVRISVPNQSSPIDAGQLELAHFASP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
             L   GDNL   +  SG+P++            QG+LE SNV  + E+  ++ AQRAYE
Sbjct: 183 GMLLAQGDNLYRASDTSGEPVVGKAGQDNLGTFAQGFLEGSNVKMIDEMVGLMVAQRAYE 242

Query: 243 MNSKVIEAADEMSSLITKMR 262
            N KV++A+DE+  ++  +R
Sbjct: 243 ANVKVVQASDEILGMVNNLR 262


>gi|258622490|ref|ZP_05717512.1| Putative flagellar basal-body rod protein flgG [Vibrio mimicus
           VM573]
 gi|258625232|ref|ZP_05720144.1| Putative flagellar basal-body rod protein flgG [Vibrio mimicus
           VM603]
 gi|258582479|gb|EEW07316.1| Putative flagellar basal-body rod protein flgG [Vibrio mimicus
           VM603]
 gi|258585190|gb|EEW09917.1| Putative flagellar basal-body rod protein flgG [Vibrio mimicus
           VM573]
          Length = 261

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 152/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTAGFKRDRVVFEDLFYNIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T   LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPTGVQLGSGVRVVGTQKVFTQGNAQNTAQELDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I IP+    + +   G + A T  +   Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNSQGLPLEPQIQIPDNVVSLSIGVDGTVSATTAGDPAPQQLGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG          G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETDASGLAEELVAGQDGTGSIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A D+M   + +
Sbjct: 242 MNAKVVSATDDMLKFVAQ 259


>gi|114799186|ref|YP_758987.1| flagellar basal body rod protein FlgG [Hyphomonas neptunium ATCC
           15444]
 gi|114739360|gb|ABI77485.1| flagellar basal-body rod protein FlgG [Hyphomonas neptunium ATCC
           15444]
          Length = 261

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 114/262 (43%), Positives = 165/262 (62%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MK+  IAA+GM+AQQ  +E+I+NNIAN++TT Y+   AEF+D +YQ     G+ + S   
Sbjct: 1   MKSLQIAASGMAAQQMRVEVISNNIANMSTTAYRPRTAEFSDLMYQQYLTPGTIT-SQVG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP GI +GSGV+ ++V    TQG +  T   LD+A+ G G+ +V  P     +TR G 
Sbjct: 60  TVVPSGIQLGSGVRPTTVSMDLTQGTLRETQAELDIAIDGNGFLEVTLPSGEPAFTRDGK 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
            +    G++VT+DG  L  GIVIPE+ R I +SR G+++A     ++ Q +G + +  F+
Sbjct: 120 LSRSPDGEIVTSDGFPLADGIVIPEDARRISISRDGEVVAYFDNETEGQAIGSISLVRFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  +GDN+   T  SG      P   G   ++QGY+E S VD VKEI+++I AQR 
Sbjct: 180 NEKGLEAMGDNMFRETEASGPANRLIPGTEGMGFLRQGYIEDSAVDVVKEIADLIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+NSKVI A+DEM S+ T++R
Sbjct: 240 YELNSKVITASDEMLSVTTRLR 261


>gi|283850807|ref|ZP_06368093.1| flagellar basal-body rod protein FlgG [Desulfovibrio sp. FW1012B]
 gi|283573730|gb|EFC21704.1| flagellar basal-body rod protein FlgG [Desulfovibrio sp. FW1012B]
          Length = 260

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 97/262 (37%), Positives = 153/262 (58%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A  GM A Q  ++ ++NN+AN+NT G+K++RAEF D +YQ ++VAG+ +   ++
Sbjct: 2   MRSLWTATTGMVAMQMQIDTMSNNLANVNTVGFKKSRAEFEDLMYQTQQVAGTETVGGNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++V   +TQG++ +TGN LD+A+ G G+F+V   +   +YTRAGS
Sbjct: 62  --LPTGLQVGLGVKPTTVHKFFTQGDLQNTGNQLDIAIQGEGFFKV-DVNGRDLYTRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G  L P   +P  T+ I ++ +G +  +    +       + +  FI
Sbjct: 119 FKLNQDGTIVTANGYPLQPAFSVPAGTKSITITENGHLSCLDQNGAAQGET-DIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL   G NL + T  SGD     P D     + QG+LE SNV+ V E+  +I  QRA
Sbjct: 178 NSPGLTAEGRNLYSTTQASGDAQEVTPGDQNAGTLAQGFLEMSNVELVDEMVGLIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  AD M      ++
Sbjct: 238 YEANSKAITTADGMLQTAVNVK 259


>gi|312621332|ref|YP_004022945.1| flagellar basal-body rod protein flgg [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312201799|gb|ADQ45126.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 267

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 96/270 (35%), Positives = 143/270 (52%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A         
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRA----DVVAG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   + +G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +  +G+I     +        
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIILPETAISSITIDETGRITYKDAEGQVQDSGL 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SGDP+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSAASGDPVSEEEMEGQKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSMANNLK 266


>gi|157959900|ref|YP_001499934.1| flagellar basal-body rod protein FlgG [Shewanella pealeana ATCC
           700345]
 gi|157844900|gb|ABV85399.1| flagellar basal-body rod protein FlgG [Shewanella pealeana ATCC
           700345]
          Length = 261

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 156/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G   Q  ++  
Sbjct: 4   ALWVSKTGLTAQDTKMTTIANNLANVNTTGFKRDRVAFNDLFYQVQRQPG--GQVDEQNQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G +++  + V+T G+++ T   LDLA+ G+G+FQ+E  +  V +TR G F 
Sbjct: 62  LPAGLQLGTGTRVAGTQKVFTPGDMLTTNQQLDLAIEGQGFFQIEEANGDVSFTRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            DS G +VT+ G  LVP I IP+E   + ++  G + A     +D Q +GQ+ + NF N 
Sbjct: 122 RDSDGLMVTSQGLPLVPNIQIPDEALTVTIASDGIVSAQMAGQADSQELGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G NL   T  SG  I     D     V+QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEARGSNLYRETGASGAAIEGIAGDEALGQVRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|126176154|ref|YP_001052303.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS155]
 gi|304412506|ref|ZP_07394112.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS183]
 gi|307307165|ref|ZP_07586903.1| flagellar basal-body rod protein FlgG [Shewanella baltica BA175]
 gi|125999359|gb|ABN63434.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS155]
 gi|304349148|gb|EFM13560.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS183]
 gi|306910404|gb|EFN40835.1| flagellar basal-body rod protein FlgG [Shewanella baltica BA175]
          Length = 261

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G    + +   
Sbjct: 4   ALWVSKTGLTAQDTKMTAIANNLANVNTTGFKRDRVAFNDLFYQVQRQPGGQVDALNN-- 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++   + ++T G++ +T   LDLA+ G G+FQVE P+  + YTR G F 
Sbjct: 62  LPSGLQLGAGTRVVGTQKIFTTGDMQNTSQQLDLAIEGHGFFQVEEPNGDLAYTRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
             S+G +VT+ G  LVP IVIPE+   + ++  G + A     ++ Q +GQ+ + NF N 
Sbjct: 122 RSSEGMMVTSQGLPLVPNIVIPEDALTVTIANDGVVTAKMAGEAEPQDLGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG  +     D     ++QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEARGDNLYRETAASGVAVEGVAGDQALGALRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|323204838|gb|EFZ89832.1| flagellar basal body rod protein FlgG [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
          Length = 255

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 107/254 (42%), Positives = 155/254 (61%), Gaps = 2/254 (0%)

Query: 8   AAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGI 67
             G+ AQQTN+++IANN+AN++T G+KR RA F D LYQ  +  G  +QS+++  +P G+
Sbjct: 4   KTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPG--AQSSEQTTLPSGL 61

Query: 68  SIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKG 127
            IG+GV+  +   +++QG +  T N+ D+A+ G+G+FQV  PD T  YTR GSF +D  G
Sbjct: 62  QIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNG 121

Query: 128 QLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRN 187
           QLVTA G  + P I IP     I + R G +       +    VGQL +  F+N+ GL +
Sbjct: 122 QLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLES 181

Query: 188 IGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKV 247
           IG+NL   T  SG P  S P   G   + QGY+E SNV+  +E+  MI  QRAYE+NSK 
Sbjct: 182 IGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKA 241

Query: 248 IEAADEMSSLITKM 261
           +   D+M   +T++
Sbjct: 242 VSTTDQMLQKLTQL 255


>gi|308050370|ref|YP_003913936.1| flagellar basal-body rod protein FlgG [Ferrimonas balearica DSM
           9799]
 gi|307632560|gb|ADN76862.1| flagellar basal-body rod protein FlgG [Ferrimonas balearica DSM
           9799]
          Length = 262

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 161/259 (62%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++  I+NN+AN +T GYK++RA F D LYQ    AG    S+    
Sbjct: 4   ALWISKTGLDAQQTDIATISNNLANASTVGYKKSRAIFEDLLYQTINQAG--GISSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+++G+G ++++ + +++QG ++ T N+LDL + G G+F+++ PD T+ Y+R G F 
Sbjct: 62  LPAGLTLGAGTKVAATQRIFSQGNMLTTDNSLDLMIEGPGFFEIQLPDGTIAYSRNGQFA 121

Query: 123 IDSKGQLVTADGN-TLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D +GQLVT      L PGI +PE+ + I VS  G++       ++ Q +GQ+ IANF+N
Sbjct: 122 LDDEGQLVTPGAGFLLNPGIQVPEDAQSITVSGEGEVSVRVPGAAENQVIGQIEIANFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG N+   T  SG PI   P   G   ++QG LE SNV+  +E+  MI +QR Y
Sbjct: 182 PTGLEPIGQNMFLETGASGAPIQGVPGLDGLGTLRQGALETSNVNVTEELVNMIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI   D+M + + +
Sbjct: 242 EMNSKVISTVDQMLANLNQ 260


>gi|260886211|ref|ZP_05897474.1| flagellar basal-body rod protein FlgG [Selenomonas sputigena ATCC
           35185]
 gi|330839793|ref|YP_004414373.1| flagellar basal-body rod protein FlgG [Selenomonas sputigena ATCC
           35185]
 gi|260863930|gb|EEX78430.1| flagellar basal-body rod protein FlgG [Selenomonas sputigena ATCC
           35185]
 gi|329747557|gb|AEC00914.1| flagellar basal-body rod protein FlgG [Selenomonas sputigena ATCC
           35185]
          Length = 263

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 106/263 (40%), Positives = 157/263 (59%), Gaps = 3/263 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ N++++A+NIAN+NT G K+ RAEF D +YQ  + AG  +QS   
Sbjct: 2   MRALWSAASGMKAQQDNMDVVAHNIANVNTFGSKKVRAEFQDLVYQNLRAAG--AQSGAD 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +  P G++IG G + ++ + ++TQG +  +GN  D+A+ G G+F++E PD T+ YTR GS
Sbjct: 60  SQYPTGLAIGLGTRTAATQRIFTQGNLQSSGNPTDVAIQGEGFFRIEMPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKV-SRSGQILAVTGKNSDFQPVGQLLIANF 179
           F +D   +LVT DG  L  GI +        +       ++ T    +   VGQ+ ++ F
Sbjct: 120 FKLDQNRRLVTTDGYPLADGITLDANAPSDSIVIAGDGQVSCTPAGGNVTAVGQITLSRF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           +N AGL  IG NL   T  SG+ I SNP + G   + QG +E SN+  V+E+  MI AQR
Sbjct: 180 VNPAGLFAIGKNLFKETDASGNAIDSNPGEEGAGTLTQGVVEMSNIQIVEEMVNMIVAQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE NSK I  +D M  +   ++
Sbjct: 240 AYESNSKAITTSDSMLEIANSLK 262


>gi|54294165|ref|YP_126580.1| flagellar basal body rod protein FlgG [Legionella pneumophila str.
           Lens]
 gi|54297184|ref|YP_123553.1| flagellar basal body rod protein FlgG [Legionella pneumophila str.
           Paris]
 gi|148358808|ref|YP_001250015.1| flagellar basal body rod protein FlgG [Legionella pneumophila str.
           Corby]
 gi|296106853|ref|YP_003618553.1| flagellar basal-body rod protein FlgG [Legionella pneumophila
           2300/99 Alcoy]
 gi|53750969|emb|CAH12380.1| flagellar biosynthesis protein FlgG [Legionella pneumophila str.
           Paris]
 gi|53753997|emb|CAH15468.1| flagellar biosynthesis protein FlgG [Legionella pneumophila str.
           Lens]
 gi|148280581|gb|ABQ54669.1| flagellar basal body rod protein FlgG [Legionella pneumophila str.
           Corby]
 gi|295648754|gb|ADG24601.1| flagellar basal-body rod protein FlgG [Legionella pneumophila
           2300/99 Alcoy]
 gi|307609979|emb|CBW99508.1| flagellar biosynthesis protein FlgG [Legionella pneumophila 130b]
          Length = 261

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 109/258 (42%), Positives = 162/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++ +G+ AQ  N+  IANN+AN+NTT +K+ RA F D +YQ  + AG  +QS+  + 
Sbjct: 4   ALWVSKSGLEAQDKNIATIANNLANVNTTAFKKGRALFEDLIYQNLRQAG--AQSSQNSQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P GI++G+GV + +   +++QG + +T N LD+A+ GRG+F V  PD T  YTR GSF 
Sbjct: 62  IPTGINMGTGVHLVATEKIFSQGSLQNTQNALDVAIEGRGFFTVLMPDGTQAYTRDGSFK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            DS GQ+V ++G  L P I IP +T +I +   G + A+   N+    +G + + +FIN 
Sbjct: 122 TDSTGQIVNSNGYPLQPNITIPPQTTKITIGTDGTVSALVAGNNAPSVIGNIQLTDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG NL   T  SG PI  NP + G   + QG LEASNV+ V+E+  MI AQR+YE
Sbjct: 182 AGLQPIGQNLYTETVASGTPITDNPGNSGLGTLLQGSLEASNVNVVEELVNMIQAQRSYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           + +K I+  D M   +T+
Sbjct: 242 ITAKSIQTVDSMLQYLTQ 259


>gi|254462012|ref|ZP_05075428.1| flagellar basal-body rod protein FlgG [Rhodobacterales bacterium
           HTCC2083]
 gi|206678601|gb|EDZ43088.1| flagellar basal-body rod protein FlgG [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 261

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 167/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ  +E+I+NN+AN++TTGY   RAEFAD  YQ    AG+ + ++D 
Sbjct: 1   MRALKIAATGMSAQQMRVEVISNNLANMSTTGYNTRRAEFADLHYQQMSRAGTIN-ASDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V+P G+ +G GV+ SSV     QG +  T ++LD+A+ G+G+ +V  P     YTR G+
Sbjct: 60  TVLPTGVQLGLGVRPSSVSVYLAQGSLSATNSDLDVAIDGQGYLKVTMPSGASAYTRDGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
              +++G +VT DG  +VP IVIP E R + ++  G++ A   + +  Q +GQ  +A F 
Sbjct: 120 LKRNAEGLIVTNDGYPIVPEIVIPPEARSVSINGDGEVFAYFNETAQAQLLGQFTLAGFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N  GL  IG NL   T  SG   ++ P   G   ++QGYLE S+VDAV+E++E+I AQR 
Sbjct: 180 NAKGLEAIGSNLFMETEASGPSQVTTPGTDGLGTLRQGYLEDSSVDAVREVTELIEAQRG 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE+N+KVI AAD+M    T++R
Sbjct: 240 YELNAKVITAADQMLGAATQIR 261


>gi|103488389|ref|YP_617950.1| flagellar basal body rod protein FlgG [Sphingopyxis alaskensis
           RB2256]
 gi|98978466|gb|ABF54617.1| Flagellar basal-body rod FlgG [Sphingopyxis alaskensis RB2256]
          Length = 261

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 153/258 (59%), Gaps = 3/258 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ   +++IANN+AN+NTTG+KR RA F    YQ    AG+PS + ++  
Sbjct: 5   ALHVARTGLDAQSFRMQVIANNLANVNTTGFKRDRASFETLSYQLMTQAGAPSTAENRYA 64

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
              G+++G+GV ++    + TQG    TGN LD+A+ G G+FQVE PD  + YTRAG+F 
Sbjct: 65  T--GLNLGTGVALNGTARIDTQGTFQTTGNGLDVAIDGAGYFQVELPDGRIGYTRAGNFG 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
               G +VT DG  L P I IPE+   + +   G + A     +  +   ++ IA F N 
Sbjct: 123 RAPDGTIVTPDGKPLTPAIQIPEDAGNVSIGLDGTVSATAADGTALELG-RIEIARFSNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG N+L  T  SG P++    + G   ++ G LE SNV+ V+E+ +MI  QRAYE
Sbjct: 182 AGLQAIGGNMLVETQASGAPLVGGAGEEGRGTLRGGMLEGSNVNVVEELVDMIETQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK+I A DEM    ++
Sbjct: 242 VNSKMISATDEMMKNASQ 259


>gi|332531620|ref|ZP_08407517.1| flagellar basal-body rod FlgG [Hylemonella gracilis ATCC 19624]
 gi|332038983|gb|EGI75412.1| flagellar basal-body rod FlgG [Hylemonella gracilis ATCC 19624]
          Length = 259

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 154/260 (59%), Gaps = 3/260 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            +  IA  GM AQQ  L+ I+NN+AN +T G+KR+   F D +YQ  + AGSPS  +++ 
Sbjct: 3   NSLWIAKTGMEAQQRQLDTISNNLANSSTNGFKRSSVVFEDLMYQNLRTAGSPS--SEQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G G +  +    YTQG +V  G  LD+A+ G G+FQV  PD T  YTR G+ 
Sbjct: 61  NLPTGLQVGLGARAVATSRNYTQGNLVQ-GRPLDVAINGNGFFQVSMPDGTTQYTRDGAL 119

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            I + G LVT++G  L  GIVIP    ++ ++  G + A     +  Q +G + +A FIN
Sbjct: 120 EISATGALVTSNGLPLADGIVIPPNASDLSIADDGTVTAKLPGQTVAQTIGNITLATFIN 179

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G NL A T+ SG P    P   G   + QGYLE+SNV+ V+E+  MI  QRAY
Sbjct: 180 PAGLEAKGQNLFAETAASGTPNTGAPSANGIGKLMQGYLESSNVNVVQELVTMIQTQRAY 239

Query: 242 EMNSKVIEAADEMSSLITKM 261
           EMNSK I+ +D+M   + ++
Sbjct: 240 EMNSKAIQTSDQMLQKLGQL 259


>gi|312126442|ref|YP_003991316.1| flagellar basal-body rod protein flgg [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776461|gb|ADQ05947.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 267

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 96/270 (35%), Positives = 142/270 (52%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A         
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRA----DVVAG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   + +G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +  +G+I              
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDETGRITYKDQDGQIQDSGF 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SGDP+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSATSGDPVSEEEMEGQKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSMANNLK 266


>gi|120597307|ref|YP_961881.1| flagellar basal-body rod protein FlgG [Shewanella sp. W3-18-1]
 gi|120557400|gb|ABM23327.1| flagellar basal-body rod protein FlgG [Shewanella sp. W3-18-1]
          Length = 261

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G    + +   
Sbjct: 4   ALWVSKTGLTAQDTKMTAIANNLANVNTTGFKRDRVAFNDLFYQVQRQPGGQVDALNN-- 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++   + ++T G++ +T   LDLA+ G G+FQVE P+  + YTR G F 
Sbjct: 62  LPSGLQLGAGTRVVGTQKIFTTGDMQNTSQQLDLAIQGHGFFQVEEPNGDLAYTRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
             S+G +VT+ G  LVP IVIPE+   + ++  G + A     ++ Q +GQ+ + NF N 
Sbjct: 122 RSSEGMMVTSQGLPLVPNIVIPEDALTVTIASDGVVTAQMAGEAEPQDLGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG  +     D     ++QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEARGDNLYRETAASGVAVEGVAGDQALGALRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|33601543|ref|NP_889103.1| flagellar basal body rod protein FlgG [Bordetella bronchiseptica
           RB50]
 gi|33575979|emb|CAE33058.1| flagellar basal-body rod protein [Bordetella bronchiseptica RB50]
          Length = 261

 Score =  219 bits (558), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 100/262 (38%), Positives = 159/262 (60%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  +A  G+  QQT++++I+NN+AN+ T G+KR RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWVAKTGLEGQQTSMDVISNNLANVQTNGFKRGRAVFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GVQ+++ + V++QG + +TG  +D+A+ GRG+ QVE PD T  YTR GS
Sbjct: 60  NQLPSGLQLGTGVQVAATQRVFSQGNMNNTGGEMDIAIQGRGFLQVELPDGTQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
             +D  GQL TA G  + P I +P+    + + + G +       +       QL +A F
Sbjct: 120 LQVDQNGQLTTAGGYVIQPPINVPDNALSLTIGKDGTVSVTQPGAAGTNVQIGQLQVATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL+++G+NL   T  SG   +  P   G   + Q Y+E SNV+  +E+  MI+ QR
Sbjct: 180 INPTGLQSVGENLYLETDSSGPANLLQPGIDGAGQILQQYVETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|167645396|ref|YP_001683059.1| flagellar basal body rod protein FlgG [Caulobacter sp. K31]
 gi|167347826|gb|ABZ70561.1| flagellar basal-body rod protein FlgG [Caulobacter sp. K31]
          Length = 262

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 167/262 (63%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQQ N+E+I+NNIAN+NT G+KR RAEF D LYQ  + AG+ S S D 
Sbjct: 1   MQALRTAATGMAAQQLNVEVISNNIANMNTVGFKRGRAEFQDLLYQTIERAGAQS-SGDG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            VVP G+ +G GV+  SV  ++ QG    T N  D+A+ G+G+ Q+  P     YTRAG+
Sbjct: 60  NVVPTGVQVGGGVKTGSVYRIHEQGTPTMTNNEFDVAIQGKGFLQILLPSGETAYTRAGN 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ + +GQ+VT DG T+ PGI IP       +S++G +      N   Q VGQL +ANF+
Sbjct: 120 FSTNDQGQIVTEDGYTVQPGITIPANATATIISKTGLVQVKMDGNPAPQTVGQLELANFM 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  IG+N+   T+ SG   I+ P   GF  + Q Y EASNVD+V EI+ +I AQRA
Sbjct: 180 NEGGLEAIGNNMYMETAASGAANIAAPGQQGFGTLLQNYTEASNVDSVSEITSLIVAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI  AD+M    + +R
Sbjct: 240 YEMNSKVITTADQMLQTTSNLR 261


