RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780378|ref|YP_003064791.1| flagellar basal body rod
protein FlgG [Candidatus Liberibacter asiaticus str. psy62]
         (262 letters)



>gnl|CDD|183686 PRK12691, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 262

 Score =  370 bits (953), Expect = e-103
 Identities = 138/262 (52%), Positives = 186/262 (70%), Gaps = 1/262 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GM+AQQ N+E+I+NNIAN+NTTG+KR RAEF D LYQ E+  G+ S S + 
Sbjct: 1   MRALSIAATGMAAQQLNVEVISNNIANMNTTGFKRQRAEFQDLLYQQERRVGAQS-SDNG 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            +VP G+ +G GV+ ++VR ++TQG +  TGN+LDLA+ GRG+FQ++ PD    YTRAG+
Sbjct: 60  TIVPTGVQLGLGVKTAAVRRIHTQGTLSQTGNDLDLAIQGRGYFQIQLPDGETAYTRAGA 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN  + GQ+VT+DG  + PGI IP++   I ++ SGQ+ A     +  Q +GQ+ +A F 
Sbjct: 120 FNRSADGQIVTSDGYPVQPGITIPQDATSITINASGQVSATLDGQTQPQLLGQITLARFT 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NEAGL  IGDNL   T  SG P +  P + GF  ++QGYLEASNVD VKEI+++I+AQRA
Sbjct: 180 NEAGLEAIGDNLFRETPASGAPQVGVPGEDGFGTIRQGYLEASNVDVVKEITDLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKMR 262
           YEMNSKVI AADEM    ++  
Sbjct: 240 YEMNSKVITAADEMLQTTSQNL 261


>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG,
           Gram-negative bacteria.  This family consists of the
           FlgG protein of the flagellar apparatus in the
           Proteobacteria and spirochetes.
          Length = 259

 Score =  327 bits (839), Expect = 3e-90
 Identities = 125/260 (48%), Positives = 181/260 (69%), Gaps = 1/260 (0%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           A   AA GM+AQQTN+++I+NN+AN+NTTG+K+ RAEF D LYQ E+  G+ S S  + +
Sbjct: 1   ALWTAATGMNAQQTNMDVISNNLANVNTTGFKKDRAEFEDLLYQTERQPGAQS-SEQQTI 59

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
           +P G+ +G GV++ + + ++TQG + +TGN+LDLA+ G G+FQV  PD T  YTR G+F 
Sbjct: 60  LPVGVQVGLGVRVVATQKLFTQGSLQNTGNDLDLAIEGEGFFQVLMPDGTTAYTRDGAFK 119

Query: 123 IDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           I+++GQLVT++G  L P I IPE    I V   G++    G  ++ Q VGQ+ +A FIN 
Sbjct: 120 INAEGQLVTSNGYPLQPEITIPENATSITVGSDGEVSVRQGGQTEPQEVGQITLATFINP 179

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL  +G+NL   T  SG P I  P   GF  ++QG+LEASNV+ V+E+ +MI+AQRAYE
Sbjct: 180 AGLEAVGENLFRETPASGPPQIGTPGLDGFGKLRQGFLEASNVNVVQEMVDMITAQRAYE 239

Query: 243 MNSKVIEAADEMSSLITKMR 262
           MNSK I+A+D+M   ++++ 
Sbjct: 240 MNSKAIQASDQMLQTVSQLL 259


>gnl|CDD|139158 PRK12692, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 262

 Score =  318 bits (817), Expect = 8e-88
 Identities = 142/260 (54%), Positives = 192/260 (73%), Gaps = 1/260 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M+A  IAA GMSAQQ NLE+IANNIAN+NTTG+K ARAEF D LYQAE+  G P+Q+  +
Sbjct: 1   MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQE 60

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
           AV PEG  +G GV+ +++RN++ QG +  TGN LDLA+ GRG+FQV +P+  + YTRAGS
Sbjct: 61  AV-PEGAMLGLGVRAAAIRNLHRQGSLAQTGNQLDLAVNGRGYFQVTSPNGEIQYTRAGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           FN ++ GQLVT +G  + P I+IP+ T ++ ++ SGQ+ A        Q +GQL +ANF 
Sbjct: 120 FNKNAAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAKIDGQVAPQNLGQLTLANFA 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           NE+GL  +G+ L   T  SG P++ NP D+GF  ++QGYLE SNVD VKEI+ +I+AQRA
Sbjct: 180 NESGLEPLGNGLYRETPASGAPVVGNPGDVGFGKIQQGYLEGSNVDPVKEITSLITAQRA 239

Query: 241 YEMNSKVIEAADEMSSLITK 260
           +EMNSKVI+AADEM+  ++K
Sbjct: 240 FEMNSKVIQAADEMAGTVSK 259


>gnl|CDD|183687 PRK12693, flgG, flagellar basal body rod protein FlgG; Provisional.
          Length = 261

 Score =  302 bits (775), Expect = 8e-83
 Identities = 116/259 (44%), Positives = 167/259 (64%), Gaps = 2/259 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++A  IA  G+ AQQTN+++I+NN+AN+NTTG+K++RA F D LYQ  +  G+ S     
Sbjct: 2   IRALWIAKTGLDAQQTNIDVISNNLANVNTTGFKKSRAVFEDLLYQTIRQPGAQSSQNTT 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  + + ++TQG +  TGN+LD+A+ G+G+FQV+ PD T+ YTR GS
Sbjct: 62  --LPSGLQVGTGVRPVATQKIFTQGNLQQTGNSLDVAIEGQGFFQVQLPDGTIAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F +D  GQLVT+ G  L P I IPE    I +   G +       +  Q VGQ+ + +FI
Sbjct: 120 FKLDQDGQLVTSGGYPLQPEITIPENATSITIGTDGTVSVTQAGQAAPQVVGQITLTDFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL +IG+NL   T+ SG PI   P   G   ++QG+LE SNV+ V+E+  MI+ QRA
Sbjct: 180 NPAGLESIGENLYLETAASGAPIEGTPGLNGLGTLRQGFLETSNVNVVEELVNMITGQRA 239

