RPSBLAST alignment for GI: 254780378 and conserved domain: PRK06803

>gnl|CDD|180703 PRK06803, flgE, flagellar hook protein FlgE; Validated. Length = 402
 Score = 76.3 bits (188), Expect = 8e-15
 Identities = 47/136 (34%), Positives = 66/136 (48%), Gaps = 22/136 (16%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +F IA +G++A    L  I+NNIAN +T G+K +R EF+      +   G          
Sbjct: 2   SFNIALSGLNATTQQLNTISNNIANSSTKGFKGSRTEFSSIYNGGQ--PG---------- 49

Query: 63  VPEGISIGSGVQISSV-RNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
                    GV++SSV +N    G + +TG  LDLA+ G G+F ++  D    YTRAG F
Sbjct: 50  ---------GVEVSSVSQNFSKDGSLTYTGRGLDLAISGGGFFVLKESDGDTAYTRAGMF 100

Query: 122 NIDSKGQLVTADGNTL 137
             D  G L    G  L
Sbjct: 101 RSDVDGYLTDPQGMKL 116