>gi|285018207|ref|YP_003375918.1| flagellar basal-body rod protein flgg [Xanthomonas albilineans GPE
           PC73]
 gi|283473425|emb|CBA15930.1| probable flagellar basal-body rod protein flgg [Xanthomonas
           albilineans]
          Length = 261

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 146/259 (56%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  GM AQQT + +++NN+AN +TTG+KR RA F D LYQ  +  G    S+ + 
Sbjct: 3   QALWVAKTGMDAQQTRMSVVSNNLANTSTTGFKRDRASFEDLLYQQRRQPG--GASSSQT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +P G+ +G+GV++ +    + QG    TG  LD+ + GRG+ +V+ PD T  YTR GS 
Sbjct: 61  QLPSGLQLGTGVRVVATSKDFEQGSQQQTGRALDVMVNGRGFLEVQMPDGTSAYTRDGSL 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            ++++GQLVT  G  + PGI IPE  + + +   G +      ++    VG L + +FIN
Sbjct: 121 QVNAQGQLVTNSGYAIQPGIQIPEGAQSLTIGNDGTVSVQVPGSAAALQVGSLTLTDFIN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL+  G NL   T+ SG      P   G     QG LE SNV+ V+E+  MI  QRAY
Sbjct: 181 PSGLQATGQNLYVETAASGPAQSGTPGLNGLGTTVQGALEGSNVNVVEELVSMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMN+K I   D M   +  
Sbjct: 241 EMNAKAISTTDAMLGYLNN 259


>gi|146294548|ref|YP_001184972.1| flagellar basal-body rod protein FlgG [Shewanella putrefaciens
           CN-32]
 gi|145566238|gb|ABP77173.1| flagellar basal-body rod protein FlgG [Shewanella putrefaciens
           CN-32]
          Length = 261

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G    + +   
Sbjct: 4   ALWVSKTGLTAQDTKMTAIANNLANVNTTGFKRDRVAFNDLFYQVQRQPGGQVDALNN-- 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++   + ++T G++ +T   LDLA+ G G+FQVE P+  + YTR G F 
Sbjct: 62  LPSGLQLGAGTRVVGTQKIFTTGDMQNTSQQLDLAIQGHGFFQVEEPNGDLAYTRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
             S+G +VT+ G  LVP IVIPE+   + ++  G + A     ++ Q +GQ+ + NF N 
Sbjct: 122 RSSEGMMVTSQGLPLVPNIVIPEDALTVTIASDGVVTAQMAGEAEPQDLGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL   GDNL   T+ SG  +     D     ++QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 SGLEARGDNLYRETAASGVAVEGVAGDQALGALRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|149203125|ref|ZP_01880096.1| flagellar basal-body rod protein FlgG [Roseovarius sp. TM1035]
 gi|149143671|gb|EDM31707.1| flagellar basal-body rod protein FlgG [Roseovarius sp. TM1035]
          Length = 261

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 157/259 (60%), Gaps = 1/259 (0%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
             IAA GM+AQQ  +E I+NN+AN++TTGY   RAEFAD  YQ    AG+ + +AD  V+
Sbjct: 4   LKIAATGMAAQQMRVETISNNLANMSTTGYNARRAEFADLHYQQLARAGTIN-AADGTVL 62

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
           P G+ +G GV+ S++     QG +  T  +LDLA+ G G+ +V  P     YTR G+   
Sbjct: 63  PTGVQLGLGVRPSAISVQLAQGSLTQTNGDLDLAIDGGGYLEVRLPSGQSGYTRDGALKR 122

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
            + G +V ++G  + P I IPE+ R I ++  G++ A     ++ Q +GQ+ +  F N  
Sbjct: 123 SADGVIVNSEGFPIAPEITIPEDARSITINAEGEVFAFFQDTAEAQQLGQIDLVGFTNPK 182

Query: 184 GLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEM 243
           GL  IG NL   T  SG   ++     G   ++QGYLE S+VD V+EI+E+I AQR YE+
Sbjct: 183 GLEAIGGNLFVETEASGPANVTTAGQDGLGTLRQGYLEDSSVDPVREITELIEAQRGYEL 242

Query: 244 NSKVIEAADEMSSLITKMR 262
           N+KVI AAD+M S  T++R
Sbjct: 243 NAKVITAADQMLSATTQVR 261


>gi|52841453|ref|YP_095252.1| flagellar basal body rod protein FlgG [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52628564|gb|AAU27305.1| flagellar basal body rod protein FlgG [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 261

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 109/258 (42%), Positives = 162/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++ +G+ AQ  N+  IANN+AN+NTT +K+ RA F D +YQ  + AG  +QS+  + 
Sbjct: 4   ALWVSKSGLEAQDKNIATIANNLANVNTTAFKKGRALFEDLIYQNLRQAG--AQSSQNSQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P GI++G+GV + +   +++QG + +T N LD+A+ GRG+F V  PD T  YTR GSF 
Sbjct: 62  IPTGINMGTGVHLVATEKIFSQGSLQNTQNALDVAIEGRGFFTVLMPDGTQSYTRDGSFK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            DS GQ+V ++G  L P I IP +T +I +   G + A+   N+    +G + + +FIN 
Sbjct: 122 TDSTGQIVNSNGYPLQPNITIPPQTTKITIGTDGTVSALVAGNNAPSVIGNIQLTDFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+ IG NL   T  SG PI  NP + G   + QG LEASNV+ V+E+  MI AQR+YE
Sbjct: 182 AGLQPIGQNLYTETVASGTPITDNPGNSGLGTLLQGSLEASNVNVVEELVNMIQAQRSYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           + +K I+  D M   +T+
Sbjct: 242 ITAKSIQTVDSMLQYLTQ 259


>gi|312136039|ref|YP_004003377.1| flagellar basal-body rod protein flgg [Caldicellulosiruptor
           owensensis OL]
 gi|311776090|gb|ADQ05577.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           owensensis OL]
          Length = 267

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 95/270 (35%), Positives = 142/270 (52%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A         
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRA----DVVAG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   + +G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +   G+I     +        
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDEMGRITYKDQEGQVQDSGL 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SG+P+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSAASGEPVSEEEMEGQKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSIANNLK 266


>gi|225158946|ref|ZP_03725258.1| flagellar basal-body rod protein FlgG [Opitutaceae bacterium TAV2]
 gi|224802441|gb|EEG20701.1| flagellar basal-body rod protein FlgG [Opitutaceae bacterium TAV2]
          Length = 260

 Score =  219 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 105/260 (40%), Positives = 157/260 (60%), Gaps = 4/260 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +   AA GM AQQ NL  IANN+AN+NT G+KR++ EF D LYQ+ + AG  +++ +  +
Sbjct: 4   SLYSAATGMEAQQLNLNTIANNLANVNTAGFKRSKIEFHDMLYQSPRNAG--AETGNGNL 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ IG+G +ISS   ++TQG++  +   LD+A+ G G+F+++ PD T  YTR GSF 
Sbjct: 62  LPTGVEIGNGSRISSTAKIFTQGQLTASSEKLDIAIQGEGFFEIQRPDGTTAYTRDGSFK 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            D  GQ+VTADG  ++ G                    VT  N+      +L +  F N 
Sbjct: 122 QDPNGQIVTADGLPVLSGFQAVPNGTTDITISDTG--DVTYTNAAGNETFRLTLTRFANP 179

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGLR++G NL   T  SG P    P + GF   +Q Y+E+SNV+ V+E+  +I AQRAYE
Sbjct: 180 AGLRSLGGNLYEETPASGTPETGQPGEQGFGTTQQYYIESSNVNIVEEMVNLIVAQRAYE 239

Query: 243 MNSKVIEAADEMSSLITKMR 262
           ++SK I+ +DEM   +T+++
Sbjct: 240 VSSKAIQTSDEMLQNVTQLK 259


>gi|92116936|ref|YP_576665.1| flagellar basal body rod protein FlgG [Nitrobacter hamburgensis
           X14]
 gi|91799830|gb|ABE62205.1| Flagellar basal-body rod FlgG [Nitrobacter hamburgensis X14]
          Length = 262

 Score =  219 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 165/261 (63%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYK+ RA F D +Y   +  G+ + S   
Sbjct: 1   MRALYTAATGMAAQELNVQVISNNIANLRTTGYKKQRAAFQDLIYDHVRRVGAQA-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P GI +G GV+      + +QG +  TGN+LD+A+ G G+F+++ PD T  YTR G+
Sbjct: 60  TILPVGIDLGGGVKTVGTPRLMSQGTLSQTGNDLDIAIRGEGFFKIQMPDGTYQYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++V A GN + P I IP+ +  I ++  GQ+       +    +GQ+ +  F+
Sbjct: 120 FQMDNQGRIVNAQGNPVQPTITIPQNSAGITINAQGQVSVTLPGQTTPTVLGQIGLTRFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+ +GDN    T  SG P     +  G+  ++Q  LE +NV+ V EIS++I+AQRA
Sbjct: 180 NKAGLQPVGDNNFTETPASGPPQDGIANIDGYGDMQQSSLEQANVEVVSEISDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KVI AAD+M    + +
Sbjct: 240 YEMNAKVISAADQMLQSASAL 260


>gi|302872712|ref|YP_003841348.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575571|gb|ADL43362.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 267

 Score =  219 bits (557), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 95/270 (35%), Positives = 143/270 (52%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A         
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRA----DVVAG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   + +G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +  +G+I     +        
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDETGRITYKDQEGQIQDSGL 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SG+P+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSAASGEPVSEEEMEGQKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSMANNLK 266


>gi|222530298|ref|YP_002574180.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222457145|gb|ACM61407.1| flagellar basal-body rod protein FlgG [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 267

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 96/270 (35%), Positives = 142/270 (52%), Gaps = 13/270 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM AQQTN++II+NN+AN+NTT +K+ +AEF D LY+    A         
Sbjct: 2   MRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLLYETLSRA----DVVAG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG GV IS++   + +G +  T N LDLA+ G G+F V TP+    YTR GS
Sbjct: 58  DGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVSTPNG-PRYTRDGS 116

Query: 121 FNIDS-KGQLVTADGNTLVPGIVIPEETREIK-------VSRSGQILAVTGKNSDFQPVG 172
           F + + +GQ+     +          E    +       +  +G+I              
Sbjct: 117 FKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDETGRITYKDQDGQIQDSGF 176

Query: 173 QLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEIS 232
           ++ I  FIN  GL   G NL   ++ SGDP+     +   + + QG+LE SNV  V E+ 
Sbjct: 177 KIKIVRFINPQGLLAEGKNLYNVSAASGDPMSEEEMEGQKSRILQGFLEMSNVQVVDEMV 236

Query: 233 EMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           ++I AQRAYE+NSK I+ AD+M S+   ++
Sbjct: 237 KLIIAQRAYEINSKAIQTADDMLSMANNLK 266


>gi|167628969|ref|YP_001679468.1| flagellar basal-body rod protein flgg, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591709|gb|ABZ83457.1| flagellar basal-body rod protein flgg, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 258

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 102/264 (38%), Positives = 148/264 (56%), Gaps = 10/264 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   +A GM AQQ N++ I+NN+AN+NT GYK++RAEF D LY   + A         
Sbjct: 2   MRALYSSATGMIAQQLNMDTISNNLANVNTNGYKKSRAEFQDLLYSTIRTA--------T 53

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKT--VMYTRA 118
           A VP G+ +G+GV+ SS+  + + G +V T N  DLA+ G G+F++  P+      YTR 
Sbjct: 54  AQVPTGMQVGAGVRPSSITTIISSGNMVQTDNPYDLAITGEGYFRLINPNNDAVPFYTRD 113

Query: 119 GSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           GSF +D +G LV ADG  L     +PE   ++ ++  G I              ++ +  
Sbjct: 114 GSFKLDKEGYLVNADGLRLDGFDPLPEGATDLDINADGMISYKNAVGERVDTGQRIQLYT 173

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F N AGL   G NLL ++  SG+ I  +    G   + Q YLE+SNV  V E+  MI+AQ
Sbjct: 174 FPNPAGLNREGRNLLTQSEASGEAIGGDAGADGRGRIAQRYLESSNVQVVDEMVAMITAQ 233

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE+N+K I+ ADEM      ++
Sbjct: 234 RAYEVNTKAIQTADEMLGQANNLK 257


>gi|188582486|ref|YP_001925931.1| flagellar basal-body rod protein FlgG [Methylobacterium populi
           BJ001]
 gi|179345984|gb|ACB81396.1| flagellar basal-body rod protein FlgG [Methylobacterium populi
           BJ001]
          Length = 263

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 117/261 (44%), Positives = 170/261 (65%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYKR +  F D LYQ  + +GS S S   
Sbjct: 1   MRALYAAATGMAAQELNVQVISNNIANLRTTGYKRQQVHFQDLLYQNLRRSGS-STSDQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+++GSGV+ +S     +QG +  T  + D+A+ G G F+V  PD    YTR GS
Sbjct: 60  TILPAGLALGSGVKTTSTARAMSQGPLAQTDKDYDVAIRGEGLFRVRLPDGRNAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++D++GQLVT DG  L PG+ +P     + +S +G + A     +  Q +GQ  +A F+
Sbjct: 120 FDLDAQGQLVTRDGYLLDPGVTVPNTATSVTISATGAVQATLPGQTAPQALGQFQLARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IGDNL   T+ SG  I   P   GF +++Q +LE +NV+AV EIS +I+AQRA
Sbjct: 180 NKVGLESIGDNLFVETAASGPAITGLPGSEGFGNLQQNWLEEANVNAVTEISSLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSKV+ AAD+M S  ++M
Sbjct: 240 YEMNSKVVTAADQMLSTTSQM 260


>gi|328948267|ref|YP_004365604.1| flagellar basal-body rod protein FlgG [Treponema succinifaciens DSM
           2489]
 gi|328448591|gb|AEB14307.1| flagellar basal-body rod protein FlgG [Treponema succinifaciens DSM
           2489]
          Length = 264

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 111/263 (42%), Positives = 161/263 (61%), Gaps = 4/263 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM+ QQ N++ I+NN++N+NTTG+K+ RAEF D LYQ  K+AG+P  + +  
Sbjct: 3   RSLWNAATGMNGQQMNIDTISNNLSNVNTTGFKQHRAEFEDLLYQNVKLAGTP--ATEDT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           V P G  +GSGV++ + + + TQG +  TG + D+A+VG G+F+V+  D +  YTR GSF
Sbjct: 61  VTPVGHQMGSGVKVGATQRIMTQGSLQATGVDTDVAVVGDGFFRVQQYDGSWAYTRDGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIK--VSRSGQILAVTGKNSDFQPVGQLLIANF 179
            +DS GQLVTA+G  ++P I++PE  +     +S  G++        +   VGQL +  F
Sbjct: 121 KVDSTGQLVTANGLRVMPEIIMPEGFQLETLSISDGGRVNIKVNGELEPVEVGQLELYRF 180

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
            N  GL N GDNL   T+ SG+PI   P   G    K  +LE SNV  V E+ +MI AQR
Sbjct: 181 PNAVGLENTGDNLYKVTNASGEPIAGRPGIDGMGITKHKFLEMSNVSVVNEMVQMIVAQR 240

Query: 240 AYEMNSKVIEAADEMSSLITKMR 262
           AYE NSK I+ +D M      ++
Sbjct: 241 AYEFNSKAIQTSDNMLQTAAGLK 263


>gi|85706167|ref|ZP_01037262.1| flagellar basal-body rod protein FlgG [Roseovarius sp. 217]
 gi|85669331|gb|EAQ24197.1| flagellar basal-body rod protein FlgG [Roseovarius sp. 217]
          Length = 261

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 158/259 (61%), Gaps = 1/259 (0%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
             IAA GM+AQQ  +E I+NN+AN++TTGY   RAEFAD  YQ    AG+ + + D  V+
Sbjct: 4   LKIAATGMAAQQMRVETISNNLANMSTTGYNARRAEFADLHYQQLARAGTIN-ATDGTVL 62

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
           P G+ +G GV+ +++     QG +  T  +LD+A+ G G+ +V  P     YTR G+   
Sbjct: 63  PTGVQLGLGVRPAAISVQLAQGSLSQTNGDLDVAIEGNGYLEVTLPSGQAAYTRDGALKR 122

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
            + G +V ++G  + P I IPE+ R I ++  G++ A    N++ Q +GQL +A F N  
Sbjct: 123 SADGIIVNSEGFPVAPEITIPEDARSITINAEGEVFAFFQDNAEAQQLGQLDLAGFSNPK 182

Query: 184 GLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEM 243
           GL  IG NL   T  SG   ++     G   ++QGYLE S+VD V+EI+E+I AQR YE+
Sbjct: 183 GLEAIGSNLFVETEASGPANVTTAGQDGLGTLRQGYLEDSSVDPVREITELIEAQRGYEL 242

Query: 244 NSKVIEAADEMSSLITKMR 262
           N+KVI AAD+M S  T++R
Sbjct: 243 NAKVITAADQMLSATTQVR 261


>gi|89902479|ref|YP_524950.1| flagellar basal-body rod FlgG [Rhodoferax ferrireducens T118]
 gi|89347216|gb|ABD71419.1| Flagellar basal-body rod FlgG [Rhodoferax ferrireducens T118]
          Length = 260

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 105/261 (40%), Positives = 157/261 (60%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           + +  I+  GM AQQ  L++I+NN+AN++T G+KRA A F D +YQ  + AG  S S+++
Sbjct: 2   INSLWISKTGMEAQQMQLDVISNNLANVSTNGFKRASAVFEDLMYQNLRQAG--SNSSEQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           + +P G+ +G GV+  +    + QG +  +GN LD+A+ G G+FQV  PD T  YTR GS
Sbjct: 60  SQLPTGLQVGLGVRTVATSRSFAQGNLQQSGNKLDVAIQGNGFFQVTMPDGTTNYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F + S GQLVTA G  +  G+ +P     I ++  G + A        Q +G + +A+F+
Sbjct: 120 FQVSSTGQLVTATGLPIANGVTVPANATSIAIAGDGTVTAQVPGTPTPQGIGSISLASFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL A ++ SG P    P   G   + QGY+E SNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLDPKGQNLYAESTASGQPNSGTPGADGMGALMQGYVETSNVNVVQELVTMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSK I+ +D+M   + ++
Sbjct: 240 YEMNSKAIQTSDQMLQKLGQL 260


>gi|262276415|ref|ZP_06054224.1| flagellar basal-body rod protein FlgG [Grimontia hollisae CIP
           101886]
 gi|262220223|gb|EEY71539.1| flagellar basal-body rod protein FlgG [Grimontia hollisae CIP
           101886]
          Length = 262

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 99/259 (38%), Positives = 146/259 (56%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNISTISNNLANASTVGFKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G V  T N LDL + G G+FQ+  PD  + Y R G F 
Sbjct: 62  LPSGLMLGAGSKVVATQRVHTNGNVQTTNNALDLMIEGDGFFQILLPDGNIGYQRNGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G +  +  G  L P IV+P +  ++ V   G++ A      +   +GQ+   +FIN
Sbjct: 122 LNDEGVIVTSGAGYPLEPEIVVPPDAIQVTVGTDGEVSARLRGQQENAILGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   G   V+Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGSVRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M S + +
Sbjct: 242 EMNSKVISSVDQMLSYVNQ 260


>gi|27380939|ref|NP_772468.1| flagellar basal body rod protein FlgG [Bradyrhizobium japonicum
           USDA 110]
 gi|27354105|dbj|BAC51093.1| flagellar basal-body rod protein [Bradyrhizobium japonicum USDA
           110]
          Length = 262

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 162/261 (62%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTG+K+  A F D +Y+  +  G+ + S   
Sbjct: 1   MQALHTAATGMAAQELNVQVISNNIANLRTTGFKKQTAAFQDLIYEHVRRVGAQA-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ IG GV+        TQG +  TGN+LDLA+ G G+F++  PD T  YTR G+
Sbjct: 60  TIVPVGVDIGGGVKTVGTPRSMTQGTLSQTGNDLDLAISGEGFFKILMPDGTFQYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VTA GN + P I IP     + V+  GQ+      +S     GQL +  FI
Sbjct: 120 FQMDNQGRVVTAQGNPVQPTITIPNNASGLTVNEQGQVSVTLPGSSTSAVQGQLGLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+ +G+N    T  SG P     +  G+  + QG LE +NVD V E+S++I+AQRA
Sbjct: 180 NKAGLQPVGNNQFTETPSSGPPQDGTANTEGYGKITQGSLEQANVDVVSEMSDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KVI AAD+M    T +
Sbjct: 240 YEMNAKVISAADQMMQSTTAL 260


>gi|332305617|ref|YP_004433468.1| flagellar basal-body rod protein FlgG [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172946|gb|AEE22200.1| flagellar basal-body rod protein FlgG [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 262

 Score =  218 bits (556), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 160/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ A QT++ +I+NN+AN +T G+K+ RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAAQTDVAVISNNLANASTVGFKKDRAIFEDLLYQNINQPG--GRSSADTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  +TQG ++ T N LD+++ GRG+F+++ PD T+ YTR G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKAHTQGNMLTTENALDMSIQGRGFFEIQQPDGTIAYTRNGQFT 121

Query: 123 IDSKGQLVTADGN-TLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +GQ+VT      L P I +PE+ ++I +S+ G++ A     +D Q +GQ+ +++F+N
Sbjct: 122 LNDEGQIVTPGAGFLLQPNITVPEDAQQITISQDGEVSASIRGQADPQVLGQISLSDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ IG NL   T+ SG PI   P   G   V QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 MTGLQPIGQNLYVETATSGAPIQGVPGLEGLGTVVQGALETSNVNVTEELVNLIESQRLY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D M   + +
Sbjct: 242 EMNSKVISAVDSMLGQVIQ 260


>gi|54307272|ref|YP_128292.1| putative FlgG flagellar basal-body rod protein [Photobacterium
           profundum SS9]
 gi|46911692|emb|CAG18490.1| Putative FlgG flagellar basal-body rod protein [Photobacterium
           profundum SS9]
          Length = 261