Query: 241 YEMNSKVIEAADEMSSLIT 259
           YEMNSK I  AD+M   + 
Sbjct: 240 YEMNSKAISTADQMLQYVN 258


>gnl|CDD|183688 PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 260

 Score =  268 bits (687), Expect = 1e-72
 Identities = 110/261 (42%), Positives = 168/261 (64%), Gaps = 2/261 (0%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
            ++  IA  G++AQQ  +++I+NN+AN++T G+KR+RA F D LYQ  +  G+  QS  +
Sbjct: 2   NRSLWIAKTGLNAQQAQMDVISNNLANVSTNGFKRSRAVFEDLLYQTIRQPGA--QSTQQ 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
             +P G+ +G+GV+  +   ++TQG +  TGN+ D+A+ G+G+FQV  PD T  YTR GS
Sbjct: 60  TELPSGLQLGTGVRQVATERLFTQGNLQQTGNSKDVAINGQGFFQVLMPDGTTAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFI 180
           F  +++GQLVT+ G  L P I IP+    + + + G +      +S+   +GQL +A FI
Sbjct: 120 FQTNAQGQLVTSSGYPLQPAITIPQNATSLTIGKDGTVSVTQPGSSNAVQIGQLQLATFI 179

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRA 240
           N AGL+  G+NL A T+ SG P +S P   G   + QGY+EASNV+ V+E+  MI  QRA
Sbjct: 180 NPAGLQAKGENLFAETTSSGAPNVSQPGLNGAGTLNQGYVEASNVNVVEELVNMIQTQRA 239

Query: 241 YEMNSKVIEAADEMSSLITKM 261
           YE+NSK +  +D+M   +T+M
Sbjct: 240 YEINSKAVTTSDQMLQRLTQM 260


>gnl|CDD|183766 PRK12816, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 264

 Score =  247 bits (633), Expect = 2e-66
 Identities = 116/256 (45%), Positives = 166/256 (64%), Gaps = 4/256 (1%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++   AA+GM+AQQ N++ IANN+AN+NTTG+K+ RAEF D +YQ ++ AG+P+     
Sbjct: 2   MRSLWTAASGMNAQQFNIDTIANNLANVNTTGFKKIRAEFEDLIYQTQRRAGTPATE--D 59

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
            V P G+ +G GV++++ + ++ QG +  TGN LD+A+ G G+F++  PD T  YTR GS
Sbjct: 60  TVTPLGVQVGHGVKVAATQRLFEQGSLQATGNKLDVAIEGEGFFKILMPDGTYAYTRDGS 119

Query: 121 FNIDSKGQLVTADGNTLVPGIVIPEETRE--IKVSRSGQILAVTGKNSDFQPVGQLLIAN 178
           F ID+ GQLVT++G  L+P I+ PE      I +S  G +    G+++D   +GQ+ +  
Sbjct: 120 FKIDANGQLVTSNGYRLLPEIIFPENYILNSITISEEGIVSVKVGEDNDPIELGQIELYR 179

Query: 179 FINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQ 238
           F+N AGL  IG NL   T  SG  I   P   GF  V QG+LE SNV  V+E+  MI AQ
Sbjct: 180 FVNPAGLSAIGKNLFKETIASGQEIPGIPGSEGFGRVLQGFLEMSNVSIVEEMVTMIVAQ 239

Query: 239 RAYEMNSKVIEAADEM 254
           RAYE+NSK I+ +D M
Sbjct: 240 RAYEINSKAIQTSDNM 255


>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins.  This
           model encompasses three closely related flagellar
           proteins usually denoted FlgE, FlgF and FlgG. The names
           have often been mis-assigned, however. Three equivalog
           models, TIGR02489, TIGR02490 and TIGR00488,
           respectively, separate the individual forms into three
           genome-context consistent groups. The major differences
           between these genes are architectural, with variable
           central sections between relatively conserved N- and
           C-terminal domains. More distantly related are two other
           flagellar apparatus familis, FlgC (TIGR01395) which
           consists of little else but the N-and C-terminal domains
           and FlgK (TIGR02492) with a substantial but different
           central domain.
          Length = 231

 Score =  240 bits (615), Expect = 3e-64
 Identities = 98/248 (39%), Positives = 139/248 (56%), Gaps = 22/248 (8%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            A   A +G++AQ + L++IANNIAN+NTTG+KR+RAEF D L Q+   +G         
Sbjct: 1   MALYTALSGLNAQSSALDVIANNIANVNTTGFKRSRAEFQDLLSQSGSGSGQ-------- 52

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
                  +G GV+ S V   ++QG +  TGN+LDLA+ G G+F V+ PD T  YTRAG+F
Sbjct: 53  -------VGGGVRASGVAQDFSQGNLQPTGNSLDLAISGDGFFVVQGPDGT-AYTRAGNF 104

Query: 122 NIDSKGQLVTADGNTLVPG-----IVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLI 176
            +D+ G LV  DG  L+       + +P +   + +   G + A    N     +GQ+ +
Sbjct: 105 QLDADGYLVNPDGYYLLAWTGSGPVTVPPDGASVSIGSDGTVSATYS-NGQTVTLGQIAL 163

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
           ANF N  GLR  G NL + T  SG  ++      GF  ++ G LE+SNVD   E+  MI 
Sbjct: 164 ANFPNPDGLRKEGGNLYSATRDSGAALVGAAGTGGFGSIQSGALESSNVDLAAELVNMIV 223

Query: 237 AQRAYEMN 244
           AQRAY+ N
Sbjct: 224 AQRAYQAN 231


>gnl|CDD|183640 PRK12636, flgG, flagellar basal body rod protein FlgG; Provisional.
          Length = 263

 Score =  181 bits (462), Expect = 1e-46
 Identities = 92/249 (36%), Positives = 140/249 (56%), Gaps = 9/249 (3%)

Query: 10  GMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISI 69
           GM   QT L++I NNIAN+NT G+K++R  F D + Q   ++G+   +A++  V     +
Sbjct: 11  GMKNFQTKLDVIGNNIANVNTYGFKKSRVTFKDMVSQ--TISGASGPTANRGGV-NSKQV 67

Query: 70  GSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQL 129
           G G Q+ ++  ++TQG +  TG  LDLA+ G G+F+V   D    YTRAG+F +D++G +
Sbjct: 68  GLGSQLGAIDTIHTQGSLQTTGRPLDLAISGDGFFRVGDGD-NTAYTRAGNFYLDNEGNI 126

Query: 130 VTADGNTLV----PGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGL 185
           V ADG  L+      I IP + +   +   G + +      + Q  GQ+ +A F N  GL
Sbjct: 127 VNADGLYLLGMNGGRIQIPTDAQSFSIGADGTV-SYVDAGGELQTAGQIGLATFANPDGL 185

Query: 186 RNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNS 245
              GDNL   T  SG P    P + G   +  G LE SNVD  +E +EMI AQR ++ N+
Sbjct: 186 EKAGDNLYRETLNSGTPSAVVPGEGGTGKIVSGALEMSNVDLAEEFTEMIVAQRGFQANT 245

