RPSBLAST alignment for GI: 254780378 and conserved domain: PRK12632

>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional. Length = 130
 Score = 44.4 bits (105), Expect = 3e-05
 Identities = 19/39 (48%), Positives = 27/39 (69%)

Query: 218 GYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSS 256
           GY + SNVD V EI++   AQR+YE N ++ + A +MSS
Sbjct: 84  GYYDGSNVDLVVEIADAREAQRSYEANLRMFDQARQMSS 122