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 100/258 (38%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G++AQ T +++I+NN+AN+NT G+K+ RA F D  YQ +K  G  + +  +  
Sbjct: 4   ALWISKTGLAAQDTQMQVISNNLANVNTVGFKQDRAVFEDLFYQMKKQPG--AMTDQQNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P G+ +G+GV++   + +   G   +T    DLA++G G+FQ+E  D    YTR G F+
Sbjct: 62  NPGGLQLGNGVRVVGTQKLMKTGAYQNTEQATDLAVLGSGFFQIELADGNTGYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +S+G +VTA G  L+P I IPE      V   G +   T  + + Q +GQ+ +ANF N 
Sbjct: 122 RNSEGMMVTAAGLPLMPNIEIPENATNFSVGTDGMVTISTADDPEPQEIGQITLANFANA 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+++G NL   T  SG PI     + G   + Q  LE SNV+ V+E+  MI+ QRAYE
Sbjct: 182 AGLQSLGGNLFKETGASGAPIEGVGGEDGLGQISQFSLEGSNVNVVEEMVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ +AD+M   +++
Sbjct: 242 MNAKVVSSADQMLKFVSQ 259


>gi|91792666|ref|YP_562317.1| flagellar basal body rod protein FlgG [Shewanella denitrificans
           OS217]
 gi|91714668|gb|ABE54594.1| Flagellar basal-body rod FlgG [Shewanella denitrificans OS217]
          Length = 262

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SAD   
Sbjct: 4   ALWISKTGLDAQQTDISVISNNVANASTIGYKKSRAVFEDLLYQTVNQAG--GISADNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + +++QG ++ T N+LDL + G G+F+V+ PD T  YTR G F+
Sbjct: 62  LPNGLNIGAGTKVVATQKMFSQGNMLTTDNSLDLMIEGPGFFEVQLPDGTPAYTRNGQFS 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE    I VS  G++       ++ Q +GQ+ + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPENATGITVSAGGEVSVKIPGTAESQVIGQITMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPLGQNLYTETGASGTPIQGTASLDGLGAIRQGALETSNVNVTEELVNLIQSQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + I +
Sbjct: 242 EMNSKVISAVDQMLAYINQ 260


>gi|109899400|ref|YP_662655.1| flagellar basal body rod protein FlgG [Pseudoalteromonas atlantica
           T6c]
 gi|109701681|gb|ABG41601.1| flagellar basal-body rod protein FlgG [Pseudoalteromonas atlantica
           T6c]
          Length = 262

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 160/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ A QT++ +I+NN+AN +T G+K+ RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAAQTDVAVISNNLANASTVGFKKDRAIFEDLLYQNINQPG--GRSSADTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  +TQG ++ T N LD+++ GRG+F+++ PD ++ YTR G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKAHTQGNMLTTENALDMSIQGRGFFEIQQPDGSIAYTRNGQFT 121

Query: 123 IDSKGQLVTADGN-TLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +GQ+VT      L P I +PE+ ++I +S+ G++ A     +D Q +GQ+ +++F+N
Sbjct: 122 LNDEGQIVTPGAGFLLQPNITVPEDAQQITISQDGEVSASIRGQADPQVLGQISLSDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ IG NL   T+ SG PI   P   G   V QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 MTGLQPIGQNLYVETATSGAPIQGVPGLEGLGTVVQGALETSNVNVTEELVNLIESQRLY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D M   + +
Sbjct: 242 EMNSKVISAVDSMLGQVIQ 260


>gi|304317903|ref|YP_003853048.1| flagellar basal-body rod protein FlgG [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779405|gb|ADL69964.1| flagellar basal-body rod protein FlgG [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 266

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 97/268 (36%), Positives = 143/268 (53%), Gaps = 10/268 (3%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM+AQQ N+++I+NN+AN+NTT +KR RAEF D +YQ  +     +     
Sbjct: 2   IRALWSAASGMNAQQLNVDVISNNLANVNTTSFKRDRAEFQDLMYQTLQTEDVNA----G 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV+ S++   +++G +  T N LD+AL G G+F V  PD    YTR GS
Sbjct: 58  QGKPVNMQVGVGVRPSAIVKDFSEGSLQETDNPLDVALDGEGFFAVLGPDGNTYYTRDGS 117

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQ------ILAVTGKNSDFQPVGQL 174
           F +       T       P +           ++         +++V   +   Q +  L
Sbjct: 118 FKLSVDQNTATLTTADGYPVLDDGGNPITFDSTQKDISISPLGVISVKNPDGTQQDIATL 177

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            I NF N  GL N G+NL   T+ SG P   +       +V QG+LE SNV  V E+  M
Sbjct: 178 GIYNFQNPNGLLNKGNNLYEATAASGAPGTRDDFQGKMGNVVQGFLETSNVQVVNEMVNM 237

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+AAD+M S+   +R
Sbjct: 238 IAAQRAYELNSKAIQAADDMLSIANNLR 265


>gi|116626490|ref|YP_828646.1| flagellar basal-body rod protein FlgG [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229652|gb|ABJ88361.1| flagellar basal-body rod protein FlgG [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 263

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 112/262 (42%), Positives = 155/262 (59%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM+AQQ N++ IA+N+AN NT GYK  RA+F D +YQ     G  S S  +
Sbjct: 2   IRALYSAASGMTAQQLNVDNIAHNLANANTAGYKMRRAQFQDLIYQTVVQPG--SASGQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             VP G+ +G G + SS   ++TQG    T N LDL + G+G+FQV  P   + YTR+G+
Sbjct: 60  TTVPTGLQVGLGTRTSSNEILFTQGSFAQTDNPLDLVIQGKGFFQVRQPSGQLAYTRSGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ D  G +VT DGNTL P I +P   ++I +++ G +       S  Q  GQ+ +ANF 
Sbjct: 120 FHCDRDGNIVTQDGNTLEPQITVPAAAQQISIAQDGTVSYTLPNQSAAQQAGQIQLANFQ 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNP-DDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           N AGL ++G NL   T  SGD  +  P    G   V QGY E SNV  V+E   +I AQR
Sbjct: 180 NPAGLNSVGGNLYLPTDASGDATVGTPGGQEGLGSVLQGYTEQSNVSVVEEFINLIVAQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
            YE NSKV++AAD+M   +  +
Sbjct: 240 GYEANSKVVKAADDMYQQVNNL 261


>gi|291334316|gb|ADD93977.1| flagellar basal body rod protein FlgG [uncultured marine bacterium
           MedDCM-OCT-S09-C247]
          Length = 257

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 110/257 (42%), Positives = 160/257 (62%), Gaps = 2/257 (0%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
             +A  G++AQQ  +++IANN+AN+NTTG+KR RA F    YQ  K AG  +Q+AD   +
Sbjct: 1   MHVAKTGLNAQQYKMQVIANNLANVNTTGFKRDRANFESLFYQIVKTAG--AQTADDTAL 58

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
              +++G+GV++ S + ++TQG +V T N+LDLA+ G+G+FQ   PD  V YTR+G  + 
Sbjct: 59  TSPLAVGTGVKVVSTQKLFTQGGLVSTDNSLDLAIDGQGFFQALLPDGRVGYTRSGILSR 118

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
           +++G L T  G  L P I +P +   I VS +G +      N   Q VGQ+ IANF N  
Sbjct: 119 NAEGVLTTTSGYVLQPQIQLPADATSINVSTTGIVSVTEPGNDIAQEVGQISIANFSNPR 178

Query: 184 GLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEM 243
           GL  IG+N    ++ SG      P D GF  V QGY+E+SNV+ V+++ +MI  QRAYE+
Sbjct: 179 GLTPIGENFFVPSAESGVAQEGAPLDGGFGKVLQGYVESSNVNVVQQLVDMIETQRAYEV 238

Query: 244 NSKVIEAADEMSSLITK 260
           +SK I A DEM   I++
Sbjct: 239 SSKSITAVDEMMQFISR 255


>gi|170742325|ref|YP_001770980.1| flagellar basal-body rod protein FlgG [Methylobacterium sp. 4-46]
 gi|168196599|gb|ACA18546.1| flagellar basal-body rod protein FlgG [Methylobacterium sp. 4-46]
          Length = 263

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 119/261 (45%), Positives = 169/261 (64%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYKR +A F D LYQ  + AG+ + S   
Sbjct: 1   MRALYAAATGMAAQELNVQVISNNIANLRTTGYKRQQAHFQDLLYQNLRRAGTAT-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+++GSGV+ +S   V +QG +  T    D+A+ G G FQ+  PD    YTR GS
Sbjct: 60  NQLPAGLALGSGVKTTSTARVMSQGTLSSTEKTYDVAIRGEGLFQITMPDGRTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++D++GQ+V+ DG  L P I +P     + +S SG + A     +  Q +GQ+ +A F+
Sbjct: 120 FDLDAQGQIVSRDGYLLNPAITVPNNATAVTISASGLVQATLPGQTAPQNLGQIQLARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IGDNL   T  SG  I  NP   GF  ++Q YLE +NV+AV EIS +I+AQRA
Sbjct: 180 NKVGLESIGDNLFIETQASGPAIQGNPGTEGFGSLQQSYLEEANVNAVTEISSLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSKV+ AAD+M S  ++M
Sbjct: 240 YEMNSKVVTAADQMLSTTSQM 260


>gi|28869144|ref|NP_791763.1| flagellar basal-body rod protein FlgG [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|71735047|ref|YP_275559.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213967579|ref|ZP_03395727.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tomato T1]
 gi|257484944|ref|ZP_05638985.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289627766|ref|ZP_06460720.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651643|ref|ZP_06482986.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298487853|ref|ZP_07005893.1| Flagellar basal-body rod protein flgG [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301385716|ref|ZP_07234134.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060071|ref|ZP_07251612.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tomato K40]
 gi|302134830|ref|ZP_07260820.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|302185580|ref|ZP_07262253.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           syringae 642]
 gi|28852384|gb|AAO55458.1| flagellar basal-body rod protein FlgG [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|71555600|gb|AAZ34811.1| flagellar basal-body rod protein FlgG [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213927880|gb|EEB61427.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tomato T1]
 gi|298157578|gb|EFH98658.1| Flagellar basal-body rod protein flgG [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320325096|gb|EFW81165.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329355|gb|EFW85348.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866425|gb|EGH01134.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330880529|gb|EGH14678.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330986471|gb|EGH84574.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011045|gb|EGH91101.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331017022|gb|EGH97078.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 262

 Score =  218 bits (554), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 113/259 (43%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G++AQ TNL  I+NN+AN++TTG+K  RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALYVAKTGLAAQDTNLTTISNNLANVSTTGFKSDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T N LDLA+ GRG+FQV  PD TV Y+R G+F+
Sbjct: 62  LPSGLQLGTGVRIVGTQKNFTAGSLQTTNNPLDLAVNGRGFFQVTQPDGTVAYSRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANFIN 181
           +D+ GQ+VTA+G  L P IV+P+  +   V + G +       +    +   +  A+FIN
Sbjct: 122 LDANGQIVTANGYALEPAIVVPQNAQTFTVGQDGTVSVTLAGATATPQIIGNIQTADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG NL   T  SG P I  P   G     Q  LE SNV  V+E+  MI+ QRAY
Sbjct: 182 PAGLQAIGGNLYLETGSSGAPQIGTPGLNGLGPTLQNTLENSNVSTVEELVNMITTQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   +T+
Sbjct: 242 EMNSKVISTADQMLQNLTQ 260


>gi|149908757|ref|ZP_01897418.1| putative flagellar basal-body rod protein [Moritella sp. PE36]
 gi|149808299|gb|EDM68238.1| putative flagellar basal-body rod protein [Moritella sp. PE36]
          Length = 261

 Score =  218 bits (554), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 151/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A   +  G++AQ   + IIANN+AN+NTTG+K+ R  F+D  Y  ++  G  + +     
Sbjct: 4   ALWTSKTGLAAQDVKMSIIANNLANVNTTGFKKDRVAFSDLFYDIKRQPG--ALADQNNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+++  + V+T G    TG  LD+A++G+G+FQVE     + YTR G F 
Sbjct: 62  IPTGVQVGNGVRVTGTQKVFTPGSFADTGQELDMAIIGKGFFQVEQVSGEIAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S  Q+V +DG  LVP I IP +   I +   G I A     S  Q VGQ+ +A+F N 
Sbjct: 122 LNSDSQIVNSDGLPLVPSIQIPADATSITIGSDGTITAQLAGESAPQDVGQITLASFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG        +     +KQ  LE SNV  V+E+ +MIS QRAYE
Sbjct: 182 AGLVALGGNLYTETGSSGAAQEGVAGEASLGQIKQRGLEGSNVSVVEEMVDMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   +T+
Sbjct: 242 MNAKVVSAADKMLQFVTQ 259


>gi|91204383|emb|CAJ70883.1| strongly similar to flagellar distal rod protein [Candidatus
           Kuenenia stuttgartiensis]
          Length = 262

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 111/261 (42%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA GM AQQ  L+ ++NN++NINTTG+KR++  F D LY    +AG  S+SA  
Sbjct: 2   LRALYTAATGMKAQQLFLDNVSNNLSNINTTGFKRSQVNFQDLLYSKRYIAG--SESAQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G GV+  S+  V++QG  V+T   LDLA+ G+G+FQ++  D ++ YTR GS
Sbjct: 60  FEIPAGIQLGGGVRTISISKVFSQGNHVNTERELDLAIQGKGFFQIQQSDGSIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++SKG++VTADG  L P I I   T     +     +  +  +   Q VGQ+++  F 
Sbjct: 120 FQLNSKGEVVTADGLPLSPSITITNATEISIGTDGTVYVKGSDPSGTLQNVGQIMLTMFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N +GL ++G NL   T  SG PI++   + G   + QG+LE SNV+ V E+  +I+AQRA
Sbjct: 180 NPSGLDSLGKNLYLETMASGSPIVTVAGEQGTGEIYQGFLENSNVETVTELVSLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NS+ I A+DEM S I  M
Sbjct: 240 YEINSRAISASDEMLSTINSM 260


>gi|66046704|ref|YP_236545.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257411|gb|AAY38507.1| Flagellar basal body rod protein:Protein of unknown function
           DUF1078 [Pseudomonas syringae pv. syringae B728a]
          Length = 262

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 112/259 (43%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G++AQ TNL  I+NN+AN++TTG+K  RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALYVAKTGLAAQDTNLTTISNNLANVSTTGFKSDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T N LDLA+ GRG+FQV  PD T+ Y+R G+F+
Sbjct: 62  LPSGLQLGTGVRIVGTQKNFTAGSLQTTNNPLDLAVNGRGFFQVTQPDGTIAYSRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANFIN 181
           +D+ GQ+VTA+G  L P IV+P+  +   V + G +       +    +   +  A+FIN
Sbjct: 122 LDANGQIVTANGYALEPAIVVPQNAQTFTVGQDGTVSVTLAGATATPQIIGNIQTADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG NL   T  SG P I  P   G     Q  LE SNV  V+E+  MI+ QRAY
Sbjct: 182 PAGLQAIGGNLYLETGSSGAPQIGTPGLNGLGPTLQNTLENSNVSTVEELVNMITTQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   +T+
Sbjct: 242 EMNSKVISTADQMLQNLTQ 260


>gi|119775448|ref|YP_928188.1| flagellar basal body rod protein FlgG [Shewanella amazonensis SB2B]
 gi|119767948|gb|ABM00519.1| flagellar basal-body rod protein FlgG [Shewanella amazonensis SB2B]
          Length = 262

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N LD+ + G G+F+++ PD T  YTR G F+
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNALDMMIEGPGFFEIQLPDGTTAYTRNGQFS 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IP+    I VS  G++   T   ++ Q VGQL +++FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPDNATSITVSAEGEVSVKTPGAAESQIVGQLTLSDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  IG NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPIGQNLYLETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|237799211|ref|ZP_04587672.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|330961201|gb|EGH61461.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|331022066|gb|EGI02123.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 262

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 113/259 (43%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G++AQ TNL  I+NN+AN++TTG+K  RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALYVAKTGLAAQDTNLTTISNNLANVSTTGFKSDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T N LDLA+ GRG+FQV  PD TV Y+R G+F+
Sbjct: 62  LPSGLQLGTGVRIVGTQKNFTAGSLQTTNNPLDLAVNGRGFFQVTQPDGTVAYSRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANFIN 181
           +D+ GQ+VTA+G  L P IV+P+  +   V + G +       +    +   +  A+FIN
Sbjct: 122 LDANGQIVTANGYALEPAIVVPQAAQTFTVGQDGTVSVTLAGATATPQIIGNIQTADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG NL   T  SG P I  P   G     Q  LE SNV  V+E+  MI+ QRAY
Sbjct: 182 PAGLQAIGGNLYLETGSSGAPQIGTPGLNGLGPTLQNTLENSNVSTVEELVNMITTQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   +T+
Sbjct: 242 EMNSKVISTADQMLQNLTQ 260


>gi|294084416|ref|YP_003551174.1| flagellar basal-body rod protein FlgG [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663989|gb|ADE39090.1| flagellar basal-body rod protein FlgG [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 262

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +  +A  G++AQQT +++IANN+AN+NTTG+KR RA F   LYQ  + AG   +++    
Sbjct: 5   SMHVAKTGLNAQQTRMQVIANNLANVNTTGFKRDRANFETLLYQVRRSAGE--ETSADTD 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +    ++G+G +I + + + +QG ++ T N+LDLA+ G G+FQV  PD  + YTR GSF+
Sbjct: 63  LTSAFAVGTGARIVNTQKMMSQGSMIQTDNSLDLAIEGSGFFQVLLPDGQIGYTRNGSFS 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +++G L T  G  L P I IP    +I +S  G +  +     + Q VGQ+ IA+F N 
Sbjct: 123 TNAEGTLTTPSGYVLQPEIQIPGNASQINISGDGIVSVIVAGEIEPQNVGQMTIADFNNR 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL+ IG++    T+ SG  II+NP + GF  + QG LEASNV+ V+E+  MI  QRAYE
Sbjct: 183 RGLQPIGESFSIETAASGAAIIANPQEQGFGKLVQGSLEASNVNVVQELVNMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           ++SK I + DEM   I+ 
Sbjct: 243 VSSKSITSVDEMLRFISN 260


>gi|74101660|gb|AAZ99750.1| FlgGL [Aeromonas hydrophila]
          Length = 275

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 98/258 (37%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ   +  I+NN+AN+NT G+KR R  F D  YQ ++  G  +Q   + +
Sbjct: 18  ALWVSKTGLSAQDAKMASISNNLANVNTVGFKRDRVAFEDLFYQVQRQPG--AQQDQQNL 75

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI +G+GV++   + V+T G+  +T   LD+A+VG G+F VE PD    YTR G ++
Sbjct: 76  SPIGIQMGNGVRVVGTQKVFTPGQFQNTNQELDMAVVGAGFFGVERPDGETAYTRNGQWH 135

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +++G LV +DG  ++P I IP+   ++ +   G + A      +   +G++ + NF N 
Sbjct: 136 RNAEGLLVNSDGLPMLPQIQIPDNATKVSIGTDGTVSATLPGQQENVELGRITLTNFTNP 195

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG+ I   P +     +KQ  LE+SNV+ V+E+ +MI+ QRAYE
Sbjct: 196 AGLEALGGNLYRATGASGEAIEGVPGEEAMGAIKQFTLESSNVNVVEEMVDMITTQRAYE 255

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   +T+
Sbjct: 256 MNAKVVSAADQMLKFVTQ 273


>gi|34497161|ref|NP_901376.1| flagellar basal body rod protein FlgG [Chromobacterium violaceum
           ATCC 12472]
 gi|34103018|gb|AAQ59381.1| flagellar basal-body rod protein flgG [Chromobacterium violaceum
           ATCC 12472]
          Length = 262

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQ   L  IANN+AN+NTTG+KR R  F D  YQ EK  G  S+  D  V
Sbjct: 4   ALWISKTGIQAQDARLTAIANNLANVNTTGFKRDRMIFEDLFYQVEKQPG--SKVDDNNV 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P G+ +G+G ++   + V+T+G +  T  +LD+A++G+G+ QV+  +    YTRAG  +
Sbjct: 62  SPSGVQMGNGTRLVGSQKVFTEGNITTTNQSLDVAIIGQGFLQVKMANGETGYTRAGQLS 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +   G L TA G  L P I IP +  +I +S +G++    G  +  + V ++ +A+FIN 
Sbjct: 122 LSKDGVLQTAQGLPLEPEIRIPADATKISISETGEVAVTRGSGTTPEAVDRIQLASFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +GDNL  +T  SGD    +P +     +KQG LE SNV  V+E+ +MI+AQR YE
Sbjct: 182 AGLLALGDNLFQKTDASGDANPGDPGNGALGKLKQGSLEGSNVQVVEEMVDMIAAQRTYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD M   + +
Sbjct: 242 MNTKVLSAADNMLQQLGQ 259


>gi|78485810|ref|YP_391735.1| hypothetical protein Tcr_1469 [Thiomicrospira crunogena XCL-2]
 gi|78364096|gb|ABB42061.1| Flagellar basal-body rod protein FlgG [Thiomicrospira crunogena
           XCL-2]
          Length = 263

 Score =  217 bits (553), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 147/259 (56%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           +A  +A  G+ AQ   L  I+NN+AN NT  YK  RAEF D +YQ  +  G+ +   ++ 
Sbjct: 3   RALYVAKTGLEAQDFRLATISNNLANANTYAYKTGRAEFNDLMYQNVRQPGAQATQNEEN 62

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P G+ +G+GV+   V+ ++TQG  + T N LD+ + G+G+FQ    D  +MYTR GSF
Sbjct: 63  TFPSGLQLGTGVKAIGVQKIHTQGNAMVTDNQLDVMIEGKGFFQALDQDGNIMYTRDGSF 122

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            ++  G LVT+ G  + P I IP  T E+ +S  G + A    N     VGQL +A FIN
Sbjct: 123 EVNQNGDLVTSSGYLVEPNINIPLNTTEVFISSDGVVSAKEPGNPQPIAVGQLELATFIN 182

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL   G N    T  SG P + NP+      + QG LE+SNV+ V+E+  MI AQR Y
Sbjct: 183 PAGLEATGKNFYIETLASGAPNVKNPEIEEAGSLLQGALESSNVNTVEELIGMIEAQRTY 242

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSK I AAD M   +  
Sbjct: 243 EMNSKAISAADGMMQYLNN 261


>gi|330899406|gb|EGH30825.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 262

 Score =  217 bits (553), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 111/259 (42%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G++AQ TNL  I+NN+AN++TTG+K  RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALYVAKTGLAAQDTNLTTISNNLANVSTTGFKSDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T N LDLA+ GRG+FQV  PD T+ Y+R G+F+
Sbjct: 62  LPSGLQLGTGVRIVGTQKKFTAGSLQTTNNPLDLAVNGRGFFQVTQPDGTIAYSRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANFIN 181
           +D+ GQ+VTA+G  L P IV+P+  +   V + G +       +    +   +  A+FIN
Sbjct: 122 LDANGQIVTANGYALEPAIVVPQNAQTFTVGQDGTVSVTLAGATATPQIIGNIQTADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ +G NL   T  SG P I  P   G     Q  LE SNV  V+E+  MI+ QRAY
Sbjct: 182 PAGLQAMGGNLYLETGSSGAPQIGTPGLNGLGPTLQNTLENSNVSTVEELVNMITTQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   +T+
Sbjct: 242 EMNSKVISTADQMLQNLTQ 260


