RPSBLAST alignment for GI: 254780378 and conserved domain: TIGR01396

>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB. This model represents FlgB, one of several components of bacterial flagella that share a domain described by pfam model pfam00460. FlgB is part of the basal body. Length = 131
 Score = 38.9 bits (91), Expect = 0.001
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 2  KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAE 48
           AF +    +  +    E+IANNIAN++T GYK     F   L ++ 
Sbjct: 3  NAFGLLQQALDVRSLRQEVIANNIANVDTPGYKAKDVSFEAELKKSL 49