RPSBLAST alignment for GI: 254780378 and conserved domain: PRK08147

>gnl|CDD|181252 PRK08147, flgK, flagellar hook-associated protein FlgK; Validated. Length = 547
 Score = 38.5 bits (90), Expect = 0.002
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPE 65
           A +G++A Q  L  ++NNI+N N  GY R     A         AGS   +        
Sbjct: 7  TAMSGLNAAQAALNTVSNNISNYNVAGYTRQTTILAQ--------AGSTLTAGG------ 52

Query: 66 GISIGSGVQISSVRNVYTQ 84
             IG+GV +S V+  Y  
Sbjct: 53 --WIGNGVYVSGVQREYDA 69