>gi|157373205|ref|YP_001471805.1| flagellar basal-body rod protein FlgG [Shewanella sediminis
           HAW-EB3]
 gi|157315579|gb|ABV34677.1| flagellar basal-body rod protein FlgG [Shewanella sediminis
           HAW-EB3]
          Length = 261

 Score =  217 bits (553), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 99/258 (38%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   +  IANN+AN+NTTG+KR R  F D  YQ ++  G   Q  +   
Sbjct: 4   ALWVSKTGLTAQDVKMTTIANNLANVNTTGFKRDRVAFNDLFYQTQRQPG--GQVDELNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++   + ++T G+++ T   LDLA+ G+G+FQ+E  +  + Y+R G F 
Sbjct: 62  LPSGLQLGTGTRVVGTQKIFTSGDMLTTNQQLDLAIEGQGFFQIEEANGDLAYSRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +S G +VT+ G  LVP I IPE+   I ++  G + A     ++ Q +GQ+ + NF N 
Sbjct: 122 RNSDGLMVTSQGLPLVPNIEIPEDALTITIATDGIVTAQISGQAEAQELGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL   GDNL   T  SG  I     D     ++QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 TGLEARGDNLYRETGASGAAIEGVAGDQAIGQLRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|330445350|ref|ZP_08309002.1| flagellar basal-body rod protein FlgG [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489541|dbj|GAA03499.1| flagellar basal-body rod protein FlgG [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 262

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 147/259 (56%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K+ RA F D  YQ     G   QS     
Sbjct: 4   ALWVSKTGLDAQQTNISTISNNLANASTVGFKKGRAVFEDLFYQNINQPG--GQSTQDTT 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+TQG    T N +D+ + G G+FQV  PD  + YTR G F 
Sbjct: 62  LPTGLMLGAGSKVVATQKVFTQGNTQTTNNAMDMMIEGDGFFQVLLPDGNIGYTRNGQFT 121

Query: 123 IDSKGQ-LVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           I++ GQ + +  G  + P IV+PE+   I V   G++ A      + Q +GQ+   +FIN
Sbjct: 122 INADGQLVTSGSGYPVQPEIVVPEDAVGITVGTDGEVSARIRGEQENQVLGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             G+  IG NL   T  SGDP    P   G+  ++Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGMEPIGQNLFLPTGASGDPQEGTPGLEGYGSIRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI   D+M S + +
Sbjct: 242 EMNSKVISTVDQMLSYVNQ 260


>gi|332533173|ref|ZP_08409042.1| flagellar basal-body rod protein FlgG [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037455|gb|EGI73909.1| flagellar basal-body rod protein FlgG [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 262

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 157/259 (60%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNLANASTVGYKKSRAIFEDLLYQNINQPG--GRSSQDTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  +TQG ++ T N+LD  + G G+F+V  PD  + Y+R G F 
Sbjct: 62  MPSGLMLGAGAKVVANQKEFTQGNMLTTENSLDWMISGEGFFEVLQPDGNIAYSRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            D  G++VT+    +  P + +P++ + I VS+ G++       +D   +GQL I++FIN
Sbjct: 122 TDGDGRIVTSGAGYVIQPEMNVPDDAQSITVSQDGEVSVRVAGQADNVVIGQLTISDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  IG NL   T+VSG P+  NP   G   + QG LE SNV+  +E+  +I  QR Y
Sbjct: 182 PSGLEPIGQNLYTETAVSGAPVQGNPGVEGLGSIIQGSLETSNVNVTEELVNLIETQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A DEM S I +
Sbjct: 242 EMNSKVISAVDEMMSYINQ 260


>gi|220924578|ref|YP_002499880.1| flagellar basal-body rod protein FlgG [Methylobacterium nodulans
           ORS 2060]
 gi|219949185|gb|ACL59577.1| flagellar basal-body rod protein FlgG [Methylobacterium nodulans
           ORS 2060]
          Length = 263

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 121/261 (46%), Positives = 171/261 (65%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYKR +A F D LYQ  + AGS + S   
Sbjct: 1   MRALYAAATGMAAQELNVQVISNNIANLRTTGYKRQQAHFQDLLYQNLRRAGSAT-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+++GSGV+ +S   V +QG +  T    D+A+ G G+FQ+  PD    YTR GS
Sbjct: 60  NQLPAGLALGSGVKTTSTARVMSQGTLSSTEKTYDIAIRGEGFFQITLPDGRTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++DS+GQ+VT DG  + P I +P     + +S SG + A     +  Q +GQ+ +A F+
Sbjct: 120 FDLDSQGQIVTRDGYLINPSITVPNNATGVTISASGMVQATVPGQTAPQNLGQIQLARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IGDNL   T  SG  I  NP   GF +++Q YLE +NV+AV EIS +I+AQRA
Sbjct: 180 NKVGLESIGDNLFTETLASGPAITGNPGAEGFGNLQQSYLEEANVNAVTEISSLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSKV+ AAD+M S  ++M
Sbjct: 240 YEMNSKVVTAADQMLSTTSQM 260


>gi|167623363|ref|YP_001673657.1| flagellar basal body rod protein FlgG [Shewanella halifaxensis
           HAW-EB4]
 gi|167353385|gb|ABZ75998.1| flagellar basal-body rod protein FlgG [Shewanella halifaxensis
           HAW-EB4]
          Length = 262

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 112/259 (43%), Positives = 160/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T G+K++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNVANASTVGFKKSRAVFEDLLYQNVSQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+SIG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F+
Sbjct: 62  LPNGLSIGAGTKVVATQEMFTQGNMLTTDNSLDLMVEGPGFFEVQLPDGTAAYTRNGQFS 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE    I VS  G++   T  N++ Q VGQL IA+FIN
Sbjct: 122 LDETGQIVTPGSGYVIQPAITIPEGATSITVSAEGEVSVKTPGNAENQVVGQLAIADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYLETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDQMLSYVNQ 260


>gi|77359724|ref|YP_339299.1| flagellar basal body rod protein FlgG [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874635|emb|CAI85856.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 262

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 157/259 (60%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNLANASTVGYKKSRAVFEDLLYQNINQPG--GRSSQDTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  ++QG ++ T N+LD  + G G+F+V  PD  + Y+R G F 
Sbjct: 62  MPSGLMLGAGAKVVANQKNFSQGNMLTTENSLDWMISGSGFFEVLQPDGNIAYSRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            D  G++VT+    +  P + +P++ + I VS+ G++       +D   +GQ+ I++FIN
Sbjct: 122 TDGDGRVVTSGAGYVVQPEMNVPDDAQSITVSQDGEVSVRVAGQADNVVIGQITISDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  IG NL   T+VSG P+  NP   G   + QG LE SNV+  +E+  +I  QR Y
Sbjct: 182 PSGLEPIGQNLYTETAVSGAPVQGNPGVDGLGTIIQGSLETSNVNVTEELVNLIETQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A DEM S I +
Sbjct: 242 EMNSKVISAVDEMMSYINQ 260


>gi|315121847|ref|YP_004062336.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495249|gb|ADR51848.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 262

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 236/262 (90%), Positives = 254/262 (96%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKAF IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEK AGSPSQSAD+
Sbjct: 1   MKAFTIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKAAGSPSQSADQ 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           +VVPEGI+IGSGVQISSVRNVYTQGE+VHTGN+LDLALVGRGWFQVETPDKTVMYTRAGS
Sbjct: 61  SVVPEGINIGSGVQISSVRNVYTQGELVHTGNSLDLALVGRGWFQVETPDKTVMYTRAGS 120

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FNIDSKGQLVT+DGNTL+PGI IPEE RE+ VSRSGQI+AVTGKNSDFQP+GQLLIANF+
Sbjct: 121 FNIDSKGQLVTSDGNTLLPGITIPEEARELTVSRSGQIMAVTGKNSDFQPLGQLLIANFV 180

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGLRNIGDNL+ RTSVSG+ IIS+PDD GFAH+KQGYLEASNVDAVKEISEMISAQRA
Sbjct: 181 NEAGLRNIGDNLVTRTSVSGEAIISSPDDAGFAHIKQGYLEASNVDAVKEISEMISAQRA 240

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI+AADEMSSL++KMR
Sbjct: 241 YEMNSKVIQAADEMSSLVSKMR 262


>gi|119469952|ref|ZP_01612757.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Alteromonadales bacterium TW-7]
 gi|119446662|gb|EAW27935.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Alteromonadales bacterium TW-7]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 157/259 (60%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNLANASTVGYKKSRAIFEDLLYQNINQPG--GRSSQDTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  ++QG ++ T N+LD  + G G+F+V  PD  + Y+R G F 
Sbjct: 62  MPSGLMLGAGAKVVANQKNFSQGNMLTTENSLDWMISGPGFFEVLQPDGNIAYSRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            D  G++VT+    +  P + +P++ + I +S+ G++       +D   +GQL I++FIN
Sbjct: 122 TDGDGRIVTSGSGYVVQPEMNVPDDAQSITISQDGEVSVRISGQADNVVIGQLTISDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T+VSG P+  NP   G   + QG LE SNV+  +E+  +I  QR Y
Sbjct: 182 PSGLEPVGQNLYTETAVSGAPVQGNPGVEGLGTIIQGSLETSNVNVTEELVNLIETQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A DEM S I +
Sbjct: 242 EMNSKVISAVDEMMSYINQ 260


>gi|145297456|ref|YP_001140297.1| lateral flagellar basal-body rod protein LfgG [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142850228|gb|ABO88549.1| lateral flagellar basal-body rod protein LfgG [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 261

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 98/258 (37%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SAQ   +  I+NN+AN+NT G+KR R  F D  YQ ++  G  +Q   + +
Sbjct: 4   ALWVSKTGLSAQDAKMASISNNLANVNTVGFKRDRVAFEDLFYQVQRQPG--AQQDQQNL 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P GI +G+GV++   + V+T G+  +T   LD+A+VG G+F VE PD    YTR G ++
Sbjct: 62  SPIGIQMGNGVRVVGTQKVFTPGQFQNTNQELDMAVVGAGFFGVERPDGETAYTRNGQWH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +++G LV +DG  ++P I IP+   ++ +   G + A      +   +G++ + NF N 
Sbjct: 122 RNAEGLLVNSDGLPMLPQIQIPDNATKVSIGTDGTVSATLPGQQENVELGRITLTNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG+ I   P +     +KQ  LE+SNV+ V+E+ +MI+ QRAYE
Sbjct: 182 AGLEALGGNLYRATGASGEAIEGVPGEEAMGAIKQFTLESSNVNVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   +T+
Sbjct: 242 MNAKVVSAADQMLKFVTQ 259


>gi|89075497|ref|ZP_01161908.1| putative polar flagellar FlgG [Photobacterium sp. SKA34]
 gi|89048769|gb|EAR54340.1| putative polar flagellar FlgG [Photobacterium sp. SKA34]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 102/259 (39%), Positives = 148/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K+ RA F D  YQ     G   QS     
Sbjct: 4   ALWVSKTGLDAQQTNISTISNNLANASTVGFKKGRAVFEDLFYQNINQPG--GQSTQDTT 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+TQG    T N +D+ + G G+FQV  PD  + YTR G F 
Sbjct: 62  LPTGLMLGAGSKVVATQKVFTQGNTQTTNNAMDMMIEGDGFFQVLLPDGNIGYTRNGQFT 121

Query: 123 IDSKGQ-LVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           I+S+GQ + +  G  + P IV+PE+   I V   G++ A      + Q +GQ+   +FIN
Sbjct: 122 INSEGQLVTSGSGYPVQPEIVVPEDAVGITVGTDGEVSARIRGEQENQVLGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             G+  IG NL   T  SGDP    P   G+  ++Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGMEPIGQNLFLPTGASGDPQEGTPGLEGYGSIRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI   D+M S + +
Sbjct: 242 EMNSKVISTVDQMLSYVNQ 260


>gi|182680548|ref|YP_001834694.1| flagellar basal body rod protein FlgG [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636431|gb|ACB97205.1| flagellar basal-body rod protein FlgG [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 139/260 (53%), Positives = 188/260 (72%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           MKA  IAA GM+AQ  N+++IANNIAN+NTT +KRARAEF D LYQAE++ G  ++    
Sbjct: 1   MKALSIAATGMAAQDLNVQVIANNIANMNTTAFKRARAEFTDLLYQAERLQGVANRGQSN 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++PEG  +G GV+ +++RN++ QG + +TGN LDLAL GRGWFQV +P+   +YTRAG+
Sbjct: 61  -MIPEGAQLGLGVRTAAIRNLHVQGTLTNTGNKLDLALNGRGWFQVTSPEGETLYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ ++ GQLVT DG  + P I IP +  ++ V++SG +       +  Q +GQL + NF 
Sbjct: 120 FSTNATGQLVTTDGYLVNPNITIPTDATDVAVNQSGVVSVTRNGQTSAQQIGQLTLTNFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  +G NL  +T  SG P+   P DIGFA + QGYLE SNVD VKEI+++ISAQRA
Sbjct: 180 NEAGLTPLGSNLYRQTEASGTPVSGTPGDIGFATINQGYLETSNVDPVKEITDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI+AADEM++ I+K
Sbjct: 240 YEMNSKVIQAADEMATTISK 259


>gi|127512281|ref|YP_001093478.1| flagellar basal body rod protein FlgG [Shewanella loihica PV-4]
 gi|126637576|gb|ABO23219.1| flagellar basal-body rod protein FlgG [Shewanella loihica PV-4]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 159/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEVQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IP++   I VS  G++   T   ++ Q VGQL +++FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPDDATSITVSAEGEVSVKTPGAAENQVVGQLSMSDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYLETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDQMLSYVNQ 260


>gi|90579911|ref|ZP_01235719.1| putative polar flagellar FlgG [Vibrio angustum S14]
 gi|90438796|gb|EAS63979.1| putative polar flagellar FlgG [Vibrio angustum S14]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 148/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K+ RA F D  YQ     G   QS     
Sbjct: 4   ALWVSKTGLDAQQTNISTISNNLANASTVGFKKGRAVFEDLFYQNINQPG--GQSTQDTT 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+TQG    T N +D+ + G G+FQV  PD  + YTR G F 
Sbjct: 62  LPTGLMLGAGSKVVATQKVFTQGNTQTTNNAMDMMIEGDGFFQVLLPDGNIGYTRNGQFT 121

Query: 123 IDSKGQ-LVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           I+S+GQ + +  G  + P IV+P++   I V   G++ A      + Q +GQ+   +FIN
Sbjct: 122 INSEGQLVTSGSGYPVQPEIVVPDDAVGITVGTDGEVSARIRGEQENQVLGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             G+  IG NL   T  SGDP    P   G+  ++Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGMEPIGQNLFLPTGASGDPQEGTPGLEGYGSIRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI   D+M S + +
Sbjct: 242 EMNSKVISTVDQMLSYVNQ 260


>gi|85715052|ref|ZP_01046037.1| hypothetical protein NB311A_11787 [Nitrobacter sp. Nb-311A]
 gi|85698249|gb|EAQ36121.1| hypothetical protein NB311A_11787 [Nitrobacter sp. Nb-311A]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 106/261 (40%), Positives = 163/261 (62%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYK+ RA F D +Y   +  G+ + SA  
Sbjct: 1   MRALYTAATGMAAQELNVQVISNNIANLRTTGYKKQRAAFQDLIYDHVRRVGAQA-SAQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P GI +G GV+        +QG +  TGN+LD+A+ G G+F++  PD T  YTR G+
Sbjct: 60  TILPVGIDLGGGVKTVGTPRQMSQGTLSQTGNDLDIAIRGEGFFKILMPDGTFQYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++V A GN + P I IP+ +  I ++  GQ+       +    +GQ+ +  FI
Sbjct: 120 FQMDNQGRIVNAQGNPVQPTITIPQNSAGITINSQGQVSVTLPGQTTPTVLGQIGLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+ +GDN    T  SG       +  GF  ++Q  LE +NV+ V EIS++I+AQRA
Sbjct: 180 NKAGLQPVGDNNFKETPASGPFQDGIANIDGFGDMQQSSLEQANVEVVSEISDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KV+ AAD+M    + +
Sbjct: 240 YEMNAKVVSAADQMLQSASAL 260


>gi|24374755|ref|NP_718798.1| flagellar basal body rod protein FlgG [Shewanella oneidensis MR-1]
 gi|24349419|gb|AAN56242.1|AE015761_12 flagellar basal-body rod protein FlgG [Shewanella oneidensis MR-1]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+++ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEIQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE+   I VS  G++   T   ++ Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPPITIPEDATSITVSAEGEVSVKTPGAAENQVVGQLSMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|294013088|ref|YP_003546548.1| flagellar basal-body rod protein FlgG [Sphingobium japonicum UT26S]
 gi|292676418|dbj|BAI97936.1| flagellar basal-body rod protein FlgG [Sphingobium japonicum UT26S]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 106/258 (41%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ T + +IANN+AN+NTTG+KR RA+F    YQ    AG+ S S +K  
Sbjct: 5   ALHVARTGLDAQNTKMRVIANNLANVNTTGFKRDRADFETLAYQQIVAAGANSDSENKFA 64

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
              G+++GSGV +     +  QG +  TGN LD+A+ G G+FQV+ PD ++ YTRAG+F 
Sbjct: 65  T--GLNLGSGVALQGTSKINAQGTLNQTGNTLDMAIEGSGYFQVQQPDGSIAYTRAGNFT 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
             ++G +VT+DG  L+P I +PE    + +   G + A     ++   +GQ+ +A+F+N 
Sbjct: 123 TTAEGVVVTSDGLPLIPQITVPEGATSVTIGNDGTVSATLQGQTEPTQLGQIELASFMNP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL ++G NLL  ++ SG P +      G   V+ GYLE SNV+ V+E+ +MI  QRAYE
Sbjct: 183 GGLTSVGGNLLKESAASGTPQVGVAGLDGRGVVRAGYLETSNVNVVEELVDMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK+I+A DEM     +
Sbjct: 243 VNSKMIKATDEMLQYANQ 260


>gi|167626157|ref|YP_001676451.1| flagellar basal-body rod protein FlgG [Shewanella halifaxensis
           HAW-EB4]
 gi|167356179|gb|ABZ78792.1| flagellar basal-body rod protein FlgG [Shewanella halifaxensis
           HAW-EB4]
          Length = 261

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 100/258 (38%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G   Q  ++  
Sbjct: 4   ALWVSKTGLTAQDTKMTTIANNLANVNTTGFKRDRVAFNDLFYQVQRQPG--GQVDEQNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++   + V+T G+++ T   LD+A+ G+G+FQ+E  +  + Y+R G F 
Sbjct: 62  LPSGLQLGTGTRVVGTQKVFTPGDMLTTNQQLDMAIEGQGFFQIEEANGELSYSRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +S+G +VT+ G  LVP I IPEE   + ++  G + A     +D Q +GQ+ + NF N 
Sbjct: 122 RNSEGLMVTSQGLPLVPNIEIPEEALTVTIASDGIVSAQMAGQTDAQELGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G+NL   T  SG  +     D     ++QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEARGNNLYRETGASGAAVEGIAGDQALGQIRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|56460250|ref|YP_155531.1| flagellar basal body rod protein FlgG [Idiomarina loihiensis L2TR]
 gi|56179260|gb|AAV81982.1| Flagella basal body rod protein [Idiomarina loihiensis L2TR]
          Length = 262

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 161/259 (62%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQ ++ +I+NN+AN +T G+K++RA F D LYQ     G   QSA    
Sbjct: 4   ALWISKTGLDAQQRDISVISNNLANSSTIGFKKSRAVFEDLLYQNINQPG--GQSAQDTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  +TQG V  T N+LD+ + G+G+FQV  PD  + YTR G F+
Sbjct: 62  LPNGLMLGAGTKVVATQKSHTQGNVQTTDNSLDVMIDGKGFFQVLMPDGNISYTRNGQFS 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G++  + +G T+ P I IPE+   + +S+ G++      N D   VGQ+ + NFIN
Sbjct: 122 LNEEGEIVTSGNGYTIEPAIQIPEDAMSVSISQEGEVTVTQPGNPDNVVVGQINLVNFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ +G NL   T+VSG P+ + P   G  +  QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PAGLQPMGQNLYKETAVSGAPLEAVPGVDGMGNTIQGALETSNVNVTEELVNLIESQRGY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M S I +
Sbjct: 242 EMNSKVISSVDQMLSYINQ 260


>gi|91976161|ref|YP_568820.1| flagellar basal body rod protein FlgG [Rhodopseudomonas palustris
           BisB5]
 gi|91682617|gb|ABE38919.1| Flagellar basal-body rod FlgG [Rhodopseudomonas palustris BisB5]
          Length = 262

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 107/261 (40%), Positives = 161/261 (61%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYK+  A F D +Y   +  G+ + S   
Sbjct: 1   MRALYTAATGMAAQELNVQVISNNIANMRTTGYKKQTAAFQDLIYDHVRRVGAQA-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ IG GV+      +  QG +  TGN+LD+A+ G G+F+++ PD T  Y+R GS
Sbjct: 60  TILPVGVDIGGGVKTVGTPRMMGQGTISPTGNDLDIAIRGEGFFKIQMPDGTFTYSRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G++VT++GN + P I IP     I ++  GQ+      ++    +GQ+ +  FI
Sbjct: 120 FTTDNTGRIVTSNGNPVQPTITIPSGASGITINAQGQVTVNVPGSTTPVLLGQIGLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL  IGDNL   T  SG P     +  GF  ++Q  LE +NV+ V EIS++I+AQRA
Sbjct: 180 NKTGLLPIGDNLFTETPASGPPQDGTANTDGFGDMQQKALEQANVEVVNEISDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KV+ AAD+M    + M
Sbjct: 240 YEMNAKVVSAADQMLQSTSNM 260


>gi|148554187|ref|YP_001261769.1| flagellar basal body rod protein FlgG [Sphingomonas wittichii RW1]
 gi|148499377|gb|ABQ67631.1| flagellar basal-body rod protein FlgG [Sphingomonas wittichii RW1]
          Length = 262

