RPSBLAST alignment for GI: 254780378 and conserved domain: PRK12637

>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional. Length = 473
 Score = 72.1 bits (176), Expect = 1e-13
 Identities = 48/137 (35%), Positives = 72/137 (52%), Gaps = 5/137 (3%)

Query: 130 VTADGNTLVPGIV----IPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGL 185
           VT  G+   P +V       E   + V + G ++A    N + Q +G L++ANF N  GL
Sbjct: 338 VTQYGSDFAPKVVQNGYSSGEFMGLSVGKDGSLVA-KYTNGETQTIGTLVLANFNNVQGL 396

Query: 186 RNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNS 245
           + +G+N    TS SG   +  P   G A +    LEASNVD  +E+  MI AQR Y+ N+
Sbjct: 397 QPVGNNAWVETSESGQATLGQPGTNGLATIAGQALEASNVDMSRELVNMIVAQRTYQANA 456

Query: 246 KVIEAADEMSSLITKMR 262
           + I+  DE+  ++  MR
Sbjct: 457 QTIKTQDEVMQVLMNMR 473