RPSBLAST alignment for GI: 254780378 and conserved domain: COG4786

>gnl|CDD|34397 COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion]. Length = 265
 Score =  268 bits (686), Expect = 1e-72
 Identities = 122/266 (45%), Positives = 172/266 (64%), Gaps = 7/266 (2%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++    AA+GM AQQ  L++I+NN+AN+NTTG+KR RAEF D LYQ    AG+P+ ++  
Sbjct: 2   LRGLYTAASGMMAQQRKLDVISNNLANVNTTGFKRDRAEFEDLLYQTINTAGAPNSNST- 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
              P G  +G GV+++    V+TQG +  T N LDLA+ G G+FQ++TPD T+ YTR GS
Sbjct: 61  -TSPSGGQVGLGVRVNETYTVFTQGSLQKTDNPLDLAITGDGFFQIQTPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVP----GIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLI 176
           F +D +GQLVT++G  ++      I IP     I + + G +      N+D   VGQ+ +
Sbjct: 120 FTVDEEGQLVTSNGYPVLDSGGNPITIPNNAGSITIGKDGTVSVTIRGNTDPVQVGQIGL 179

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
            NF N AGL+ IG+NL   T+ SG PI+  P D GF  ++QG+LEASNV+ V+E+++MI 
Sbjct: 180 VNFDNPAGLKKIGNNLYQETAASG-PIVGVPGDNGFGAIRQGFLEASNVNVVEEMTDMIE 238

Query: 237 AQRAYEMNSKVIEAADEMSSLITKMR 262
           AQRAYE NSKVI+ ADEM      + 
Sbjct: 239 AQRAYEANSKVIQTADEMLGKANNLL 264