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 151/258 (58%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ   +++IANN+AN+NTTG+KR RA F    YQA    G  + S+D   
Sbjct: 5   ALHVARTGLDAQNMRMQVIANNLANVNTTGFKRDRASFETLAYQAMTAPG--AASSDSTK 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
              G ++G+GVQI+    + TQG +  TGN LD+A+ G G+FQV  PD    YTR G+FN
Sbjct: 63  FATGTNLGTGVQINGTAKIQTQGALQETGNPLDMAIQGDGYFQVLLPDGRTGYTRDGNFN 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
               G +VTADG  L P I IPE T  + ++  G + A     +    +G++ +A F N 
Sbjct: 123 RSDDGTIVTADGYHLQPQIQIPENTTNLTIAADGTVSATQAGETTSTELGKIELARFSNP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL+  G+N+L  T  SG P        G   ++Q  LE+SNV+ V+E+ +MI  QRAYE
Sbjct: 183 AGLQAEGNNILTETPASGQPQTGPGGIDGRGTIQQSSLESSNVNIVEELVDMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK+I + D+M   + +
Sbjct: 243 VNSKMISSTDQMLQYVNQ 260


>gi|152997580|ref|YP_001342415.1| flagellar basal-body rod protein FlgG [Marinomonas sp. MWYL1]
 gi|150838504|gb|ABR72480.1| flagellar basal-body rod protein FlgG [Marinomonas sp. MWYL1]
          Length = 261

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 156/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SA    L ++ANN+AN++TT +K+ RA F D +Y+  +  G    SA  A 
Sbjct: 4   ALWVSKTGLSAMDKQLNVVANNLANVSTTAFKKDRAVFEDLMYKTVRAPG--GLSAQNAE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++ + +  ++ G+   T   LD+A+ G+G+ QV  PD T+ YTR GS  
Sbjct: 62  LPSGLQLGTGVKVGATQKDFSNGDYNMTDRQLDIAIQGKGFLQVLQPDGTIAYTRNGSLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+GQL T+ G  L PGI I  +  EI ++  G +      ++D Q VG + IA FIN 
Sbjct: 122 LNSQGQLATSGGLVLEPGIQIDPDVIEIMIAEDGIVSVRKNGDADAQQVGAINIAGFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL + G NL   T+ SG P++  P       + QG LEASNV++++E+  MI+ QRAYE
Sbjct: 182 TGLSSAGQNLFTETNASGPPLVGVPGTDSLGTIAQGMLEASNVNSIEELVNMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKVI +AD M S   +
Sbjct: 242 MNSKVIASADGMMSFAIQ 259


>gi|146341904|ref|YP_001206952.1| flagellar basal body rod protein FlgG [Bradyrhizobium sp. ORS278]
 gi|146194710|emb|CAL78735.1| Flagellar basal-body rod protein flgG (Distal rod protein)
           [Bradyrhizobium sp. ORS278]
          Length = 262

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 113/261 (43%), Positives = 163/261 (62%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTG+K+  A F D +Y+  +  G+ S S   
Sbjct: 1   MQALHTAATGMAAQELNVQVISNNIANLRTTGFKKQTAAFQDLIYEHVRRVGAQS-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P GI IG GV+        TQG +  TGN+LDLA+ G G+F++  PD T  YTR G+
Sbjct: 60  TILPVGIDIGGGVKTVGTPRSMTQGTLSQTGNDLDLAISGEGFFKILMPDGTYQYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VTA GN + P I IP+    I V+  GQ+      ++    +GQL +  FI
Sbjct: 120 FQMDNQGRIVTAQGNPVQPTISIPQNASGITVNSQGQVSVTLPGSTTSNIIGQLQVTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+ +G+N    T  SG P     +  G   + QG LE +NVD V E+SE+I+AQRA
Sbjct: 180 NKAGLQPVGNNQFTDTPSSGAPQDGIANQDGLGSITQGSLEQANVDVVSEMSELIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KVI AAD+M    T +
Sbjct: 240 YEMNAKVISAADQMMQSTTAL 260


>gi|94495409|ref|ZP_01301989.1| flagellar basal-body rod protein [Sphingomonas sp. SKA58]
 gi|94424797|gb|EAT09818.1| flagellar basal-body rod protein [Sphingomonas sp. SKA58]
          Length = 262

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 163/258 (63%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ T + +IANN+AN+NTTG+K+ RA+F    YQ    AG+ S + +K  
Sbjct: 5   ALHVARTGLDAQNTKMRVIANNLANVNTTGFKKDRADFETLAYQQIVQAGANSDAENKFA 64

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
              G+++GSGV +     + +QG +  T N LD+A+ G G+FQV+ PD ++ Y+RAG+F+
Sbjct: 65  T--GLNLGSGVALQGTSKINSQGTLTQTSNALDMAIEGSGYFQVQQPDGSIAYSRAGNFS 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           + ++G +VT DG  L+P I +P+    + +   G + A     S+   +GQ+ +A+F+N 
Sbjct: 123 VTAEGTIVTGDGLPLIPQITVPQGATSVSIGNDGTVSATLQGESEPSQLGQIELASFMNP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL++IG NLL  T+ SG P +      G   ++ GYLE SNV+ V+E+ +MI  QRAYE
Sbjct: 183 SGLQSIGGNLLVETAASGTPQVGVAGLEGRGVIRSGYLETSNVNIVEELVDMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK+I+A DEM   + +
Sbjct: 243 VNSKMIKATDEMLQYVNQ 260


>gi|149911700|ref|ZP_01900308.1| Flagellar basal body rod protein FlgG [Moritella sp. PE36]
 gi|149805230|gb|EDM65247.1| Flagellar basal body rod protein FlgG [Moritella sp. PE36]
          Length = 262

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 157/259 (60%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQ N+  I+NN+AN +T G+K+ RA F D LYQA    G   QS+    
Sbjct: 4   ALWISKTGLEAQQANISTISNNLANASTVGFKKERAIFEDLLYQAINQPG--GQSSQNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSG ++ + +  ++QG ++ T N+LDL + GRG+F++E PD T  YTR G F 
Sbjct: 62  LPSGLMVGSGARVVATQKDHSQGNMLTTDNSLDLMVSGRGFFEIEMPDGTTSYTRNGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G +     G  L P I IP + + I VS  G++       ++ Q VGQ+ I++F+N
Sbjct: 122 LNDEGIIVTPGSGYPLQPQIQIPADAQTITVSEDGEVSVSLPGQTNNQTVGQINISDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ IG N+  +T  SGDP+   P + G   + QG +E SNV+  +E+  +I +QR Y
Sbjct: 182 PGGLQPIGQNMYIQTGASGDPVQGLPSNEGLGKLVQGAIETSNVNVTEELVNLIESQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A DEM S I +
Sbjct: 242 EMNSKVISAVDEMLSYINQ 260


>gi|153837069|ref|ZP_01989736.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ3810]
 gi|149749657|gb|EDM60402.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ3810]
          Length = 261

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T + +I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTVISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T  +LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNTQNTTQDLDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I+S+G +V + G  L P I IP+      V   G +   T  +   Q +GQ+ +A FIN 
Sbjct: 122 INSEGLMVNSQGLPLEPQIQIPDNATSFSVGVDGTVTTTTADDPTPQQLGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG          G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETEASGPADELIAGADGAGSIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   +++
Sbjct: 242 MNAKVVSAADDMLKFVSQ 259


>gi|162147478|ref|YP_001601939.1| flagellar basal body rod protein FlgG [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545587|ref|YP_002277816.1| flagellar basal body rod protein FlgG [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786055|emb|CAP55637.1| putative flagellar basal-body rod protein flgG [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533264|gb|ACI53201.1| flagellar basal-body rod protein FlgG [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 262

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 116/262 (44%), Positives = 162/262 (61%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M +  IAA GM AQ TN++ I+NNIAN+ TTGYKR RAEF D +YQ  +  G+ S S   
Sbjct: 2   MPSLDIAATGMQAQTTNVDTISNNIANMTTTGYKRRRAEFQDLIYQDVRRVGTMS-SDTG 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G  IG GV+ + +  +  QG +  T N LD+A+ G G+FQV  P     YTR G+
Sbjct: 61  DLVPAGAQIGLGVRTAGIYRINEQGTLEQTSNALDMAIQGPGYFQVTLPSGEYAYTRDGT 120

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++   G +VTADG  L P I +P     I V +SGQ+       +  Q  GQ+ +  F 
Sbjct: 121 FSLSEDGTIVTADGYPLSPNITLPNNAENITVDQSGQVQYTISGQTQAQVAGQIQLGIFQ 180

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE GL  +G NL  +T+ SGD I+  P   G+  ++QG++E S+V+ V EI+++I+AQRA
Sbjct: 181 NENGLAAMGQNLFTQTTSSGDAILGTPQAQGYGLIQQGFIEESSVNVVTEITDLITAQRA 240

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI A+DEM   +T ++
Sbjct: 241 YEMNSKVITASDEMLQTLTNLK 262


>gi|289679021|ref|ZP_06499911.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           syringae FF5]
 gi|330972416|gb|EGH72482.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 262

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 111/259 (42%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G++AQ TNL  I+NN+AN++TTG+K  RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALYVAKTGLAAQDTNLTTISNNLANVSTTGFKSDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T N LDLA+ GRG+FQV  PD T+ Y+R G+F+
Sbjct: 62  LPSGLQLGTGVRIVGTQKNFTAGSLQTTNNPLDLAVNGRGFFQVTQPDGTIAYSRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANFIN 181
           +D+ GQ+VTA+G  L P IV+P+  +   V + G +       +    +   +  A+FIN
Sbjct: 122 LDANGQIVTANGYALEPAIVVPQNAQTFTVGQDGTVSVTLAGATATPQIIGNIQTADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ +G NL   T  SG P I  P   G     Q  LE SNV  V+E+  MI+ QRAY
Sbjct: 182 PAGLQAMGGNLYLETGSSGAPQIGTPGLNGLGPTLQNTLENSNVSTVEELVNMITTQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   +T+
Sbjct: 242 EMNSKVISTADQMLQNLTQ 260


>gi|212637787|ref|YP_002314312.1| flagellar basal body rod protein [Shewanella piezotolerans WP3]
 gi|212559271|gb|ACJ31725.1| Flagellar basal body rod protein [Shewanella piezotolerans WP3]
          Length = 261

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ T +  IANN+AN+NTTG+KR R  F D  YQ ++  G   Q  ++  
Sbjct: 4   ALWVSKTGLTAQDTKMTTIANNLANVNTTGFKRDRVAFNDLFYQVQRQPG--GQVDEQNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++   + V+T G+++ T   LDLA+ G+G+FQ+E  +  + ++R G F 
Sbjct: 62  LPSGLQLGTGTRVVGTQKVFTSGDMLTTNQQLDLAIEGQGFFQIEESNGDLSFSRDGQFY 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
            +S+G +VT+ G  LVP I IPEE   I ++  G + A     +D Q +GQ+ + NF N 
Sbjct: 122 RNSEGLMVTSQGLPLVPNIEIPEEALTITIATDGIVSAQMAGQADAQELGQITLVNFTNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G+NL   T  SG  I     D     ++QG LE +NV+ V+E+ EMIS QRAYE
Sbjct: 182 AGLEARGNNLYRETGASGAAIEGVAGDQALGQIRQGALEGANVNVVEEMVEMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ A+D+M   + +
Sbjct: 242 MNAKVVSASDDMLKFLNQ 259


>gi|239907792|ref|YP_002954533.1| flagellar basal-body rod protein FlgG [Desulfovibrio magneticus
           RS-1]
 gi|239797658|dbj|BAH76647.1| flagellar basal-body rod protein FlgG [Desulfovibrio magneticus
           RS-1]
          Length = 260

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 96/262 (36%), Positives = 156/262 (59%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   A+ GM A Q  ++ ++NN+AN+NT G+K++RAEF D +YQ  +VAG+ +   ++
Sbjct: 2   MRSLWTASTGMVAMQMQIDTMSNNLANVNTVGFKKSRAEFEDLMYQTLQVAGTETVGGNR 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GV+ ++V   +TQG++ +TGN LD+A+ G G+F+V   +   +YTRAGS
Sbjct: 62  --LPTGLQVGLGVKPTTVHKFFTQGDMQNTGNQLDIAIQGEGFFKV-DVNGRELYTRAGS 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F ++  G +VTA+G  L P   +P ET+ I ++ +G +  +   +++      + +  FI
Sbjct: 119 FKLNQDGTIVTANGYPLQPAFSVPTETKTITITENGHLSCLDANSAELAAT-DIPLYTFI 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL   G NL + +  SG      P +     + QG+LE SNV+ V E+  +I  QRA
Sbjct: 178 NNAGLTAEGRNLYSTSQASGAANEVTPGNQNAGTLAQGFLEMSNVELVDEMVGLIVGQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE NSK I  AD M      ++
Sbjct: 238 YEANSKSITTADGMLQTAVNIK 259


>gi|153834448|ref|ZP_01987115.1| flagellar basal-body rod protein FlgG [Vibrio harveyi HY01]
 gi|156973589|ref|YP_001444496.1| flagellar basal body rod protein FlgG [Vibrio harveyi ATCC
           BAA-1116]
 gi|269961601|ref|ZP_06175963.1| flagellar basal-body rod protein FlgG [Vibrio harveyi 1DA3]
 gi|148869144|gb|EDL68176.1| flagellar basal-body rod protein FlgG [Vibrio harveyi HY01]
 gi|156525183|gb|ABU70269.1| hypothetical protein VIBHAR_01292 [Vibrio harveyi ATCC BAA-1116]
 gi|269833642|gb|EEZ87739.1| flagellar basal-body rod protein FlgG [Vibrio harveyi 1DA3]
          Length = 262

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 147/259 (56%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T GYK++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNIATISNNLANASTVGYKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G    T N LD+ + G G+FQV  PD  + YTR G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTHGNAQTTTNALDMMVEGDGFFQVTLPDGNIGYTRNGQFT 121

Query: 123 IDSKGQ-LVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D +G  + +  G  + P IVIPE+   I V   G++        +   VGQL I +F+N
Sbjct: 122 LDGEGTLVTSGSGYPVEPEIVIPEDAISITVGTDGEVSVRIRGEQNNVVVGQLTITDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   G   ++Q  LEASNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M S + +
Sbjct: 242 EMNSKVISSVDKMMSFVNQ 260


>gi|90423017|ref|YP_531387.1| flagellar basal body rod protein FlgG [Rhodopseudomonas palustris
           BisB18]
 gi|90105031|gb|ABD87068.1| Flagellar basal-body rod FlgG [Rhodopseudomonas palustris BisB18]
          Length = 262

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 164/261 (62%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTG+K+ RA F D +Y   +  G+ + S   
Sbjct: 1   MRALYTAATGMAAQELNVQVISNNIANMRTTGFKKQRAAFQDLIYDHVRRVGAQA-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ IG GV+      + TQG +  TGN+LDLA+ G G+F+++ PD T  YTR GS
Sbjct: 60  TILPVGVDIGGGVKTVGTPRLMTQGTLSTTGNDLDLAVRGEGFFKIQMPDGTYSYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G++VT++GN L P I IP     I ++ +GQ+      ++    +GQ+ +  FI
Sbjct: 120 FTTDNTGRVVTSNGNPLQPTITIPTGASGITIASNGQVSVTVTGSTTPTVLGQISLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL+  GDNL   T  SG P     +  G+  ++Q  LE +NV+ V EIS++I+AQRA
Sbjct: 180 NKTGLQPQGDNLFIETGASGPPQDGIANADGYGDIQQQTLEQANVEVVTEISDLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KV+ AAD+M    + M
Sbjct: 240 YEMNAKVVSAADQMLQSTSNM 260


>gi|170747256|ref|YP_001753516.1| flagellar basal-body rod protein FlgG [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653778|gb|ACB22833.1| flagellar basal-body rod protein FlgG [Methylobacterium
           radiotolerans JCM 2831]
          Length = 263

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 118/261 (45%), Positives = 170/261 (65%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYKR +  F D LYQ  + AG+ S S   
Sbjct: 1   MRALYSAATGMAAQELNVQVISNNIANLRTTGYKRQQVHFQDLLYQNMRRAGA-STSQQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+S+GSGV+ +S   V +QG +  T  + D+A+ G G+F+V  PD    Y+R GS
Sbjct: 60  TQLPAGLSLGSGVKTTSTARVMSQGTLSSTEKDYDVAIRGDGFFRVTLPDGRTAYSRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++ ++GQLVT DG  L P I +P+    + +S +G + A     +  Q +GQ  ++ F+
Sbjct: 120 FDLSAQGQLVTRDGYLLDPAITVPQNATSVTISATGAVQANIPGQTAPQALGQFQLSRFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IGDNL   T+ SG  I   P   GF +++Q YLE +NV+AV EIS +I+AQRA
Sbjct: 180 NKVGLESIGDNLFVETAASGQAISGLPGADGFGNLQQSYLEEANVNAVTEISSLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSKV+ AAD+M S  T+M
Sbjct: 240 YEMNSKVVTAADQMLSTTTQM 260


>gi|326202442|ref|ZP_08192311.1| fagellar hook-basal body protein [Clostridium papyrosolvens DSM
           2782]
 gi|325987560|gb|EGD48387.1| fagellar hook-basal body protein [Clostridium papyrosolvens DSM
           2782]
          Length = 270

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 91/272 (33%), Positives = 139/272 (51%), Gaps = 14/272 (5%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A +GM AQQ N+++I+NN+AN+NTTGYK+ RAEF D LYQ    A       + 
Sbjct: 2   MRALYTAGSGMKAQQFNVDVISNNLANVNTTGYKKERAEFKDLLYQTMDRA----YVLNG 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G G  +SS    +  G    TG+ LD A+ G G+F +  P  TV YTR GS
Sbjct: 58  GGKPVNLQVGHGTVVSSTIRNFENGTPEQTGSTLDFAIDGEGFFTIMGPQGTVKYTRDGS 117

Query: 121 FN--IDSKGQLVTADGNTLVPGIVIPEETREIK--------VSRSGQILAVTGKNSDFQP 170
           F   I   G       +          E             VS  G++     +      
Sbjct: 118 FKLSITEDGMKKLTTSDGYAVLDNSGGEILFDPEVKTSELSVSPRGEMSYKNAEGVSVPM 177

Query: 171 VGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKE 230
              + +  F N+  L  +G+NL +  S +G+P+  + D+   + +KQG+LE+SNV  V E
Sbjct: 178 DQTIGMVTFPNKYALEAVGNNLYSSNSATGEPLQVSEDENAKSIMKQGFLESSNVQVVDE 237

Query: 231 ISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           + ++I AQRAYE++SK I+++D+M  +   +R
Sbjct: 238 MVKLIVAQRAYEVSSKAIQSSDDMLQIANNLR 269


>gi|39936961|ref|NP_949237.1| flagellar basal body rod protein FlgG [Rhodopseudomonas palustris
           CGA009]
 gi|192292789|ref|YP_001993394.1| flagellar basal body rod protein FlgG [Rhodopseudomonas palustris
           TIE-1]
 gi|39650818|emb|CAE29341.1| putative flagellar basal-body rod protein flgg (distal rod protein)
           [Rhodopseudomonas palustris CGA009]
 gi|192286538|gb|ACF02919.1| flagellar basal-body rod protein FlgG [Rhodopseudomonas palustris
           TIE-1]
          Length = 262

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 162/261 (62%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTG+K+  A+F D +Y   +  G+ + S   
Sbjct: 1   MRALYTAATGMAAQELNVQVISNNIANMRTTGFKKQTAQFQDLIYDHVRRVGAQA-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ IG GV+      + TQG +  TGN+LDLA+ G G+F+++ PD T  YTR GS
Sbjct: 60  TILPVGVDIGGGVKTVGTPRLMTQGTLSPTGNDLDLAVRGEGFFKIQMPDGTFAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G++VTA+GN + P I +P     I V+ +GQ+      ++    +GQ+ +  FI
Sbjct: 120 FTKDNTGRMVTANGNPVQPTITVPNGATSITVAANGQVSVTISGSTTPTVIGQIGLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+  GDNL   T  SG P        G   + Q  LE +NV+ V EIS++ISAQRA
Sbjct: 180 NKAGLQPQGDNLFIETPASGTPQDGIASADGLGDIMQKTLEMANVEVVTEISDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KV+ +AD+M    + M
Sbjct: 240 YEMNAKVVSSADQMLQSTSNM 260


>gi|312884832|ref|ZP_07744524.1| flagellar basal body rod protein FlgG [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367484|gb|EFP95044.1| flagellar basal body rod protein FlgG [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 261

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 103/258 (39%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q  +   
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYTIQRQPG--AQVDEVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T  +LDLA++G+G+FQ+E  D  +MYTR G F 
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNTQNTNQDLDLAVMGKGFFQIENSDGQIMYTRNGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I IP++   I V   G +   +  +   Q VGQ+ +A FIN 
Sbjct: 122 VNSEGLMVNSQGLPLEPQIQIPDDALSISVGVDGTVTTTSAIDPTPQQVGQITLARFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL  +T  SG        + G   +KQ  LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRQTEASGLAEELIASEDGVGSIKQRALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   + +
Sbjct: 242 MNAKVVSAADDMLKFVAQ 259


>gi|316932823|ref|YP_004107805.1| flagellar basal-body rod protein FlgG [Rhodopseudomonas palustris
           DX-1]
 gi|315600537|gb|ADU43072.1| flagellar basal-body rod protein FlgG [Rhodopseudomonas palustris
           DX-1]
          Length = 262

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 110/261 (42%), Positives = 160/261 (61%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTG+K+  A+F D +Y   +  G+ + S   
Sbjct: 1   MRALYTAATGMAAQELNVQVISNNIANMRTTGFKKQTAQFQDLIYDHVRRVGAQA-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+ IG GV+      + TQG +  TGN+LD+A+ G G+F+++ PD T  YTR GS
Sbjct: 60  TILPVGVDIGGGVKTVGTPRLMTQGTLSPTGNDLDMAVRGEGFFKIQMPDGTFAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  D+ G++VTA GN + P I IP     I V+ +GQ+      ++    +GQ+ +  FI
Sbjct: 120 FTTDNTGRIVTAGGNPVQPTITIPNGATSITVATNGQVSVTISGSTTPTVLGQIGLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+  GDNL   T  SG P        G   + Q  LE +NV+ V EIS++ISAQRA
Sbjct: 180 NKAGLQPQGDNLFVETPASGTPQDGIATADGLGDIMQKTLEQANVEVVTEISDLISAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KV+ AAD+M      M
Sbjct: 240 YEMNAKVVSAADQMLQSTANM 260


