RPSBLAST alignment for GI: 254780378 and conserved domain: PRK08471

>gnl|CDD|181438 PRK08471, flgK, flagellar hook-associated protein FlgK; Validated. Length = 613
 Score = 37.3 bits (87), Expect = 0.003
 Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 16/73 (21%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPE 65
              G+ A Q  ++   NNI+N ++  Y R R                  QSA  A+   
Sbjct: 10 TGYTGLQAAQVMVDTTGNNISNASSEFYTRQRV----------------VQSAQAALNTG 53

Query: 66 GISIGSGVQISSV 78
          G ++G+G  I ++
Sbjct: 54 GGNVGTGTDIETI 66