RPSBLAST alignment for GI: 254780378 and conserved domain: PRK06945

>gnl|CDD|180769 PRK06945, flgK, flagellar hook-associated protein FlgK; Validated. Length = 651
 Score = 37.3 bits (87), Expect = 0.004
 Identities = 20/81 (24%), Positives = 31/81 (38%), Gaps = 16/81 (19%)

Query: 4  FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
            I  +G++A Q  L    +NI+N  T GY R R                  Q+      
Sbjct: 5  LNIGLSGLNAAQWGLTTTGHNISNAATPGYSRQR----------------VVQAEAGGQY 48

Query: 64 PEGISIGSGVQISSVRNVYTQ 84
               +G GV + +V+  Y+Q
Sbjct: 49 TGSGYLGQGVNVVTVKRQYSQ 69