>gi|148256792|ref|YP_001241377.1| flagellar basal body rod protein FlgG [Bradyrhizobium sp. BTAi1]
 gi|146408965|gb|ABQ37471.1| Flagellar basal-body rod protein flgG (Distal rod protein)
           [Bradyrhizobium sp. BTAi1]
          Length = 262

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 114/261 (43%), Positives = 162/261 (62%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTG+K+  A F D +Y   +  G+ S S   
Sbjct: 1   MQALHTAATGMAAQELNVQVISNNIANLRTTGFKKQTAAFQDLIYDHVRRVGAQS-SDQG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P GI IG GV+        TQG +  TGN+LDLA+ G G+F++  PD T  YTR G+
Sbjct: 60  TILPVGIDIGGGVKTVGTPRSMTQGTLSQTGNSLDLAISGEGFFKILMPDGTFQYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D++G++VTA GN + P I IP+    I V+  GQ+      ++    VGQL +  FI
Sbjct: 120 FQMDNQGRIVTAQGNPVQPTISIPQNASGITVNAQGQVSVTLPGSTTSNIVGQLQLTRFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL+ +G+N    T  SG P     +  G   + QG LE +NVD V E+SE+I+AQRA
Sbjct: 180 NKAGLQPVGNNQFTDTPSSGAPQDGVANQDGLGSITQGSLEQANVDVVSEMSELIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMN+KVI AAD+M    T +
Sbjct: 240 YEMNAKVISAADQMMQSTTAL 260


>gi|254461663|ref|ZP_05075079.1| flagellar basal-body rod protein FlgG [Rhodobacterales bacterium
           HTCC2083]
 gi|206678252|gb|EDZ42739.1| flagellar basal-body rod protein FlgG [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 168/259 (64%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            A  +A  G++AQQT +++IANN++N+NT G+K  R  F   LYQ ++  G   Q+++  
Sbjct: 4   NAMHVAKTGLNAQQTRMQVIANNLSNLNTVGFKSDRVNFESLLYQVKRGGGD--QTSEGT 61

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +   +++G+GV+  + + +Y+QG +V+T N+ DLA+ G+G+FQV  PD  V YTR GSF
Sbjct: 62  ELTSALALGTGVRAVNTQKLYSQGGMVNTDNSFDLAIDGQGFFQVLIPDGRVGYTRNGSF 121

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +  ++G L TA G  + P I IP++  E+ VS+ G +   +    + Q VGQL +A+F N
Sbjct: 122 SRSAEGALTTASGYVVQPEIRIPDDVVEVNVSQDGIVSVRSAAQKEPQEVGQLTLASFAN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ +G++ L +T+ SGDP +++P   G   + QG LE+SNV+ V+++ EMI  QRAY
Sbjct: 182 PRGLQPVGESFLVQTAASGDPTVASPQAQGIGKLVQGSLESSNVNVVQQLVEMIETQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           E++SK I A+DEM   I+ 
Sbjct: 242 EVSSKSITASDEMMRYISN 260


>gi|326386932|ref|ZP_08208546.1| flagellar basal body rod protein FlgG [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208612|gb|EGD59415.1| flagellar basal body rod protein FlgG [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 111/258 (43%), Positives = 156/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ T + +IANN+AN++TTG+KR RA FA   YQ  +VAG  +QS+++  
Sbjct: 5   ALYVARTGLEAQDTRMRVIANNLANVSTTGFKRDRANFASLAYQDARVAG--AQSSNETT 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
              G+++G+GV I S     T+G +  TGN LDLAL G G+FQ+  P   + YTRAG+F 
Sbjct: 63  YATGLNLGTGVGIQSTTPDMTEGSLQSTGNALDLALDGDGYFQISMPGGQLSYTRAGNFT 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
              +G LVT+ G  L P I IPE    I V++ G + A    +S    +GQ+ IA+F N 
Sbjct: 123 RSPEGLLVTSQGYALQPQITIPEGATGITVAQDGTVSATLPGSSQATSIGQITIASFTNP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           A L+ IGDN    T+ SG   +      G  +V+QG+LEASNV  V E+ +MI  QRAYE
Sbjct: 183 AALKAIGDNFYTETTGSGPVQLGIAGQNGRGNVRQGFLEASNVSVVSELVDMIECQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK++ A D+M     +
Sbjct: 243 INSKMVSAVDDMLKNANQ 260


>gi|260768780|ref|ZP_05877714.1| flagellar basal-body rod protein FlgG [Vibrio furnissii CIP 102972]
 gi|260616810|gb|EEX41995.1| flagellar basal-body rod protein FlgG [Vibrio furnissii CIP 102972]
 gi|315180483|gb|ADT87397.1| hypothetical flagellar basal-body rod protein [Vibrio furnissii
           NCTC 11218]
          Length = 261

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 102/259 (39%), Positives = 156/259 (60%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            A MI+  GM+AQ   +  I+NN+AN+NT G+KR R  F D  Y  EK AG  + + D  
Sbjct: 3   NALMISKTGMAAQDAKMTAISNNLANVNTVGFKRDRVVFEDLFYSVEKQAG--TGTNDLN 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
           + P G+ +G+GV+++    V+TQG + +T    DLA+VG G+FQ+E P+  V+YTR G F
Sbjct: 61  IHPTGVQLGNGVRVAGTEKVFTQGNINNTSQQFDLAIVGDGFFQIEGPEGEVLYTRNGQF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++++ G +V   G  L P I +P+    + ++  GQ+ AV     + + +G++ +  F+N
Sbjct: 121 HLNADGAIVNTQGYLLQPEINVPDNATLVTITEDGQVSAVVSGQVEPEQLGEITLVKFMN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL   G NLLA T  SG+ +       G   +KQG LE SNV  V+E+ +MIS QRAY
Sbjct: 181 PSGLTAKGANLLAETEASGEAMELVAGTDGAGVIKQGALETSNVQVVEEMVDMISTQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           EM++K++ AAD+M   I  
Sbjct: 241 EMSAKMVSAADQMLQYIAN 259


>gi|315127351|ref|YP_004069354.1| flagellar basal body rod protein FlgG [Pseudoalteromonas sp.
           SM9913]
 gi|315015865|gb|ADT69203.1| flagellar basal body rod protein FlgG [Pseudoalteromonas sp.
           SM9913]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNLANASTVGYKKSRAIFEDLLYQNINQPG--GRSSQDTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  ++QG ++ T N+LD  + G G+F+V  PD  + Y+R G F 
Sbjct: 62  MPSGLMLGAGTKVVANQKNFSQGNMLTTENSLDWMISGPGFFEVLQPDGNIAYSRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            D +G++VT+    +  P + +P++ + I VS+ G++       ++   +GQ+ I++FIN
Sbjct: 122 TDGEGRVVTSGAGYVVQPEMNVPDDAQSITVSQDGEVSVRIKGQAENVVIGQITISDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  IG NL   T+VSG P+  NP   G   + QG LE SNV+  +E+  +I  QR Y
Sbjct: 182 PSGLEPIGQNLYTETAVSGAPVQGNPGVEGLGTIIQGSLETSNVNVTEELVNLIETQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A DEM S I +
Sbjct: 242 EMNSKVISAVDEMMSYINQ 260


>gi|330875986|gb|EGH10135.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330967093|gb|EGH67353.1| flagellar basal body rod protein FlgG [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 113/259 (43%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G++AQ TNL  I+NN+AN++TTG+K  RAEF D LYQ ++  G  +QS   + 
Sbjct: 4   ALYVAKTGLAAQDTNLTTISNNLANVSTTGFKSDRAEFQDLLYQIKRQPG--AQSTQDSE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV+I   +  +T G +  T N LDLA+ GRG+FQV  PD T+ Y+R G+F+
Sbjct: 62  LPSGLQLGTGVRIVGTQKNFTAGSLQTTNNPLDLAVNGRGFFQVTQPDGTIAYSRDGTFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANFIN 181
           ++S GQ+VTA G  L P IV+P+  +   V + G +       +    V   +  A+FIN
Sbjct: 122 LNSTGQIVTATGYALEPAIVVPQNAQTFTVGQDGTVSVTLAGATATSQVIGNIQTADFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL+ IG NL   T+ SG P I  P   G     Q  LE SNV  V+E+  MI+ QRAY
Sbjct: 182 PAGLQAIGGNLYLETASSGAPQIGTPGLNGLGPTLQNTLENSNVSTVEELVNMITTQRAY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI  AD+M   +T+
Sbjct: 242 EMNSKVISTADQMLQNLTQ 260


>gi|88858141|ref|ZP_01132783.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Pseudoalteromonas tunicata D2]
 gi|88819758|gb|EAR29571.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Pseudoalteromonas tunicata D2]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 96/259 (37%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNLANASTVGYKKSRAVFEDLLYQNINQPG--GRSSQDTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + +  ++QG ++ T N++D  + G+G+F+V  PD ++ Y+RAG F 
Sbjct: 62  MPSGLMLGAGTKVVATQKNFSQGNMITTDNSMDWMIQGQGFFEVLLPDGSLAYSRAGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            D  G++  +  G  + P + +P + + + +S+ G++       +D   +GQL I++FIN
Sbjct: 122 TDGDGRVVTSGAGFPVQPEMNVPNDAQSLTISQDGEVSVRVRGQADNVVIGQLTISDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T+VSG PI  NP   G   + QG LE SNV+  +E+  +I  QR Y
Sbjct: 182 PSGLEPMGQNLFTETAVSGAPIQGNPGADGLGVIVQGALETSNVNTTEELVNLIETQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M + I +
Sbjct: 242 EMNSKVISSVDQMLNFINQ 260


>gi|312115249|ref|YP_004012845.1| flagellar basal-body rod protein FlgG [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220378|gb|ADP71746.1| flagellar basal-body rod protein FlgG [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 261

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 136/260 (52%), Positives = 181/260 (69%), Gaps = 2/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  +AA GM AQQTN+E+IANNIAN NT  +KR+RAEFAD LYQ+E+ AG P++S D 
Sbjct: 1   MRALSVAATGMVAQQTNVEVIANNIANANTVAFKRSRAEFADLLYQSERAAGVPNRS-DA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +PE   IG GVQ  ++R+++TQG +  TGN+LDLAL GRGWFQ+   +   +YTRAG+
Sbjct: 60  DAIPEASQIGLGVQPVAIRSLHTQGSLTKTGNSLDLALNGRGWFQITGANNETLYTRAGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F+ ++ GQLVT DG T++P I IP  T  I+V+  G +            VGQL IA F+
Sbjct: 120 FSKNASGQLVTPDGYTVIPSITIPTNTTSIQVNTDGTVYV-DPGTGVMAQVGQLTIATFV 178

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL  +G+NL   T  SG   +  P   G+A V+Q Y+E+SNVD V+EI+ +ISAQR 
Sbjct: 179 NDAGLEALGNNLFRETISSGSAQVQVPGSEGYATVQQYYVESSNVDPVQEITNLISAQRN 238

Query: 241 YEMNSKVIEAADEMSSLITK 260
           YEMNSKVI+AADEM  ++TK
Sbjct: 239 YEMNSKVIQAADEMFQVLTK 258


>gi|28897555|ref|NP_797160.1| flagellar basal body rod protein FlgG [Vibrio parahaemolyticus RIMD
           2210633]
 gi|91225875|ref|ZP_01260844.1| polar flagellar FlgG [Vibrio alginolyticus 12G01]
 gi|153839683|ref|ZP_01992350.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ3810]
 gi|254230138|ref|ZP_04923533.1| flagellar basal-body rod protein FlgG [Vibrio sp. Ex25]
 gi|260364613|ref|ZP_05777215.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           K5030]
 gi|260878282|ref|ZP_05890637.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AN-5034]
 gi|260898112|ref|ZP_05906608.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           Peru-466]
 gi|260901956|ref|ZP_05910351.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ4037]
 gi|262394937|ref|YP_003286791.1| flagellar basal-body rod protein FlgG [Vibrio sp. Ex25]
 gi|269965422|ref|ZP_06179541.1| flagellar basal-body rod protein FlgG [Vibrio alginolyticus 40B]
 gi|5361010|gb|AAD42917.1|U12817_11 polar flagellar FlgG homolog [Vibrio parahaemolyticus]
 gi|28805767|dbj|BAC59044.1| polar flagellar FlgG [Vibrio parahaemolyticus RIMD 2210633]
 gi|91189525|gb|EAS75801.1| polar flagellar FlgG [Vibrio alginolyticus 12G01]
 gi|149746793|gb|EDM57781.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ3810]
 gi|151937331|gb|EDN56194.1| flagellar basal-body rod protein FlgG [Vibrio sp. Ex25]
 gi|262338531|gb|ACY52326.1| flagellar basal-body rod protein FlgG [Vibrio sp. Ex25]
 gi|269829901|gb|EEZ84131.1| flagellar basal-body rod protein FlgG [Vibrio alginolyticus 40B]
 gi|308086113|gb|EFO35808.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           Peru-466]
 gi|308090170|gb|EFO39865.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AN-5034]
 gi|308106768|gb|EFO44308.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ4037]
 gi|308115105|gb|EFO52645.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           K5030]
 gi|328473451|gb|EGF44299.1| flagellar basal body rod protein FlgG [Vibrio parahaemolyticus
           10329]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 148/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T GYK++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNIATISNNLANASTVGYKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G    T N LD+ + G G+FQV  PD  + YTR G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTHGNAQTTTNALDMMVEGDGFFQVTLPDGNIGYTRNGQFT 121

Query: 123 IDSKGQ-LVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G  + +  G  + P IVIPE+   I V   G++        D Q VGQL I +F+N
Sbjct: 122 LNGEGTLVTSGSGYPVEPEIVIPEDAISITVGTDGEVSVRVRGQQDNQVVGQLTITDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   G   ++Q  LEASNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M S + +
Sbjct: 242 EMNSKVISSVDKMMSFVNQ 260


>gi|87119674|ref|ZP_01075571.1| Flagella basal body rod protein [Marinomonas sp. MED121]
 gi|86165150|gb|EAQ66418.1| Flagella basal body rod protein [Marinomonas sp. MED121]
          Length = 261

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+SA    L +I+NN+AN++TTG+K+ RA F D LY   +  G     +    
Sbjct: 4   ALWVSKTGLSAMDKQLSVISNNLANVSTTGFKKDRAVFEDLLYHTVQQPG--GLQSQNTQ 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++S+ +  +++G+   T  +LD+A+ G+G+FQ+  PD  + YTR G F 
Sbjct: 62  LPSGLQMGAGVRVSATQKDFSEGDYNVTDRDLDVAIQGQGFFQILMPDGNMGYTRDGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G LVT+ G  + P + IP++   + +   G +  V    S+ + VGQL +A FIN 
Sbjct: 122 LNSEGDLVTSSGFLVEPQVTIPQDAMSVTIGDDGTVSIVRQGASESEGVGQLSLAGFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL +IG NL   TS SG PII  P      +V+Q  +E SNV++V+E+  +I+AQR YE
Sbjct: 182 EGLSSIGQNLFVETSASGAPIIDVPGTSALGNVRQNMVETSNVNSVEELVSLITAQRGYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MNSKV+ AAD M S + +
Sbjct: 242 MNSKVVSAADGMMSFVIQ 259


>gi|163802601|ref|ZP_02196493.1| polar flagellar FlgG [Vibrio sp. AND4]
 gi|159173684|gb|EDP58503.1| polar flagellar FlgG [Vibrio sp. AND4]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 106/259 (40%), Positives = 148/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNIATISNNLANASTVGFKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G    T N LD+ + G G+FQV  PD  + YTR G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTHGNAQTTTNALDMMVEGDGFFQVTLPDGNIGYTRNGQFT 121

Query: 123 IDSKGQLVTADGNT-LVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D +G LVT+     + P IVIPE+   I V   G++        +   VGQL I +F+N
Sbjct: 122 LDGEGTLVTSGSGYAVEPEIVIPEDAISITVGTDGEVSVRVRGEQNNVVVGQLTITDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   G   ++Q  LEASNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGEIRQSMLEASNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M S I +
Sbjct: 242 EMNSKVISSVDKMMSFINQ 260


>gi|315929129|gb|EFV08356.1| flagellar basal-body rod protein FlgG [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 250

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 100/252 (39%), Positives = 155/252 (61%), Gaps = 3/252 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA GM AQQT +++ +NNIAN+NT G+K++RAEFAD +YQ  K AG  + ++  
Sbjct: 1   MRSLHTAATGMVAQQTQIDVTSNNIANVNTAGFKKSRAEFADLMYQVMKYAG--TSTSAT 58

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNL-DLALVGRGWFQVETPDKTVMYTRAG 119
            + P GI +G GV+ ++V  V+T+G +  T  +  D+A+ G G+FQ++ PD T+ YTR G
Sbjct: 59  TLSPSGIEVGVGVRPTAVTKVFTEGNLKSTSTDGLDMAIAGNGFFQIQLPDGTIGYTRNG 118

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANF 179
            F  D++G +V +DG  L+P + IPE    I V+  G +  +         +GQ+ +  F
Sbjct: 119 QFTKDNEGNIVNSDGYRLLPEMTIPEGATAINVATDGTVSVMLPGEQQETQIGQVELVQF 178

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN AGL ++GDNL   T  SG P+       G   ++ G++E SNV  V+E++++I+ QR
Sbjct: 179 INPAGLHSMGDNLYLETGASGAPVAGIAGQDGLGTIRHGFIELSNVQLVEEMTDLITGQR 238

Query: 240 AYEMNSKVIEAA 251
           AYE  SK I  +
Sbjct: 239 AYEAGSKAITTS 250


>gi|117919774|ref|YP_868966.1| flagellar basal body rod protein FlgG [Shewanella sp. ANA-3]
 gi|117612106|gb|ABK47560.1| flagellar basal-body rod protein FlgG [Shewanella sp. ANA-3]
          Length = 262

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEVQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE+   I VS  G++   T   ++ Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPEDATSITVSAEGEVSVKTPGAAENQVVGQLSMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|326404069|ref|YP_004284151.1| flagellar basal-body rod protein FlgG [Acidiphilium multivorum
           AIU301]
 gi|325050931|dbj|BAJ81269.1| flagellar basal-body rod protein FlgG [Acidiphilium multivorum
           AIU301]
          Length = 260

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 119/261 (45%), Positives = 165/261 (63%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM AQQTN+E+I+NNIAN+ TTGYK  R  F D LYQ  + AGS S S   
Sbjct: 1   MRALDIAATGMQAQQTNVEVISNNIANMTTTGYKAQRVAFQDLLYQDLRRAGSNS-SDAG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G  IG GV+ +++  +  QG +  T N LD+A+ G GWFQV  P     YTR G+
Sbjct: 60  TIVPSGTQIGLGVKTAAIYRIDQQGNLQQTNNTLDMAISGNGWFQVTLPSGQTAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +   G +VTADG  + PGI IP     + ++ SGQ+       +  Q VGQL +A F 
Sbjct: 120 FGLSPNGTIVTADGYVVQPGIQIPTNATNVTINASGQVQVSLPGQTAPQTVGQLQLAVFP 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+AGL   G NL  +T+ SG+P+   P   GF  V QG++E SNV+ V E++++I+AQRA
Sbjct: 180 NDAGLAAQGGNLFLQTAASGNPVTGAPSAPGFGTVMQGFVENSNVNVVSEVTDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           Y+MNS+V+ A ++M S +T++
Sbjct: 240 YDMNSQVVTATNQMLSTLTQL 260


>gi|163852464|ref|YP_001640507.1| flagellar basal-body rod protein FlgG [Methylobacterium extorquens
           PA1]
 gi|218531220|ref|YP_002422036.1| flagellar basal-body rod protein FlgG [Methylobacterium
           chloromethanicum CM4]
 gi|240139801|ref|YP_002964278.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Methylobacterium extorquens AM1]
 gi|254562216|ref|YP_003069311.1| cell-distal portion of basal-body rod biosynthesis protein
           [Methylobacterium extorquens DM4]
 gi|163664069|gb|ABY31436.1| flagellar basal-body rod protein FlgG [Methylobacterium extorquens
           PA1]
 gi|218523523|gb|ACK84108.1| flagellar basal-body rod protein FlgG [Methylobacterium
           chloromethanicum CM4]
 gi|240009775|gb|ACS41001.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Methylobacterium extorquens AM1]
 gi|254269494|emb|CAX25460.1| flagellar biosynthesis; cell-distal portion of basal-body rod
           [Methylobacterium extorquens DM4]
          Length = 263

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 116/261 (44%), Positives = 170/261 (65%), Gaps = 1/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA GM+AQ+ N+++I+NNIAN+ TTGYKR +  F D LYQ  + +GS S S   
Sbjct: 1   MRALYAAATGMAAQELNVQVISNNIANLRTTGYKRQQVHFQDLLYQNLRRSGS-STSDQN 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            ++P G+++GSGV+ +S     +QG +  T  + D+A+ G G F+V  PD    Y+R GS
Sbjct: 60  TMLPAGLALGSGVKTTSTARAMSQGPLAQTEKDYDVAIRGEGLFRVRLPDGRTAYSRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++D++GQ+VT DG  L PG+ +P     + +S +G + A     +  Q +GQ  +A F+
Sbjct: 120 FDLDAQGQMVTRDGYLLDPGVTVPNTATSVTISATGAVQATMPGQTAPQALGQFQLARFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N+ GL +IGDNL   T+ SG  I   P   GF +++Q YLE +NV+AV EIS +I+AQRA
Sbjct: 180 NKVGLESIGDNLFVETAASGPAITGLPGSEGFGNLQQRYLEEANVNAVTEISSLIAAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YEMNSKV+ AAD+M S  ++M
Sbjct: 240 YEMNSKVVTAADQMLSTTSQM 260


>gi|113969608|ref|YP_733401.1| flagellar basal body rod protein FlgG [Shewanella sp. MR-4]
 gi|113884292|gb|ABI38344.1| flagellar basal-body rod protein FlgG [Shewanella sp. MR-4]
          Length = 262

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 159/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEVQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IP++   I VS  G++   T   ++ Q VGQL +++FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPDDATSITVSAEGEVSVKTPGTAENQVVGQLSMSDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|262404538|ref|ZP_06081093.1| flagellar basal-body rod protein FlgG [Vibrio sp. RC586]
 gi|262349570|gb|EEY98708.1| flagellar basal-body rod protein FlgG [Vibrio sp. RC586]
          Length = 262