Query: 246 KVIEAADEM 254
           ++I  +DE+
Sbjct: 246 RIITTSDEI 254


>gnl|CDD|183767 PRK12817, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 260

 Score =  179 bits (456), Expect = 7e-46
 Identities = 104/274 (37%), Positives = 147/274 (53%), Gaps = 28/274 (10%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           ++AF  + +GM+AQQ  L+ I+NN+AN+NTTGYKR    F+D +Y+     G P+    +
Sbjct: 2   LRAFWNSKSGMNAQQEKLDSISNNLANVNTTGYKREDVSFSDLVYETLDRKGYPTNDKPE 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGS 120
                 I  G+GV+ ++      QG ++ TGN  DLA+ G G+F+V   D T  YTRAG+
Sbjct: 62  ------IITGTGVKATNWIRDNQQGNLLTTGNKTDLAIDGEGFFRVIMADGTYAYTRAGN 115

Query: 121 FNIDSKGQLVTADGNTL----------VPGIVIPEETREIKVSRSGQILAVTGKNSDFQP 170
           FNIDS G LV  +GN L                  ++    V   G I   + KN D Q 
Sbjct: 116 FNIDSNGMLVDDNGNRLEIQLEAGVGINNRNT-GFDSNNFTVDEDGGI---SVKNVDGQN 171

Query: 171 --VGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAV 228
             VG++ I N +      +IGDNL       G  +  N D      + QGYLE SNVD  
Sbjct: 172 KKVGKINIYNAVGNDAFISIGDNLY--VPSDGVQVFLNND----VDILQGYLENSNVDLG 225

Query: 229 KEISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           KE+++MI  QRA++++SK I+ ADEM  +I  MR
Sbjct: 226 KEMTDMIITQRAFQLSSKGIKTADEMWGIINNMR 259


>gnl|CDD|183685 PRK12690, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 238

 Score =  142 bits (359), Expect = 1e-34
 Identities = 81/251 (32%), Positives = 121/251 (48%), Gaps = 38/251 (15%)

Query: 18  LEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQISS 77
           ++++ANNIAN +TTG++R    F++++    K   S   S         +S+       S
Sbjct: 19  MQVVANNIANASTTGFRREGLVFSEYV----KSLDSGEAS---------LSMARA----S 61

Query: 78  VRNV-YTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNT 136
            R     QG +  TG   D A+ G G+F VETP    + TRAGSF  +++G+LV  DGN 
Sbjct: 62  GRQTDLEQGGLTQTGGQFDFAIEGEGFFMVETPQGERL-TRAGSFTPNAEGELVDPDGNR 120

Query: 137 LVPG----IVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNL 192
           L+      I IP + R + V   G + A      D QP+GQ+ +    +  GLR  G   
Sbjct: 121 LLDAGGAPIFIPPDARSVAVGADGTLSA------DGQPLGQIGLYQPTDPLGLRREGGTR 174

Query: 193 LARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAAD 252
               +  G            A + QG+LE SNV+ V EI+ MI  QRAYE+    ++  D
Sbjct: 175 FR--AEGGVEPAEG------ARLLQGFLEGSNVNPVSEIARMIEVQRAYELGQSFLDRED 226

Query: 253 E-MSSLITKMR 262
           E + + I  + 
Sbjct: 227 ERIRTTIRTLG 237


>gnl|CDD|183684 PRK12689, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 253

 Score =  132 bits (335), Expect = 6e-32
 Identities = 78/252 (30%), Positives = 119/252 (47%), Gaps = 26/252 (10%)

Query: 10  GMSAQQT---NLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEG 66
           G+S Q      L+++ANN+AN+NT G+K   + F ++L         P    D    P+ 
Sbjct: 8   GLSRQMALERQLDVVANNVANVNTNGFKARSSLFQEYL--------MPGAHEDNFQRPD- 58

Query: 67  ISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSK 126
               S VQ        +QG +  T N LD+A+ G  +  V+TP     YTR G+  I+++
Sbjct: 59  -RRVSYVQDRGTPLDLSQGPLEQTKNPLDVAIDGDAFLAVQTPQGE-RYTRDGALEINAQ 116

Query: 127 GQLVTADGNTLVPG----IVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           GQLVT+DG   V G    I        I +S  G +    G  +     G+L +  F N 
Sbjct: 117 GQLVTSDGY-PVLGTGGPITFQPTDTGIAISPDGTVSVNEGTATTDSIRGKLRLVTFANP 175

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
             L+  G NL A T+ +       P D   A V+QGY+E SNV+ V E++ M+   R Y 
Sbjct: 176 QALKKEGANLYAATAPAR------PADTK-ARVEQGYIERSNVNPVLEMTRMMEVNRTYT 228

Query: 243 MNSKVIEAADEM 254
             S +++   ++
Sbjct: 229 QVSSMLQQQSDL 240


>gnl|CDD|180198 PRK05682, flgE, flagellar hook protein FlgE; Validated.
          Length = 407

 Score =  128 bits (325), Expect = 1e-30
 Identities = 53/136 (38%), Positives = 76/136 (55%), Gaps = 15/136 (11%)

Query: 2   KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKA 61
            +F  A +G++A    L++I NNIAN NTTG+K +RAEFAD    +     +        
Sbjct: 1   MSFNTAVSGLNAASNRLDVIGNNIANANTTGFKSSRAEFADLYANSAGTNPT-------- 52

Query: 62  VVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
                  +GSGV+++ V   ++QG +  TGN+LDLA+ G G+F V +      YTRAG+F
Sbjct: 53  ------QVGSGVKVAGVAQQFSQGSITSTGNSLDLAISGNGFFVV-SNGGNGFYTRAGAF 105

Query: 122 NIDSKGQLVTADGNTL 137
            +D  G LV A G  L
Sbjct: 106 KLDKNGYLVNAAGYYL 121



 Score = 88.7 bits (221), Expect = 1e-18
 Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 12/137 (8%)

Query: 118 AGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
           A  F + +     T DG    PG +         +   G + AV   N   +P+GQ+ +A
Sbjct: 275 ASGFTVSA----TTQDGYA--PGTL-----TGYSIDDDGTVTAVY-SNGQTKPLGQIALA 322

Query: 178 NFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISA 237
           NF N  GL  +G N+ + T+ SG  +I      GF  ++ G LE+SNVD   E+  MI A
Sbjct: 323 NFANPDGLTKVGGNVWSATAASGVALIGTAGSGGFGTIQSGALESSNVDLSTELVNMIVA 382

