RPSBLAST alignment for GI: 254780378 and conserved domain: PRK12817

>gnl|CDD|183767 PRK12817, flgG, flagellar basal body rod protein FlgG; Reviewed. Length = 260
 Score =  179 bits (456), Expect = 7e-46
 Identities = 104/274 (37%), Positives = 147/274 (53%), Gaps = 28/274 (10%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++AF  + +GM+AQQ  L+ I+NN+AN+NTTGYKR    F+D +Y+     G P+    +
Sbjct: 2   LRAFWNSKSGMNAQQEKLDSISNNLANVNTTGYKREDVSFSDLVYETLDRKGYPTNDKPE 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
                 I  G+GV+ ++      QG ++ TGN  DLA+ G G+F+V   D T  YTRAG+
Sbjct: 62  ------IITGTGVKATNWIRDNQQGNLLTTGNKTDLAIDGEGFFRVIMADGTYAYTRAGN 115

Query: 121 FNIDSKGQLVTADGNTL----------VPGIVIPEETREIKVSRSGQILAVTGKNSDFQP 170
           FNIDS G LV  +GN L                  ++    V   G I   + KN D Q 
Sbjct: 116 FNIDSNGMLVDDNGNRLEIQLEAGVGINNRNT-GFDSNNFTVDEDGGI---SVKNVDGQN 171

Query: 171 --VGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAV 228
             VG++ I N +      +IGDNL       G  +  N D      + QGYLE SNVD  
Sbjct: 172 KKVGKINIYNAVGNDAFISIGDNLY--VPSDGVQVFLNND----VDILQGYLENSNVDLG 225

Query: 229 KEISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           KE+++MI  QRA++++SK I+ ADEM  +I  MR
Sbjct: 226 KEMTDMIITQRAFQLSSKGIKTADEMWGIINNMR 259