 Score =  215 bits (548), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 147/259 (56%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K+ RA F D  YQ     G  +QS+    
Sbjct: 4   ALWVSKTGLDAQQTNIATISNNLANASTIGFKKGRAVFEDLFYQNINQPG--AQSSQNTR 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G    T N+LD+ + G G+FQ+  PD  + Y+R G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTHGNAQTTSNSLDMMIEGDGFFQILMPDGNIAYSRNGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D +G +  +  G  L P IVIPE+   I +   G++        D Q +GQ+   +FIN
Sbjct: 122 LDDEGAIVTSGSGYRLQPEIVIPEDAISITIGNDGEVSVRVRGQQDNQVLGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SG+P    P   G   V+Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGEPQEGVPGLDGLGDVRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDKMLSFVNQ 260


>gi|218703527|ref|YP_002411046.1| flagellar basal body rod protein FlgG [Escherichia coli UMN026]
 gi|218430624|emb|CAR11490.1| Flagellar basal-body rod protein (flgG-like) (Distal rod protein)
           [Escherichia coli UMN026]
          Length = 303

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 99/258 (38%), Positives = 148/258 (57%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+SAQ   +  IANNIAN+NTTG+KR R  F D  YQ ++  G  +      +
Sbjct: 46  ALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLFYQTQEAPG--AMLDQNNI 103

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+  GSGV+I   +  +T+G V  T N +++A++G+G+ QV+  +  + YTR G+  
Sbjct: 104 MPTGLQFGSGVRIVGTQKTFTEGNVETTDNAMNVAIMGQGFLQVQKANGDIAYTRDGNLQ 163

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +++ G L  + G  L P I +P     +     G + A+   +SD   +GQL + NF N 
Sbjct: 164 VNADGVLTNSQGLPLQPEIDVPAGATNVAFGEDGTVTAILPGDSDVTELGQLTLVNFANP 223

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG P    P + G   ++   LE SNVD V E+  MI+ QRAYE
Sbjct: 224 AGLSAEGDNLYLETAASGQPTEGVPGEDGLGTLQDNALEGSNVDIVNEMVAMITVQRAYE 283

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   I++
Sbjct: 284 MNAKMVSAADDMLQYISQ 301


>gi|114046840|ref|YP_737390.1| flagellar basal body rod protein FlgG [Shewanella sp. MR-7]
 gi|113888282|gb|ABI42333.1| flagellar basal-body rod protein FlgG [Shewanella sp. MR-7]
          Length = 262

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 159/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEVQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE+   I VS  G++   T   ++ Q VGQL +++FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPEDATSITVSAEGEVSVKTPGAAENQVVGQLSMSDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|153001470|ref|YP_001367151.1| flagellar basal body rod protein FlgG [Shewanella baltica OS185]
 gi|151366088|gb|ABS09088.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS185]
          Length = 262

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    S+    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GVSSSNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+++ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEIQLPDGTAAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IP+    I VS  G+I   T   +D Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPDNATSITVSAEGEISVKTPGTADNQVVGQLTMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S +T+
Sbjct: 242 EMNSKVISAVDQMLSYVTQ 260


>gi|126175144|ref|YP_001051293.1| flagellar basal body rod protein FlgG [Shewanella baltica OS155]
 gi|217972600|ref|YP_002357351.1| flagellar basal body rod protein FlgG [Shewanella baltica OS223]
 gi|304409976|ref|ZP_07391595.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS183]
 gi|307302311|ref|ZP_07582069.1| flagellar basal-body rod protein FlgG [Shewanella baltica BA175]
 gi|125998349|gb|ABN62424.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS155]
 gi|217497735|gb|ACK45928.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS223]
 gi|304351385|gb|EFM15784.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS183]
 gi|306914349|gb|EFN44770.1| flagellar basal-body rod protein FlgG [Shewanella baltica BA175]
          Length = 262

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    S+    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GVSSSNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+++ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEIQLPDGTAAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IP+    I VS  G++   T   +D Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPDNATSITVSAEGEVSVKTPGTADNQVVGQLTMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S +T+
Sbjct: 242 EMNSKVISAVDQMLSYVTQ 260


>gi|157961173|ref|YP_001501207.1| flagellar basal body rod protein FlgG [Shewanella pealeana ATCC
           700345]
 gi|157846173|gb|ABV86672.1| flagellar basal-body rod protein FlgG [Shewanella pealeana ATCC
           700345]
          Length = 262

 Score =  215 bits (547), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 112/259 (43%), Positives = 161/259 (62%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T G+K++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNVANASTVGFKKSRAVFEDLLYQNVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+SIGSG ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F+
Sbjct: 62  LPNGLSIGSGTKVVATQEIFTQGNMLTTDNSLDLLVEGPGFFEVQLPDGTAAYTRNGQFS 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE+   I VS  G++   T  N++ Q VGQL I++FIN
Sbjct: 122 LDDTGQIVTPGSGYVVQPAITIPEDATSITVSAEGEVSVKTPGNAENQVVGQLAISDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYMETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDQMLSYVNQ 260


>gi|33592481|ref|NP_880125.1| flagellar basal body rod protein FlgG [Bordetella pertussis Tohama
           I]
 gi|33572127|emb|CAE41669.1| flagellar basal-body rod protein FlgG [Bordetella pertussis Tohama
           I]
 gi|332381898|gb|AEE66745.1| flagellar basal body rod protein FlgG [Bordetella pertussis CS]
          Length = 261

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 99/262 (37%), Positives = 157/262 (59%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++  +A  G+  QQT++++I+NN+AN+ T G+K  RA F D +YQ  +  G  +Q  D 
Sbjct: 2   MRSLWVAKTGLEGQQTSMDVISNNLANVQTNGFKWGRAVFQDLMYQTLRQPG--AQVGDA 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G GVQ+++ + V++QG + +TG  +D+A+ GRG+ QVE PD T  YTR GS
Sbjct: 60  NQLPSGLQLGMGVQVAATQRVFSQGNMNNTGGEMDIAIQGRGFLQVELPDGTQAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVG-QLLIANF 179
             +D  GQL TA G  + P I +P+    + + + G +       +       QL +A F
Sbjct: 120 LQVDQNGQLTTAGGYVIQPPINVPDNALSLTIGKDGTVSVTQPGAAGTNVQIGQLQVATF 179

Query: 180 INEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           IN  GL+++G+NL   T  SG   +  P   G   + Q Y+E SNV+  +E+  MI+ QR
Sbjct: 180 INPTGLQSVGENLYLETDSSGPANLLQPGIDGAGQILQQYVETSNVNVAEELVNMITTQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           AYEMNSK ++ +DEM + +T++
Sbjct: 240 AYEMNSKAVKTSDEMLARLTQL 261


>gi|114562344|ref|YP_749857.1| flagellar basal body rod protein FlgG [Shewanella frigidimarina
           NCIMB 400]
 gi|114333637|gb|ABI71019.1| flagellar basal-body rod protein FlgG [Shewanella frigidimarina
           NCIMB 400]
          Length = 262

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 110/259 (42%), Positives = 161/259 (62%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQTN+ +I+NN+AN +T G+K++RA F D LYQ    AG    S+D + 
Sbjct: 4   ALWISKTGVDAQQTNIAVISNNVANASTVGFKKSRAVFEDLLYQTVNQAG--GISSDNSK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F+
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGSGFFEVQMPDGTAAYTRNGQFS 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IP+++  I VS SG++   T   +  Q +GQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVVQPPITIPDDSTSITVSASGEVSVQTPGTAASQVIGQLTMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I  QR Y
Sbjct: 182 PAGLDPLGQNLYTETGASGTPIQGTASLDGLGSIRQGALETSNVNVTEELVNLIQGQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S I +
Sbjct: 242 EMNSKVISAVDQMLSYINQ 260


>gi|220930463|ref|YP_002507372.1| hypothetical protein Ccel_3100 [Clostridium cellulolyticum H10]
 gi|220000791|gb|ACL77392.1| protein of unknown function DUF1078 domain protein [Clostridium
           cellulolyticum H10]
          Length = 270

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 92/272 (33%), Positives = 141/272 (51%), Gaps = 14/272 (5%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   A +GM AQQ N+++I+NN+AN+NTTGYK+ RAEF D LYQ    A       + 
Sbjct: 2   MRALYTAGSGMKAQQFNVDVISNNLANVNTTGYKKERAEFKDLLYQTMDRA----YVLND 57

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           A  P  + +G G  +SS    +  G    T +NLD A+ G G+F +  P  TV YTR GS
Sbjct: 58  AGKPVNLQVGHGTVVSSTVRNFENGTPEQTSSNLDFAIDGEGFFTIMGPQGTVQYTRDGS 117

Query: 121 FN--IDSKGQLVTADGNTL--------VPGIVIPEETREIKVSRSGQILAVTGKNSDFQP 170
           F   I   G       +                     E+ VS  G++     +      
Sbjct: 118 FKLSITEDGMKKLTTADGYAVLDNSGEEILFDPEVNISELSVSPRGEMSYKDAEGVSVPM 177

Query: 171 VGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKE 230
              + +  F N+  L  +G+NL +  S +G+P+  + D+   + +KQG+LE+SNV  V E
Sbjct: 178 DQTIGMVIFPNKYALEAVGNNLYSSNSATGEPVQVSEDENAKSIMKQGFLESSNVQVVDE 237

Query: 231 ISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           + ++I AQRAYE++SK I+++D+M  +   +R
Sbjct: 238 MVKLIVAQRAYEVSSKAIQSSDDMLQIANNLR 269


>gi|158321569|ref|YP_001514076.1| hypothetical protein Clos_2549 [Alkaliphilus oremlandii OhILAs]
 gi|158141768|gb|ABW20080.1| protein of unknown function DUF1078 domain protein [Alkaliphilus
           oremlandii OhILAs]
          Length = 264

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 93/268 (34%), Positives = 147/268 (54%), Gaps = 11/268 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ N++ I+NN+AN+NTTGYK+ + EF D LY   +     +   D 
Sbjct: 1   MRALWTAASGMKAQQLNMDTISNNLANVNTTGYKKQKVEFKDLLYANMRT----TNLVDG 56

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + +G GV   +   ++T G +  T N  D+A+ G G+F +E P     YTR G+
Sbjct: 57  EGSPVNLQVGHGVMPVATTRLFTTGNLERTDNPFDMAINGEGFFVIEAPSGDRFYTRDGN 116

Query: 121 FNIDSKG---QLVTADGNTLVPGIV---IPEETREIKVSRSGQILAVTGKNSDFQPVGQL 174
           F +  +G   +LVT+DG T+V         + T +     +  ++    ++ + + +  +
Sbjct: 117 FKLSVEGDEMRLVTSDGYTVVSEFEDAIYFDGTMKEITVNANGLITAETEDGEIEEIATI 176

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            +ANFIN  GL  +G NL   T  SG+ +    ++   + + Q YLE SNV  V E+  +
Sbjct: 177 ALANFINPEGLLAVGKNLYKETVASGEAVFME-EEARTSDIVQNYLETSNVQIVDEMVRL 235

Query: 235 ISAQRAYEMNSKVIEAADEMSSLITKMR 262
           I+AQRAYE+NSK I+ +DEM  +   +R
Sbjct: 236 ITAQRAYEINSKAIQTSDEMLGIANNLR 263


>gi|307293785|ref|ZP_07573629.1| flagellar basal-body rod protein FlgG [Sphingobium chlorophenolicum
           L-1]
 gi|306879936|gb|EFN11153.1| flagellar basal-body rod protein FlgG [Sphingobium chlorophenolicum
           L-1]
          Length = 262

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ T + +IANN+AN+NTT +KR RA+F    YQ    AG+ S S +K  
Sbjct: 5   ALHVARTGLDAQNTKMRVIANNLANVNTTAFKRDRADFETLAYQQIVAAGANSDSENKFA 64

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
              G+++GSGV +     +  QG +  TGN LD+A+ G G+FQV+ PD ++ YTRAG+F 
Sbjct: 65  T--GLNLGSGVALQGTSKINAQGTLNQTGNTLDMAIEGSGYFQVQQPDGSIAYTRAGNFT 122

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
             ++G +VT+DG  L+P I +PE    I +   G + A     ++   +GQ+ +A+F+N 
Sbjct: 123 TTAEGVVVTSDGLPLIPQITVPEGATSITIGNDGTVSATLQGQTEPTQLGQVELASFMNP 182

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL++ G NLL  T+ SG P +      G   V+ GYLE SNV+ V+E+ +MI  QRAYE
Sbjct: 183 GGLQSTGGNLLKETAASGTPQVGVAGLDGRGVVRSGYLETSNVNVVEELVDMIETQRAYE 242

Query: 243 MNSKVIEAADEMSSLITK 260
           +NSK+I+A DEM     +
Sbjct: 243 VNSKMIKATDEMLQYANQ 260


>gi|322432975|ref|YP_004210224.1| flagellar basal-body rod protein FlgG [Acidobacterium sp. MP5ACTX9]
 gi|321165202|gb|ADW70906.1| flagellar basal-body rod protein FlgG [Acidobacterium sp. MP5ACTX9]
          Length = 263

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 113/262 (43%), Positives = 162/262 (61%), Gaps = 3/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A   AA+GM+AQQ NL+ IANN+AN +TTG+++ R  F+D LYQ     G  S +  +
Sbjct: 2   IRALYTAASGMTAQQLNLDNIANNLANSSTTGFQQRRLAFSDMLYQNTTSPG--SAATQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
                G+ +G GV+ +S   + TQG+   TGN LDLA+ G G+FQV  P+    Y+R+GS
Sbjct: 60  TTNAAGLQVGLGVRPTSTETIQTQGDFNSTGNPLDLAISGGGFFQVLLPNGQTGYSRSGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F++DS G +VTADGN L P I IP +   I +   G +  V    +    +G + +A F+
Sbjct: 120 FHMDSTGNVVTADGNPLQPAITIPPDATNITIGSDGTVSVVQPGTTQSAQIGSIQMALFV 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPD-DIGFAHVKQGYLEASNVDAVKEISEMISAQR 239
           N  GL ++G+N+   T+ SGDPII  P    G   ++QG LEASNV  V E  EMI AQR
Sbjct: 180 NPGGLNSVGNNIYLATTASGDPIIGTPGGSEGLGTIQQGTLEASNVSVVDEFVEMIVAQR 239

Query: 240 AYEMNSKVIEAADEMSSLITKM 261
           +YE NS+V++AADEM   + ++
Sbjct: 240 SYESNSRVVKAADEMMQQLNQL 261


>gi|313894975|ref|ZP_07828534.1| flagellar basal-body rod protein FlgG [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|320530443|ref|ZP_08031501.1| flagellar basal-body rod protein FlgG [Selenomonas artemidis F0399]
 gi|312976428|gb|EFR41884.1| flagellar basal-body rod protein FlgG [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|320137276|gb|EFW29200.1| flagellar basal-body rod protein FlgG [Selenomonas artemidis F0399]
          Length = 264

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 102/264 (38%), Positives = 155/264 (58%), Gaps = 4/264 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A   AA+GM AQQ +++I+A+NIAN+NT G K+ RAEF D +YQ  + AG+ + +  +
Sbjct: 2   MRALWSAASGMKAQQAHMDIVAHNIANVNTHGGKKVRAEFQDLVYQTLREAGARNGTDSQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P  + IG G ++++ + ++TQG +  T N  D+ + G G+F+V  PD +  YTR G+
Sbjct: 62  --YPTALQIGLGTRVAATQRIFTQGALQTTDNPTDIGIQGEGFFRVTLPDGSTAYTRDGT 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREI--KVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           + +DS  ++VT DG  +  GI I E        +S  G++       +  Q  GQ+ +A 
Sbjct: 120 WKLDSNRRMVTTDGYLIADGIQIGENAPSESITISGDGRVSYREAGQTQQQEAGQITLAR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL +IG NL   +  SG+ I S P   G   + QG LE SNV  V+E+ EMI +Q
Sbjct: 180 FVNPAGLTSIGKNLFVVSDASGEAIESTPGLDGTGTLTQGTLEMSNVQIVEEMVEMIISQ 239

Query: 239 RAYEMNSKVIEAADEMSSLITKMR 262
           RAYE NSK I  +D M  +   ++
Sbjct: 240 RAYESNSKAITTSDSMLEIANTLK 263


>gi|283834453|ref|ZP_06354194.1| flagellar basal-body rod protein FlgG [Citrobacter youngae ATCC
           29220]
 gi|291070000|gb|EFE08109.1| flagellar basal-body rod protein FlgG [Citrobacter youngae ATCC
           29220]
          Length = 261

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+SAQ   +  IANNIAN+NTTG+KR R  F D  YQ ++  G  +      +
Sbjct: 4   ALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLFYQTQEAPG--AMLDQNNI 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+  GSGV+I   +  +T+G V  T N +++A++G+G++QV+  +  + YTR G+  
Sbjct: 62  MPTGMQFGSGVRIVGTQKTFTEGNVETTDNTMNVAIMGQGFWQVQKANGDIAYTRDGNLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +++ G L  A G  L P I +P  + ++  +  G + A+   +SD   +GQL + NF N 
Sbjct: 122 VNADGVLTNAQGLPLQPEIDVPAGSTQVAFAPDGTVSAILPGDSDPTELGQLTLVNFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG P    P + G   ++ G LE SNVD V E+  MI+ QRAYE
Sbjct: 182 AGLSAEGDNLYLETAASGQPTEGIPGEDGLGTLQDGALEGSNVDIVNEMVAMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   I++
Sbjct: 242 MNAKMVSAADDMLQFISQ 259


>gi|260767767|ref|ZP_05876702.1| flagellar basal-body rod protein FlgG [Vibrio furnissii CIP 102972]
 gi|260617276|gb|EEX42460.1| flagellar basal-body rod protein FlgG [Vibrio furnissii CIP 102972]
 gi|315179401|gb|ADT86315.1| flagellar basal body rod protein FlgG [Vibrio furnissii NCTC 11218]
          Length = 262

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 149/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNIATISNNLANASTVGFKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G    T N+LD+ + G G+FQ+  PD  + Y+R G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTHGNAQTTTNSLDMMIEGDGFFQILMPDGNIGYSRNGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G +  +  G  L P IVIP++   I V   G++        D Q +GQ+   +FIN
Sbjct: 122 LNDEGVIVTSGSGYPLQPEIVIPDDAISITVGNDGEVSVRVRGQQDNQVLGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   G  +V+Q  LE+SNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGLDGLGNVRQSMLESSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDKMMSFVNQ 260


>gi|146293688|ref|YP_001184112.1| flagellar basal body rod protein FlgG [Shewanella putrefaciens
           CN-32]
 gi|145565378|gb|ABP76313.1| flagellar basal-body rod protein FlgG [Shewanella putrefaciens
           CN-32]
 gi|319427087|gb|ADV55161.1| flagellar basal-body rod protein FlgG [Shewanella putrefaciens 200]
          Length = 262

 Score =  215 bits (546), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+++ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEIQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE+   I VS  G++   T   ++ Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPEDATSITVSAEGEVSVKTAGAAENQVVGQLSMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|254227985|ref|ZP_04921415.1| flagellar basal-body rod protein FlgG [Vibrio sp. Ex25]
 gi|151939481|gb|EDN58309.1| flagellar basal-body rod protein FlgG [Vibrio sp. Ex25]
          Length = 261

 Score =  215 bits (546), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           VP GI +GSGV++   + V+TQG   +T   LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  VPSGIQLGSGVRVVGTQKVFTQGNTQNTTQELDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++S+G +V + G  L P I IP+      V   G +   T  +   Q +GQ+ +A FIN 
Sbjct: 122 VNSEGLMVNSQGLPLEPQIQIPDNASSFSVGVDGTVTTTTADDPTPQQLGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG        + G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETEASGPADELIAGEDGAGLIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   +++
Sbjct: 242 MNAKVVSAADDMLKFVSQ 259


>gi|258621051|ref|ZP_05716085.1| flagellar basal-body rod protein FlgG [Vibrio mimicus VM573]
 gi|258625279|ref|ZP_05720187.1| flagellar basal-body rod protein FlgG [Vibrio mimicus VM603]
 gi|262166280|ref|ZP_06034017.1| flagellar basal-body rod protein FlgG [Vibrio mimicus VM223]
 gi|262170827|ref|ZP_06038505.1| flagellar basal-body rod protein FlgG [Vibrio mimicus MB-451]
 gi|258582452|gb|EEW07293.1| flagellar basal-body rod protein FlgG [Vibrio mimicus VM603]
 gi|258586439|gb|EEW11154.1| flagellar basal-body rod protein FlgG [Vibrio mimicus VM573]
 gi|261891903|gb|EEY37889.1| flagellar basal-body rod protein FlgG [Vibrio mimicus MB-451]
 gi|262025996|gb|EEY44664.1| flagellar basal-body rod protein FlgG [Vibrio mimicus VM223]
          Length = 262

 Score =  215 bits (546), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 147/259 (56%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T G+K+ RA F D  YQ     G  +QS+    
Sbjct: 4   ALWVSKTGLDAQQTNIATISNNLANASTVGFKKGRAVFEDLFYQNINQPG--AQSSQNTR 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+T G    T N+LD+ + G G+FQ+  PD  + Y+R G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTHGNAQTTSNSLDMMIEGDGFFQILMPDGNIAYSRNGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D +G +  +  G  L P IVIPE+   I +   G++        D Q +GQ+   +FIN
Sbjct: 122 LDDEGAIVTSGSGYRLQPEIVIPEDAISITIGNDGEVSVRVRGQQDNQVLGQITTVDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SG+P    P   G   V+Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGEPQEGVPGLDGLGDVRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDKMMSFVNQ 260


>gi|308273544|emb|CBX30146.1| Flagellar basal-body rod protein flgG [uncultured Desulfobacterium
           sp.]
          Length = 260

 Score =  215 bits (546), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 161/262 (61%), Gaps = 4/262 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++    AA+GM AQ+  +++I+NN+AN+NT G+K++R +F D +YQ     GS + S D+
Sbjct: 2   LRGMWSAASGMDAQKMMIDVISNNLANVNTVGFKKSRPDFQDLMYQTMSQGGSTTTSGDQ 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P GI +G G    SV+ ++ QG+   T N LDL++ G+G+F+V + D+ V  TRAG+
Sbjct: 62  --IPGGIQVGMGTMPVSVQKMFMQGDFKETKNELDLSIEGKGFFKVISNDEEVY-TRAGN 118

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  G + T +G  L P + IP +T  I + +SG + A  G +     VG + + +F 
Sbjct: 119 FKMDKDGNICTPNGEKLQPAMTIPSDTMTISIDKSGTVTA-FGPSGQGTVVGVIELHSFT 177