Query: 238 QRAYEMNSKVIEAADEM 254
           QR Y+ N+K I+  D++
Sbjct: 383 QRNYQANAKTIKTQDQL 399


>gnl|CDD|183768 PRK12818, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 256

 Score =  128 bits (323), Expect = 2e-30
 Identities = 80/259 (30%), Positives = 123/259 (47%), Gaps = 22/259 (8%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKR---ARAEFADFLYQA-EKVAGSPSQ 56
           ++    A +GM   +   ++I NN+AN+NT GYK    A   F D L +  +K  G+ + 
Sbjct: 2   IRGLYTAVSGMITLEAKQDVITNNLANVNTVGYKSDNLAFKSFEDVLIENYDKKVGNKNV 61

Query: 57  SADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYT 116
                       +  G +I  V  ++TQG +  T    D A+ GRG+F VE       YT
Sbjct: 62  KNIIG------GLSMGSKIDEVNTLFTQGIIKSTDKPTDFAIQGRGFFTVERNAGNNYYT 115

Query: 117 RAGSFNIDSKGQLVTADGNTLVPGIVIPEETRE-IKVSRSGQILAVTGK-NSDFQPVGQL 174
           R G F++D++G LV   G   V G       RE I V          G  + D     + 
Sbjct: 116 RDGHFHVDTQGYLVNDSGYY-VLGRNNATGAREPINVGNGKFSTDADGNISLDGNASYKF 174

Query: 175 LIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEM 234
            +A+F +   L+ IGDNL      +G+    NP +I  A V+Q  LE SNV+   E+  M
Sbjct: 175 NVADFNDYNSLKKIGDNLY-----TGN----NPQNINGAIVRQNSLEKSNVNVTNEMVNM 225

Query: 235 ISAQRAYEMNSKVIEAADE 253
           ++  R++E N K++++ DE
Sbjct: 226 MTTMRSFETNQKIVQSIDE 244


>gnl|CDD|183642 PRK12640, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 246

 Score =  121 bits (306), Expect = 2e-28
 Identities = 84/259 (32%), Positives = 124/259 (47%), Gaps = 44/259 (16%)

Query: 7   AAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKV----AGSPSQSADKAV 62
           A+  ++ Q     ++ANN+AN +T G++         L QA  V     G P++    A 
Sbjct: 12  ASQNLNQQA----VVANNLANASTPGFRAD-------LAQARAVPVFGEGLPTRVFALAS 60

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
            P       G         ++ G +  TG  LD+AL G GW  V+ PD +  YTR GS  
Sbjct: 61  TP-------GAD-------FSPGPLQTTGRPLDVALQGDGWLAVQAPDGSEAYTRNGSLQ 106

Query: 123 IDSKGQLVTADGNTLVPG----IVIPEETREIKVSRSGQILAVT-GKNSD-FQPVGQLLI 176
           +D+ GQL TA+G   V G    I +P    +I +   G I A+  G   +    VG+L +
Sbjct: 107 VDANGQLRTANGL-PVLGDGGPIAVPPG-AKITIGADGTISALPPGDPPNAVAEVGRLKL 164

Query: 177 ANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMIS 236
            N       R  GD+ L RT+  G P  ++P       V  G LE SNV+AV+E+  MI+
Sbjct: 165 VNPPAAQLTR--GDDGLFRTT-DGAPAPADP----TVRVMSGALEGSNVNAVEEMVSMIA 217

Query: 237 AQRAYEMNSKVIEAADEMS 255
             R +EM  K+++ ADE +
Sbjct: 218 LARQFEMQVKMMKTADENA 236


>gnl|CDD|183643 PRK12642, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 241

 Score =  108 bits (271), Expect = 2e-24
 Identities = 73/247 (29%), Positives = 108/247 (43%), Gaps = 37/247 (14%)

Query: 10  GMSAQQT---NLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEG 66
            +S+Q      L+ IA+N+AN+NT G++    +F   +        S + S   A V +G
Sbjct: 8   ALSSQMALEKRLDTIADNVANVNTVGFRATEVKFDTVV--------SDTASKKVAFVSQG 59

Query: 67  ISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSK 126
            S  S             G +  TGN LD A+ G  WF  +TP   V YTR G F + S 
Sbjct: 60  KSYLST----------EAGPLTKTGNPLDFAVKGDAWFSFDTPAGQV-YTRDGRFTMTST 108

Query: 127 GQLVTADGN-TLVPG---IVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINE 182
           G+LV+  G   L  G   I +     E  +   G I        +   VG + +     +
Sbjct: 109 GELVSVTGYPVLDAGGAPIQLNPGGGEPTIGADGAI------YQNGVQVGAIGLFEIDAD 162

Query: 183 AGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
           AGL   G N          P++          V QGYLE SNV+A+ E++++IS  RA+E
Sbjct: 163 AGLLRYG-NSGVIPDKPPQPVVDRNSV----GVVQGYLEGSNVNAMTEMTQLISVSRAFE 217

Query: 243 MNSKVIE 249
             S ++ 
Sbjct: 218 SVSSLMR 224


>gnl|CDD|181421 PRK08425, flgE, flagellar hook protein FlgE; Validated.
          Length = 731

 Score = 99.4 bits (248), Expect = 8e-22
 Identities = 56/157 (35%), Positives = 83/157 (52%), Gaps = 7/157 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           M++     +G+ A Q  +++  NNIAN+NTTG+K +RA F D L Q + +A +P      
Sbjct: 2   MRSLWSGVSGLQAHQIAMDVEGNNIANVNTTGFKYSRASFVDMLSQTKLIATAPK---GG 58

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPD--KTVMYTRA 118
                 + IG GV +SS   +++QG + +T  N DLA+ G G+F V +PD   T  YTR 
Sbjct: 59  LGGQNDMQIGLGVGVSSTTKIFSQGSIQNTDKNTDLAIQGDGFFIV-SPDGGTTRNYTRD 117

Query: 119 GSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRS 155
           G F  D++G  V   G   V G V   +T  I  +  
Sbjct: 118 GDFKFDAQGNFVNNGGYV-VQGWVSDTDTGTIDSTGP 153



 Score = 67.8 bits (166), Expect = 3e-12
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 148 REIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNP 207
            +I+    G IL        F  + Q+ +ANF N AGL+  G N+ ++T+ SG  +I   
Sbjct: 617 MDIRFDSDGTILGAFTNGRTFA-LAQVALANFANNAGLQAEGGNVFSQTANSGQAVIGAA 675

Query: 208 DDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
              G   +    LE SNVD  + ++++I  QR ++ NSK I  +D+M
Sbjct: 676 GTGGRGSISGSKLEMSNVDLSRSLTQLIVIQRGFQANSKTITTSDQM 722


>gnl|CDD|131542 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, epsilon
           proteobacterial.  Members of this family are flagellar
           hook proteins, designated FlgE, as found in the epsilon
           subdivision of the Proteobacteria (Helicobacter,
           Wolinella, and Campylobacter). These proteins differ
           significantly in architecture from proteins designated
           FlgE in other lineages; the N-terminal and C-terminal
           domains are homologous, but members of this family only
           contain a large central domain that is surface-exposed
           and variable between strains.
          Length = 719

 Score = 92.3 bits (229), Expect = 1e-19
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 7/151 (4%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
           +++     +GM A Q  L++  NNIAN+NTTG+K +RA+F D L Q  K+A SP      
Sbjct: 2   LRSLWSGVSGMQAHQVALDVEGNNIANVNTTGFKYSRADFGDMLSQTVKIATSPYDGLGG 61

Query: 61  AVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDK--TVMYTRA 118
                 +SIG GV ISS   +++QG V  T +  D+A+ G G+F V + D   T  YTR 
Sbjct: 62  Q---NDLSIGLGVSISSTTKIFSQGSVQTTNSKTDVAINGDGFFIV-SDDGGLTNYYTRD 117

Query: 119 GSFNIDSKGQLVTADGNTLVPGIVIPEETRE 149
           G+F  D+ G  V   G  +V G   P E  E
Sbjct: 118 GAFKFDAYGNFVNNSG-YIVQGWNRPLEAAE 147



 Score = 65.4 bits (159), Expect = 1e-11
 Identities = 31/107 (28%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 148 REIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNP 207
           ++I+   +G +L        F  + Q+ +A+F N +GL+  G NL ++T+ SG+P++   
Sbjct: 605 KDIRFDSNGNLLGEFSNGKTFA-LAQVAMASFANNSGLQAEGGNLFSQTANSGEPVVGEA 663

Query: 208 DDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
              G   +    LE SNVD  + ++++I  QR ++ NSK +  +D++
Sbjct: 664 GTGGRGEMSTSALEMSNVDLSRSLTQLIVVQRGFQANSKTVTTSDQI 710


>gnl|CDD|105809 PRK12641, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 252

 Score = 80.0 bits (197), Expect = 6e-16
 Identities = 72/270 (26%), Positives = 114/270 (42%), Gaps = 56/270 (20%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
             MIAA  +  +Q    IIANN+ANI+TTG+K        F+   +        ++DK +
Sbjct: 7   KSMIAANKLLEKQA---IIANNLANISTTGFK------EKFILAIQNHNVKNLYNSDKKI 57

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFN 122
             E              N+   G + +TG NLDL +   GW  ++  +    YT+ G   
Sbjct: 58  TKE------------YYNLS-PGTLRYTGRNLDLFIKDNGWLTIKDTNGQEAYTKNGHLK 104

Query: 123 IDSKGQL-------VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDF--QPVGQ 173
           I+SK +L       +  +GN ++P  +       +K+S +G I ++   +       +G 
Sbjct: 105 INSKRKLTVQNNEVIGNNGNIIIPKNIN------LKISSNGVITSIKNNHKHIVETKIGS 158

Query: 174 LLIANF------INEAGL----RNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEAS 223
           L +           E GL    +N   N     ++     I          V+ G LE S
Sbjct: 159 LKLVQLPSQDLIQKENGLFYLKKNNEINKKHTKNIKHSSKI---------RVQSGMLEES 209

Query: 224 NVDAVKEISEMISAQRAYEMNSKVIEAADE 253
           NV+A K + EMIS  R +EM  K+I   D+
Sbjct: 210 NVNASKNMIEMISNARQFEMQMKIISMCDQ 239


>gnl|CDD|180703 PRK06803, flgE, flagellar hook protein FlgE; Validated.
          Length = 402

 Score = 76.3 bits (188), Expect = 8e-15
 Identities = 47/136 (34%), Positives = 66/136 (48%), Gaps = 22/136 (16%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
           +F IA +G++A    L  I+NNIAN +T G+K +R EF+      +   G          
Sbjct: 2   SFNIALSGLNATTQQLNTISNNIANSSTKGFKGSRTEFSSIYNGGQ--PG---------- 49

Query: 63  VPEGISIGSGVQISSV-RNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSF 121
                    GV++SSV +N    G + +TG  LDLA+ G G+F ++  D    YTRAG F
Sbjct: 50  ---------GVEVSSVSQNFSKDGSLTYTGRGLDLAISGGGFFVLKESDGDTAYTRAGMF 100

Query: 122 NIDSKGQLVTADGNTL 137
             D  G L    G  L
Sbjct: 101 RSDVDGYLTDPQGMKL 116



 Score = 64.8 bits (158), Expect = 2e-11
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 150 IKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDD 209
           +++  +G + A T  N   Q  GQ+++ANF N  GL  + +   + ++ SG PI+  P  
Sbjct: 291 VRIEDNGMVYA-TYTNGQRQLQGQVVLANFANPNGLVTVSNTAWSASNKSGAPILGTPGT 349

Query: 210 IGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
                +  G LE SNVD   E+  +++AQR Y+ N+KVI   D M
Sbjct: 350 GTLGSLTSGALEGSNVDITAELVGLMTAQRNYQANAKVISTNDTM 394


>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional.
          Length = 473

 Score = 72.1 bits (176), Expect = 1e-13
 Identities = 48/137 (35%), Positives = 72/137 (52%), Gaps = 5/137 (3%)

Query: 130 VTADGNTLVPGIV----IPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGL 185
           VT  G+   P +V       E   + V + G ++A    N + Q +G L++ANF N  GL
Sbjct: 338 VTQYGSDFAPKVVQNGYSSGEFMGLSVGKDGSLVA-KYTNGETQTIGTLVLANFNNVQGL 396

Query: 186 RNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNS 245
           + +G+N    TS SG   +  P   G A +    LEASNVD  +E+  MI AQR Y+ N+
Sbjct: 397 QPVGNNAWVETSESGQATLGQPGTNGLATIAGQALEASNVDMSRELVNMIVAQRTYQANA 456

Query: 246 KVIEAADEMSSLITKMR 262
           + I+  DE+  ++  MR
Sbjct: 457 QTIKTQDEVMQVLMNMR 473



 Score = 62.1 bits (150), Expect = 1e-10
 Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 21/133 (15%)