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL ++G NL  +T  SGD I + P   G   + QG++E SNVD V+E+  MI AQRA
Sbjct: 178 NPAGLFSMGHNLYRKTDASGDAIAAAPGSDGMGTIAQGFIEMSNVDVVEEMVAMIMAQRA 237

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YE++SK I+ AD M  +   ++
Sbjct: 238 YEVSSKSIQTADNMLQMANNIK 259


>gi|120598234|ref|YP_962808.1| flagellar basal body rod protein FlgG [Shewanella sp. W3-18-1]
 gi|120558327|gb|ABM24254.1| flagellar basal-body rod protein FlgG [Shewanella sp. W3-18-1]
          Length = 262

 Score =  215 bits (546), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GISASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+V+ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEVQLPDGTTAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE+   I VS  G++   T   ++ Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVLQPAITIPEDATSITVSAEGEVSVKTAGAAENQVVGQLSMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M + + +
Sbjct: 242 EMNSKVISAVDQMLAYVNQ 260


>gi|84514831|ref|ZP_01002194.1| Flagellar distal rod protein [Loktanella vestfoldensis SKA53]
 gi|84510990|gb|EAQ07444.1| Flagellar distal rod protein [Loktanella vestfoldensis SKA53]
          Length = 261

 Score =  215 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 161/259 (62%), Gaps = 2/259 (0%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            A  +A  G++AQQT +++IANN+AN+NT G+K  R  F   LYQ ++  G   Q+++  
Sbjct: 3   NAMHVAKTGLNAQQTRMQVIANNLANLNTVGFKSDRVNFESLLYQVKRSGGD--QTSEGT 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
            +   +++G+GV+  + + +YTQG +V+T N+ DLA+ G+G+FQV  PD  V YTR GSF
Sbjct: 61  ALTSALALGTGVRAVNTQKLYTQGGMVNTDNSFDLAIEGQGFFQVLMPDGRVGYTRNGSF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +  + G + TA G  + P I IP +  E+ +S+ G +        + Q VGQL IA+F N
Sbjct: 121 SRSADGTMTTASGYVVQPEIRIPADATEVNISQDGLVSVRQAGEEEAQEVGQLTIASFAN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+ IG++ + +T  SG P ++ P   G   + QG LE SNV+ V+++ EMI  QRAY
Sbjct: 181 PRGLQPIGESFVTQTLASGAPTVAAPQAQGLGKLMQGALEGSNVNVVQQLVEMIETQRAY 240

Query: 242 EMNSKVIEAADEMSSLITK 260
           E++SK I ++DEM   I+ 
Sbjct: 241 EVSSKAISSSDEMMRYISN 259


>gi|260774940|ref|ZP_05883841.1| flagellar basal-body rod protein FlgG [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609195|gb|EEX35353.1| flagellar basal-body rod protein FlgG [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 262

 Score =  215 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 102/259 (39%), Positives = 148/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T GYK++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNISTISNNLANASTVGYKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+TQG    T N+LD+ + G G+FQ+  PD  + Y+R G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTQGNTQTTNNSLDMMIEGDGFFQILMPDGNIGYSRNGQFT 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G +  +  G  L P I IPE+   I +   G++        D Q VGQ+   +F+N
Sbjct: 122 VNDEGVVVTSGAGYPLEPEIAIPEDAISITIGTDGEVSVRVRGQQDNQVVGQIATVDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   GF  ++Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGFDGFGDIRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDKMMSFVNQ 260


>gi|323495375|ref|ZP_08100452.1| flagellar basal body rod protein FlgG [Vibrio brasiliensis LMG
           20546]
 gi|323310298|gb|EGA63485.1| flagellar basal body rod protein FlgG [Vibrio brasiliensis LMG
           20546]
          Length = 262

 Score =  214 bits (545), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 149/259 (57%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G+ AQQTN+  I+NN+AN +T GYK++RA F D  YQ     G   QS+    
Sbjct: 4   ALWVSKTGLDAQQTNISTISNNLANASTVGYKKSRAVFEDLFYQNINQPG--GQSSQNTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+G ++ + + V+TQG    T N+LD+ + G G+FQ+  PD  + YTR G F 
Sbjct: 62  LPSGLMLGAGSKVVATQKVHTQGNTQTTNNSLDMMIEGDGFFQILMPDGNIGYTRNGQFT 121

Query: 123 IDSKGQLVTADGNT-LVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +G +VT+     L P I IPE+   + +   G++        D Q VGQ+   +F+N
Sbjct: 122 VNDEGVIVTSGAGYALEPEIAIPEDAISVTIGTDGEVSVRVRGQQDNQVVGQIATVDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL  IG NL   T  SGDP    P   GF  V+Q  LE SNV+  +E+  MI AQR Y
Sbjct: 182 PGGLEPIGQNLYLPTGASGDPQEGVPGFDGFGEVRQSMLETSNVNVTEELVNMIEAQRVY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDKMMSFVNQ 260


>gi|160876201|ref|YP_001555517.1| flagellar basal body rod protein FlgG [Shewanella baltica OS195]
 gi|160861723|gb|ABX50257.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS195]
 gi|315268391|gb|ADT95244.1| flagellar basal-body rod protein FlgG [Shewanella baltica OS678]
          Length = 262

 Score =  214 bits (545), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 109/259 (42%), Positives = 158/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDIAVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GVSASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + ++TQG ++ T N+LDL + G G+F+++ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEIQLPDGTAAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     L  P I IP+    I VS  G++   T   ++ Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYLLQPAITIPDNATSITVSAEGEVSVKTPGTAENQVVGQLTMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S +T+
Sbjct: 242 EMNSKVISAVDQMLSYVTQ 260


>gi|28900124|ref|NP_799779.1| putative flagellar basal-body rod protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260365774|ref|ZP_05778270.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           K5030]
 gi|260880696|ref|ZP_05893051.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AN-5034]
 gi|260897698|ref|ZP_05906194.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           Peru-466]
 gi|260899391|ref|ZP_05907786.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ4037]
 gi|28808407|dbj|BAC61612.1| putative flagellar basal-body rod protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308086222|gb|EFO35917.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           Peru-466]
 gi|308092230|gb|EFO41925.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AN-5034]
 gi|308109302|gb|EFO46842.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           AQ4037]
 gi|308115005|gb|EFO52545.1| flagellar basal-body rod protein FlgG [Vibrio parahaemolyticus
           K5030]
 gi|328470103|gb|EGF41014.1| flagellar basal body rod protein FlgG [Vibrio parahaemolyticus
           10329]
          Length = 261

 Score =  214 bits (545), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  GM+AQ T +  I+NN+AN+NT G+KR R  F D  Y  ++  G  +Q      
Sbjct: 4   ALWVSKTGMAAQDTKMTAISNNLANVNTVGFKRDRVVFEDLFYSIQRQPG--AQVDQVNE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSGV++   + V+TQG   +T  +LDLA++G+G+FQ+E  D  +MYTR G F+
Sbjct: 62  LPSGVQLGSGVRVVGTQKVFTQGNTQNTTQDLDLAVMGQGFFQIENSDGQIMYTRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I+S+G +V + G  L P I IP+      V   G +   T  +   Q +GQ+ +A FIN 
Sbjct: 122 INSEGLMVNSQGLPLEPQIQIPDNATSFSVGVDGTVTTTTADDPTPQQLGQITLAKFINP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G NL   T  SG          G   +KQG LE SNV  V+E+ +MI+ QRAYE
Sbjct: 182 AGLEAVGGNLFRETEASGPADELIAGADGAGSIKQGALEGSNVQVVEEMVDMITTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+KV+ AAD+M   +++
Sbjct: 242 MNAKVVSAADDMLKFVSQ 259


>gi|85710166|ref|ZP_01041231.1| flagellar basal-body rod protein [Erythrobacter sp. NAP1]
 gi|85688876|gb|EAQ28880.1| flagellar basal-body rod protein [Erythrobacter sp. NAP1]
          Length = 263

 Score =  214 bits (545), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 114/259 (44%), Positives = 159/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  +A  G+ AQ   + +IANN+ANI TTG+KR RAEFA   YQ  +VAG   QS  +  
Sbjct: 5   ALHVARTGLEAQDARMRVIANNLANIGTTGFKRDRAEFATLAYQEMRVAGQ--QSTQQTA 62

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDK-TVMYTRAGSF 121
              G+++G+GVQ++    +  QG +  TGN+LDLAL G G+FQVE P    + YTRAG+F
Sbjct: 63  FATGLNLGTGVQVTGTSRIEAQGTLNQTGNSLDLALDGPGFFQVELPGGGDIAYTRAGNF 122

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            +  +GQLVT  G  L P I +P+  + I ++  G + AV    +    +GQL +A+F+N
Sbjct: 123 TLSPEGQLVTTQGYALTPPIQVPQGAQNITIAPDGTVSAVQPGQTAPIQIGQLQVASFVN 182

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGLR IGDN L  T+ SG          G  +++QG LE SNV+ V+E+ EMI AQRAY
Sbjct: 183 PAGLRAIGDNFLVETAASGPVDAGLAGQFGRGNIRQGMLETSNVNVVEELVEMIEAQRAY 242

Query: 242 EMNSKVIEAADEMSSLITK 260
           E+NSK++ + DEM     +
Sbjct: 243 EINSKMVSSVDEMLRNANQ 261


>gi|119947175|ref|YP_944855.1| flagellar basal-body rod protein FlgG [Psychromonas ingrahamii 37]
 gi|119865779|gb|ABM05256.1| flagellar basal-body rod protein FlgG [Psychromonas ingrahamii 37]
          Length = 261

 Score =  214 bits (545), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 98/258 (37%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  GM+AQ   +  I+NN+ANINT G+KR R  F D  Y  +K  G+     +K  
Sbjct: 4   ALWISKTGMAAQDAKMTAISNNLANINTVGFKRDRVVFEDLFYSIQKQPGASVDGQNK-- 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G+GV++   + VYTQG + +T   LDLA++G G+FQ+E  D T+M++R G F+
Sbjct: 62  LPTGLQLGNGVRVVGTQKVYTQGSIQNTSQELDLAILGAGFFQIENSDGTIMFSRNGQFH 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++++GQ V   G +L+P + +P+    + ++  G++ AV    ++ + +G++ +  F+N 
Sbjct: 122 LNAEGQFVNTQGLSLIPQVNVPQGATSVSIAIDGKVSAVIPGQTELEQIGEITLVTFMNP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           +GL   G NL + T  SG          G   +KQG LE SNV  V+E+ +MIS QRAYE
Sbjct: 182 SGLMAKGGNLFSATESSGAANELTAGLDGAGIIKQGALEGSNVQVVEEMVDMISTQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           M++K++ AADEM   I +
Sbjct: 242 MSAKMVSAADEMLKYIAQ 259


>gi|157376214|ref|YP_001474814.1| flagellar basal body rod protein FlgG [Shewanella sediminis
           HAW-EB3]
 gi|157318588|gb|ABV37686.1| flagellar basal-body rod protein FlgG [Shewanella sediminis
           HAW-EB3]
          Length = 262

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 108/259 (41%), Positives = 157/259 (60%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ AQQT++ +I+NN+AN +T GYK++RA F D LYQ    AG    SA    
Sbjct: 4   ALWISKTGLDAQQTDISVISNNVANASTVGYKKSRAVFEDLLYQTVNQAG--GVSASNTK 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G++IG+G ++ + + V+TQG ++ T N++DL + G G+F+++ PD T  YTR G F 
Sbjct: 62  LPNGLNIGAGTKVVATQKVFTQGNMLTTDNSMDLMVEGPGFFEIQLPDGTAAYTRNGQFT 121

Query: 123 IDSKGQLVTADGNTL-VPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           +D  GQ+VT     +  P I IPE    I VS  G++   T   ++ Q VGQL + +FIN
Sbjct: 122 LDDTGQIVTPGSGYVVQPAITIPENATGITVSAEGEVSVKTPGTAESQVVGQLSMTDFIN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            +GL  +G NL   T  SG PI       G   ++QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRIY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI A D+M S + +
Sbjct: 242 EMNSKVISAVDQMLSYVNQ 260


>gi|260866415|ref|YP_003232817.1| putative lateral flagellar component of cell-distal portion of
           basal-body rod [Escherichia coli O111:H- str. 11128]
 gi|257762771|dbj|BAI34266.1| predicted lateral flagellar component of cell-distal portion of
           basal-body rod [Escherichia coli O111:H- str. 11128]
 gi|323178492|gb|EFZ64070.1| flagellar basal-body rod protein FlgG [Escherichia coli 1180]
          Length = 261

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 99/258 (38%), Positives = 147/258 (56%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+SAQ   +  IANNIAN+NTTG+KR R  F D  YQ  +  G  +      +
Sbjct: 4   ALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLFYQTLEAPG--AMLDQNNI 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+  GSGV+I   +  +T+G V  T N +++A++G+G+ QV+  +  + YTR G+  
Sbjct: 62  MPTGLQFGSGVRIVGTQKTFTEGNVETTDNAMNVAIMGQGFLQVQKANGDIAYTRDGNLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +++ G L  + G  L P I +P     +     G + A+   +SD   +GQL + NF N 
Sbjct: 122 VNADGVLTNSQGLPLQPEIDVPAGATNVAFGEDGTVTAILPGDSDVTELGQLTLVNFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG P    P + G   ++   LE SNVD V E+  MI+ QRAYE
Sbjct: 182 AGLSAEGDNLYLETAASGQPTEGVPGEDGLGTLQDNALEGSNVDIVNEMVAMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   I++
Sbjct: 242 MNAKMVSAADDMLQYISQ 259


>gi|83816512|ref|YP_446741.1| flagellar basal-body rod protein FlgG [Salinibacter ruber DSM
           13855]
 gi|294508677|ref|YP_003572736.1| flagellar basal-body rod protein FlgG [Salinibacter ruber M8]
 gi|83757906|gb|ABC46019.1| flagellar basal-body rod protein FlgG [Salinibacter ruber DSM
           13855]
 gi|294345006|emb|CBH25784.1| flagellar basal-body rod protein FlgG [Salinibacter ruber M8]
          Length = 262

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 155/261 (59%), Gaps = 3/261 (1%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
           ++   AA GM AQQT+++ IANN++N NTTGYKR+R  F D LY+  +   + ++     
Sbjct: 4   RSLQTAALGMQAQQTSIDNIANNLSNANTTGYKRSRVVFQDLLYENVQ---ASAEGQTDG 60

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
             P  + IGSG    +    ++QG    TGN+LDLA+ G G+FQV+ PD ++ YTR G+F
Sbjct: 61  AEPAELQIGSGTTAVATVRNFSQGSFSKTGNSLDLAINGDGFFQVQQPDGSLAYTRDGTF 120

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
            + S+G +VT  G  + P I +P    EI + + G + A     S+   +GQ+ +A F N
Sbjct: 121 TLSSEGNIVTQTGLKVQPNINVPPNAVEISIDQEGTVKARLQGESEMVELGQMELARFPN 180

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
            AGLR  G NL  +T  SG+P I  P   G  +V+QG+LE  NV  V+E++ +I AQR Y
Sbjct: 181 SAGLRPQGGNLYEQTESSGEPFIGTPGRGGLGNVRQGFLEKGNVKVVQEMTSLIQAQRTY 240

Query: 242 EMNSKVIEAADEMSSLITKMR 262
           E+NS+++  +DEM      ++
Sbjct: 241 ELNSRMVTTSDEMMQTANNVK 261


>gi|146305252|ref|YP_001185717.1| flagellar basal-body rod protein FlgG [Pseudomonas mendocina ymp]
 gi|145573453|gb|ABP82985.1| flagellar basal-body rod protein FlgG [Pseudomonas mendocina ymp]
          Length = 261

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  ++  G++AQ   +  +ANN+AN+NTTG+K  R  F D  Y  E   G  +Q+     
Sbjct: 4   ALWVSKTGLAAQDKAMSAVANNLANVNTTGFKSDRVVFEDLFYAIELQPG--AQADQVNT 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           VP GI +GSGV+++  + V+T+G +  TG  +DLA++G G+FQVE P+  + YT +G F 
Sbjct: 62  VPSGIQLGSGVRVAGTQKVFTEGSIQTTGQPMDLAIIGNGFFQVEAPNGDIYYTESGQFQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           ++++G +V A G  LVPGI +P  +    V   G + AV    +    +GQ+ +ANF N 
Sbjct: 122 LNAEGVIVNAQGLPLVPGIEVPAGSSRFTVGSDGIVTAVMAGETLPVELGQITLANFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            GL  +G NL   T  SG+P+   P + G  ++KQG LE SNV  V+ +  MI+ QRAYE
Sbjct: 182 GGLEALGGNLYRETVASGEPVEGTPGEDGLGNLKQGVLEGSNVQVVEAMVNMIAIQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
            N+KV++AA  M   + +
Sbjct: 242 ANAKVLDAASGMQQFLNQ 259


>gi|239995123|ref|ZP_04715647.1| flagellar basal body rod protein FlgG [Alteromonas macleodii ATCC
           27126]
          Length = 262

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/259 (37%), Positives = 160/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ A QT++ +++NN+AN +T G+K+ RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAAQTDVAVVSNNLANASTVGFKKDRAVFEDLLYQNINQPG--GRSSADTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSG ++ + +  +TQG ++ T N LD+++ GRG+F++  PD T+ Y+R G F+
Sbjct: 62  LPSGLMLGSGSKVVATQKAHTQGNLLTTENALDMSIQGRGYFEILQPDGTIAYSRNGQFS 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +GQ+  +  G  L P + IPE+ ++I +S+ G+I       ++ Q +GQL I++F+N
Sbjct: 122 LNDQGQIVTSGAGFLLQPEVAIPEDAQQITISQDGEISVSIRGQAEPQVLGQLNISDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+  G NL   T+ SG PI   P   G  ++ QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PTGLQPTGQNLYVETASSGAPIQGIPGLQGLGYISQGTLETSNVNVTEELVNLIESQRLY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M   + +
Sbjct: 242 EMNSKVISSVDQMLGQVIQ 260


>gi|331666548|ref|ZP_08367422.1| flagellar basal-body rod protein FlgG [Escherichia coli TA271]
 gi|331065772|gb|EGI37656.1| flagellar basal-body rod protein FlgG [Escherichia coli TA271]
          Length = 261

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/258 (38%), Positives = 148/258 (57%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+SAQ   +  IANNIAN+NTTG+KR R  F D  YQ ++  G  +      +
Sbjct: 4   ALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLFYQTQEAPG--AMLDQNNI 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+  GSGV+I   +  +T+G V  T N +++A++G+G+ QV+  +  + YTR G+  
Sbjct: 62  MPTGLQFGSGVRIVGTQKTFTEGNVETTDNAMNVAIMGQGFLQVQKANGDIAYTRDGNLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           +++ G L  + G  L P I +P     +     G + A+   +SD   +GQL + NF N 
Sbjct: 122 VNADGVLTISQGLPLQPEIDVPAGATNVAFGEDGTVTAILPGDSDVTELGQLTLVNFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG P    P + G   ++   LE SNVD V E+  MI+ QRAYE
Sbjct: 182 AGLSAEGDNLYLETAASGQPTEGVPGEDGLGTLQDNALEGSNVDIVNEMVAMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   I++
Sbjct: 242 MNAKMVSAADDMLQYISQ 259


>gi|283784086|ref|YP_003363951.1| lateral flagellar rod protein [Citrobacter rodentium ICC168]
 gi|282947540|emb|CBG87093.1| lateral flagellar rod protein [Citrobacter rodentium ICC168]
          Length = 261

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 100/258 (38%), Positives = 148/258 (57%), Gaps = 2/258 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+SAQ   +  IANNIAN+NTTG+KR R  F D  YQ ++  G  +      +
Sbjct: 4   ALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLFYQTQEAPG--AMLDQNNI 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+  GSGV+I   +  +T+G V  T N +++A++G+G+ QV+  +  + YTR G+  
Sbjct: 62  MPTGMQFGSGVRIVGTQKTFTEGNVETTDNAMNVAIMGQGFLQVQKANGDIAYTRDGNLQ 121

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I++ G L  + G  L P I +P     +     G + A+   +SD   +GQL + NF N 
Sbjct: 122 INADGVLTNSQGLPLQPEIDVPAGATSVAFGEDGTVTAILPGDSDPTELGQLTLVNFANP 181

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   GDNL   T+ SG P    P + G   ++   LE SNVD V E+  MI+ QRAYE
Sbjct: 182 AGLSAEGDNLYLETAASGQPTEGIPGEDGLGTLQGNALEGSNVDIVNEMVAMITVQRAYE 241

Query: 243 MNSKVIEAADEMSSLITK 260
           MN+K++ AAD+M   I++
Sbjct: 242 MNAKMVSAADDMLQFISQ 259


>gi|332140548|ref|YP_004426286.1| flagellar basal body rod protein FlgG [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550570|gb|AEA97288.1| flagellar basal body rod protein FlgG [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 262

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/259 (37%), Positives = 160/259 (61%), Gaps = 3/259 (1%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A  I+  G+ A QT++ +++NN+AN +T G+K+ RA F D LYQ     G   +S+    
Sbjct: 4   ALWISKTGLDAAQTDVAVVSNNLANASTVGFKKDRAVFEDLLYQNINQPG--GRSSADTE 61

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +GSG ++ + +  +TQG ++ T N LD+++ GRG+F++  PD T+ Y+R G F+
Sbjct: 62  LPSGLMLGSGSKVVATQKAHTQGNLLTTENALDMSIQGRGYFEILQPDGTIAYSRNGQFS 121

Query: 123 IDSKGQL-VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFIN 181
           ++ +GQ+  +  G  L P + IPE+ ++I +S+ G+I       ++ Q +GQL I++F+N
Sbjct: 122 LNDQGQIVTSGAGFLLQPEVAIPEDAQQITISQDGEISVSIRGQAEPQVLGQLNISDFVN 181

Query: 182 EAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAY 241
             GL+  G NL   T+ SG PI   P   G  ++ QG LE SNV+  +E+  +I +QR Y
Sbjct: 182 PTGLQPTGQNLFVETASSGAPIQGIPGLQGLGYISQGTLETSNVNVTEELVNLIESQRLY 241

Query: 242 EMNSKVIEAADEMSSLITK 260
           EMNSKVI + D+M   + +
Sbjct: 242 EMNSKVISSVDQMLGQVIQ 260


>gi|332994160|gb|AEF04215.1| flagellar basal body rod protein FlgG [Alteromonas sp. SN2]
          Length = 262

 Score =  214 bits (544), Expect = 1e-53,