Query: 3   AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
            F    +G++A   NL++I NNIAN  T G+K   A FAD +Y + +V            
Sbjct: 2   GFGQGLSGLNAASQNLDVIGNNIANSGTVGFKSGAASFAD-VYASSRV------------ 48

Query: 63  VPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLAL-VGRGWFQVETPDKTVMYTRAGSF 121
                  G GV++S++   +T G +  TG   D+A+  G+G+F++      V Y+R G F
Sbjct: 49  -------GLGVKVSAINQRFTVGNISTTGGEYDMAIDGGKGFFRLTDQSGGVFYSRNGEF 101

Query: 122 NIDSKGQLVTADG 134
            +D    +V A G
Sbjct: 102 MVDKNFYIVNAQG 114


>gnl|CDD|162884 TIGR02490, flgF, flagellar basal-body rod protein FlgF.  Members of
           this protein are FlgF, one of several homologous
           flagellar basal-body rod proteins in bacteria.
          Length = 89

 Score = 70.4 bits (173), Expect = 4e-13
 Identities = 41/102 (40%), Positives = 50/102 (49%), Gaps = 13/102 (12%)

Query: 141 IVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSG 200
           IV+P     I +   G I        D Q VG+L + NF N   L+  GD L    +   
Sbjct: 1   IVLPP-AGPITIGADGTISQ------DGQEVGRLGLVNFDNPNQLQREGDGLF--RATGA 51

Query: 201 DPIISNPDDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYE 242
            P    P D     V QGYLE SNV+AV E+ +MI AQRAYE
Sbjct: 52  GPA---PADSNVR-VVQGYLEGSNVNAVSEMVDMIEAQRAYE 89


>gnl|CDD|180282 PRK05841, flgE, flagellar hook protein FlgE; Validated.
          Length = 603

 Score = 68.3 bits (167), Expect = 2e-12
 Identities = 36/118 (30%), Positives = 65/118 (55%), Gaps = 12/118 (10%)

Query: 148 REIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTS---------V 198
           R++++  +G ++++   N   +P+G++ IA F N+ GLR +G NL              +
Sbjct: 478 RDVRIDENG-VISLAFSNGVVEPMGRIGIAAFTNDQGLRKVGGNLFEMQEGTINGENRPL 536

Query: 199 SGDPIISNPDD--IGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
           SG+PI+   ++  + F  V+  YLE SNVDA   ++ +I  QR Y MN++     D++
Sbjct: 537 SGNPILGWDEEGKLKFGKVRHKYLETSNVDAGNALTNLILMQRGYSMNARAFGTGDDL 594



 Score = 57.5 bits (139), Expect = 4e-09
 Identities = 41/142 (28%), Positives = 54/142 (38%), Gaps = 22/142 (15%)

Query: 7   AAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEG 66
           A +G+   Q  L+ ++NNIAN+NT GY+    EF            S    A  A     
Sbjct: 8   AYSGIKTHQFGLDSLSNNIANVNTLGYRSNIPEFKTLF--------SSHLDALNAKSVVA 59

Query: 67  ISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVM------------ 114
                GV  SS       GE   +     +A  G+GWF V       M            
Sbjct: 60  NDRNYGVTGSSNAISNKDGEYKPSDGEFHMAYQGKGWFVVGPNKNGSMTINKDGFSKKQD 119

Query: 115 --YTRAGSFNIDSKGQLVTADG 134
             +TR GSF  D+ G LV  +G
Sbjct: 120 NYFTRDGSFARDADGYLVNPEG 141


>gnl|CDD|183769 PRK12819, flgG, flagellar basal body rod protein FlgG; Reviewed.
          Length = 257

 Score = 59.9 bits (145), Expect = 6e-10
 Identities = 70/267 (26%), Positives = 111/267 (41%), Gaps = 33/267 (12%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQ---- 56
           M    I + GM      + + +NN+AN  TTG+K        F  Q     G  +     
Sbjct: 1   MNGLYIGSMGMMNYMQRINVHSNNVANAQTTGFKAENMTSKVFDVQDTYRRGDGAVTNIG 60

Query: 57  SADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLAL----VGRGWFQVETPDKT 112
           S D AVVP    +              QG +  T ++ D  L     G   F V + +  
Sbjct: 61  SVDYAVVPAATHVN-----------LVQGNIQMTNSDTDFFLDDGPAGTSSFFVTSKNGE 109

Query: 113 VMYTRAGSFNIDSKGQLVTADGNTLV----PGIVIPEETREIKVSRSGQIL-AVTGKNSD 167
              TR GSF ++S   L TA G  ++      I IPE  + + V   G +  AVT  N  
Sbjct: 110 TFLTRDGSFTLNSDRYLQTASGAFVMGENNERIRIPEGAK-VAVQADGTLYDAVTQNN-- 166

Query: 168 FQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASNVDA 227
              + +L       E   R +        +++   I + P+  G   VK G LE SNVD 
Sbjct: 167 ---IARLQTKTVSAEQNDRLVQRE-NKSFTLAEGNIANLPNGQGI--VKNGMLENSNVDM 220

Query: 228 VKEISEMISAQRAYEMNSKVIEAADEM 254
            KE++++++ QR  + + +V+ + D++
Sbjct: 221 TKEMADLMTDQRMIQASQRVMTSFDKI 247


>gnl|CDD|148188 pfam06429, DUF1078, Domain of unknown function (DUF1078).  This
           family consists of a number of C-terminal domains of
           unknown function. This domain seems to be specific to
           flagellar basal-body rod and flagellar hook proteins in
           which pfam00460 is often present at the extreme N
           terminus.
          Length = 39

 Score = 54.0 bits (131), Expect = 3e-08
 Identities = 21/39 (53%), Positives = 28/39 (71%)

Query: 223 SNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKM 261
           SNVD V+E+  +I AQRAYE N+KVI+ ADEM   +  +
Sbjct: 1   SNVDLVEEMVNLIEAQRAYEANAKVIQTADEMLGTLLNL 39


>gnl|CDD|180197 PRK05681, flgC, flagellar basal body rod protein FlgC; Reviewed.
          Length = 135

 Score = 50.6 bits (122), Expect = 4e-07
 Identities = 18/39 (46%), Positives = 27/39 (69%)

Query: 216 KQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
            +GY++  NV+ V E+ +MISA R+YE N +V+ AA  M
Sbjct: 87  AKGYVKYPNVNVVVEMVDMISASRSYEANVEVLNAAKSM 125



 Score = 49.8 bits (120), Expect = 8e-07
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 1  MKAFMIAAAGMSAQQTNLEIIANNIANINTTG------YKRARAEFADFLYQAEKVAG 52
            +F IA +G+SAQ   L +I++NIAN ++T       Y+R +  FA  L   +   G
Sbjct: 4  FSSFNIAGSGLSAQSQRLNVISSNIANADSTAAPDGDPYRRKQVVFAAELDPGQGTGG 61


>gnl|CDD|162886 TIGR02492, flgK_ends, flagellar hook-associated protein FlgK.
          The flagellar hook-associated protein FlgK of bacterial
          flagella has conserved N- and C-terminal domains. The
          central region is highly variable in length and
          sequence, and often contains substantial runs of
          low-complexity sequence. This model is built from an
          alignment of FlgK sequences with the central region
          excised. Note that several other proteins of the
          flagellar apparatus also are homologous in the N- and
          C-terminal regions to FlgK, but are excluded from this
          model.
          Length = 322

 Score = 50.0 bits (120), Expect = 5e-07
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 16/82 (19%)

Query: 3  AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAV 62
             IA +G+SA Q  L + +NNIAN NT GY R RA                  +A    
Sbjct: 2  LLNIAKSGLSASQIALSVTSNNIANANTPGYSRQRAV----------------LTAVPGG 45

Query: 63 VPEGISIGSGVQISSVRNVYTQ 84
             G+ IG+GV+++S+R +  Q
Sbjct: 46 GQGGLQIGTGVRVTSIRRIQDQ 67


>gnl|CDD|181099 PRK07739, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 507

 Score = 49.2 bits (118), Expect = 1e-06
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 12/84 (14%)

Query: 1  MKAFM---IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQS 57
          M  FM    A  G+ AQQ  L +  +NIAN NT GY R R   A            P+  
Sbjct: 2  MSTFMGLETARRGLFAQQAALYVTGHNIANANTPGYTRQRVNLA-------ATPPYPTPG 54

Query: 58 ADKAVVPEGISIGSGVQISSVRNV 81
           ++  +P    +G+GV+  SV  +
Sbjct: 55 MNRPKIPG--QMGTGVEAGSVERI 76



 Score = 28.1 bits (63), Expect = 2.3
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 230 EISEMISAQRAYEMNSKVIEAADEM-SSLITKM 261
           E++ MI  Q AY   +++I A DEM   +I  M
Sbjct: 470 EMTNMIKFQHAYNAAARMITAIDEMLDKIINGM 502


>gnl|CDD|130462 TIGR01395, FlgC, flagellar basal-body rod protein FlgC.  This model
           represents FlgC, one of several components of bacterial
           flagella that share a domain described by pfam model
           pfam00460. FlgC is part of the basal body.
          Length = 135

 Score = 49.3 bits (118), Expect = 1e-06
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 216 KQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSS 256
            +GY++  NV+ V+E+ +MI A R+YE N +V   A  M  
Sbjct: 88  AEGYVKMPNVNVVEEMVDMIEASRSYEANVQVFNTAKSMFL 128



 Score = 41.2 bits (97), Expect = 2e-04
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 6/52 (11%)

Query: 3  AFMIAAAGMSAQQTNLEIIANNIANINTTG------YKRARAEFADFLYQAE 48
           F ++A+ +SAQ+  + ++++N+AN ++T       Y+R R  F   L+Q  
Sbjct: 3  IFNVSASALSAQRVRMNVVSSNLANADSTRTPAGDPYRRRRPVFEAELFQDR 54


>gnl|CDD|168176 PRK05683, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 676

 Score = 45.1 bits (107), Expect = 2e-05
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 16/77 (20%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPE 65
          I  +G+ A QT L +  NNIAN++T GY R          Q  +   +  QS        
Sbjct: 6  IGLSGLGASQTALAVTGNNIANVDTAGYSRQ---------QTVQTTKASQQSG------- 49

Query: 66 GISIGSGVQISSVRNVY 82
             IG+G  ++ VR +Y
Sbjct: 50 AGYIGTGTTLADVRRIY 66


>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional.
          Length = 130

 Score = 44.4 bits (105), Expect = 3e-05
 Identities = 19/39 (48%), Positives = 27/39 (69%)

Query: 218 GYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSS 256
           GY + SNVD V EI++   AQR+YE N ++ + A +MSS
Sbjct: 84  GYYDGSNVDLVVEIADAREAQRSYEANLRMFDQARQMSS 122



 Score = 40.6 bits (95), Expect = 5e-04
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 2  KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEF 40
          K+  ++A+GM AQ   L  ++ NIAN +T GY+R    F
Sbjct: 6  KSLSVSASGMRAQALRLRHVSENIANADTPGYRRKTVSF 44


>gnl|CDD|180871 PRK07191, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 456

 Score = 42.9 bits (101), Expect = 8e-05
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 16/79 (20%)

Query: 1  MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
          M     A +GM A Q +L   + NIAN++T GY R   E                QSA  
Sbjct: 1  MNFIRTAFSGMQAAQAHLNATSMNIANMHTPGYSRQGVE----------------QSAIG 44

Query: 61 AVVPEGISIGSGVQISSVR 79
          A    G++ G+GV +  +R
Sbjct: 45 ADGQGGVNAGNGVNVDGIR 63



 Score = 27.5 bits (61), Expect = 3.3
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 223 SNVDAVKEISEMISAQRAYEMNSKVIEAADEMSS 256
           S V+  +E   ++  QRAY+ N KVI   D++ S
Sbjct: 417 SGVNNDEEAMNLMEYQRAYQSNMKVIATGDKLFS 450


>gnl|CDD|139117 PRK12643, flgF, flagellar basal body rod protein FlgF; Reviewed.
          Length = 209

 Score = 42.1 bits (98), Expect = 1e-04
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 18/130 (13%)

Query: 1   MKAFMIAAAGMSAQQTNLE-IIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSAD 59
           M   +  A G + Q   L+ + ANN+AN +T G+   RA+ A    +A  + G PS +  
Sbjct: 1   MDHAIYTAMGAARQSLELQAVTANNLANASTPGF---RAQLAAM--RAVPIDG-PSLATR 54

Query: 60  KAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAG 119
             V     +   GV IS       QG +  +G  LD+AL   G+  V+ PD +  YTR G
Sbjct: 55  TMVT----TSTPGVDIS-------QGTMNFSGRPLDVALQQDGYLAVQLPDGSEAYTRNG 103

Query: 120 SFNIDSKGQL 129
           +  I + GQ+
Sbjct: 104 NIQISANGQM 113


>gnl|CDD|183636 PRK12631, flgC, flagellar basal body rod protein FlgC; Provisional.
          Length = 138

 Score = 39.9 bits (93), Expect = 6e-04
 Identities = 17/37 (45%), Positives = 28/37 (75%)

Query: 218 GYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
           G++   NV+ ++E+++MISA R+Y+MN +V EAA  M
Sbjct: 93  GFIYKPNVNVMEEMADMISASRSYQMNVQVAEAAKSM 129



 Score = 32.2 bits (73), Expect = 0.12
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 2  KAFMIAAAGMSAQQTNLEIIANNIAN---INTTGYKRARAEFADFLYQAEKVAGSPSQSA 58
            F +A +GMSAQ   L   A+NIAN   ++++  K  RA     +++AE       Q A
Sbjct: 5  NIFDVAGSGMSAQSVRLNTTASNIANADSVSSSVDKTYRARHP--IFEAEMAKAQSQQQA 62

Query: 59 DKAVVPEGI 67
           + V  +GI
Sbjct: 63 SQGVAVKGI 71


>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB.  This
          model represents FlgB, one of several components of
          bacterial flagella that share a domain described by
          pfam model pfam00460. FlgB is part of the basal body.
          Length = 131

 Score = 38.9 bits (91), Expect = 0.001
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 2  KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAE 48
           AF +    +  +    E+IANNIAN++T GYK     F   L ++ 
Sbjct: 3  NAFGLLQQALDVRSLRQEVIANNIANVDTPGYKAKDVSFEAELKKSL 49


>gnl|CDD|181252 PRK08147, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 547

 Score = 38.5 bits (90), Expect = 0.002
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPE 65
           A +G++A Q  L  ++NNI+N N  GY R     A         AGS   +        
Sbjct: 7  TAMSGLNAAQAALNTVSNNISNYNVAGYTRQTTILAQ--------AGSTLTAGG------ 52

Query: 66 GISIGSGVQISSVRNVYTQ 84
             IG+GV +S V+  Y  
Sbjct: 53 --WIGNGVYVSGVQREYDA 69


>gnl|CDD|139220 PRK12782, flgC, flagellar basal body rod protein FlgC; Reviewed.
          Length = 138

 Score = 38.6 bits (90), Expect = 0.002
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTG-------YKRARAEFADFLYQAEKVAG 52
          IA++G+ AQ T L +++ N+AN  +TG       Y R    F   L +A   A 
Sbjct: 11 IASSGLEAQSTRLRVVSENLANAQSTGRTPGADPYARKTVTFRAELDRAAGAAS 64



 Score = 35.5 bits (82), Expect = 0.016
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 216 KQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKM 261
           + GY++  NV+ + E+++M  A R+YE N +VI+ A  M ++   +
Sbjct: 90  ENGYVKLPNVNMLIEMADMREANRSYEANLQVIKQARAMVAMTIDL 135


>gnl|CDD|183630 PRK12623, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 131

 Score = 38.2 bits (89), Expect = 0.002
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 10 GMSAQQTNLEIIANNIANINTTGYKRARAEFADFL 44
          G+ A     ++I+NNIAN+NT GYKR    F + L
Sbjct: 19 GLDASSYRGKVISNNIANVNTKGYKRHYVTFEENL 53


>gnl|CDD|180196 PRK05680, flgB, flagellar basal body rod protein FlgB; Reviewed.
          Length = 137

 Score = 37.9 bits (89), Expect = 0.002
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 2  KAFMIAAAGMSAQQTNLEIIANNIANINTTGYK 34
          KA       ++ +    E+IA+NIAN +T GYK
Sbjct: 7  KALRFLQEALNLRAQRQEVIASNIANADTPGYK 39


>gnl|CDD|183698 PRK12715, flgK, flagellar hook-associated protein FlgK;
          Provisional.
          Length = 649

 Score = 37.4 bits (86), Expect = 0.003
 Identities = 29/82 (35%), Positives = 40/82 (48%), Gaps = 17/82 (20%)

Query: 1  MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADK 60
          M    IA +G++A Q  L++  NNIAN  T GY R   +F      + + AGS       
Sbjct: 1  MSILNIAYSGLNAFQRALDVTGNNIANFKTRGYSRQSIQFTPI--ASNRYAGS------- 51

Query: 61 AVVPEGISIGSGVQISSV-RNV 81
                  IG+GV +SS+ RNV
Sbjct: 52 -------YIGAGVSVSSIYRNV 66


>gnl|CDD|181438 PRK08471, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 613

 Score = 37.3 bits (87), Expect = 0.003
 Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 16/73 (21%)

Query: 6  IAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPE 65
              G+ A Q  ++   NNI+N ++  Y R R                  QSA  A+   
Sbjct: 10 TGYTGLQAAQVMVDTTGNNISNASSEFYTRQRV----------------VQSAQAALNTG 53

Query: 66 GISIGSGVQISSV 78
          G ++G+G  I ++
Sbjct: 54 GGNVGTGTDIETI 66



 Score = 29.6 bits (67), Expect = 0.94
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 215 VKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
           VK+ Y   S V   +E+  +I  Q +Y   +K+I   D+M
Sbjct: 565 VKKEYQSISGVSTDEELVNLIKFQSSYGAAAKIITTIDQM 604


>gnl|CDD|180769 PRK06945, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 651

 Score = 37.3 bits (87), Expect = 0.004
 Identities = 20/81 (24%), Positives = 31/81 (38%), Gaps = 16/81 (19%)

Query: 4  FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
            I  +G++A Q  L    +NI+N  T GY R R                  Q+      
Sbjct: 5  LNIGLSGLNAAQWGLTTTGHNISNAATPGYSRQR----------------VVQAEAGGQY 48

Query: 64 PEGISIGSGVQISSVRNVYTQ 84
               +G GV + +V+  Y+Q
Sbjct: 49 TGSGYLGQGVNVVTVKRQYSQ 69


>gnl|CDD|183635 PRK12630, flgC, flagellar basal body rod protein FlgC;
          Provisional.
          Length = 143

 Score = 35.2 bits (81), Expect = 0.016
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 1  MKAF---MIAAAGMSAQQTNLEIIANNIANINTT------GYKRARAEFADFLYQAEKVA 51
          MKAF    I+A+G+SA++  ++ IA+NIAN  TT       YKR  A F + L +     
Sbjct: 1  MKAFDTMRISASGLSAERLRMDTIASNIANATTTRTADGGPYKRKIAVFQENLNKELNKK 60

Query: 52 GSPSQSADKAVVPEGI 67
              +     V   GI
Sbjct: 61 NGAYEKKLYGVKAVGI 76



 Score = 34.4 bits (79), Expect = 0.029
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 217 QGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSS 256
           +GY+   NV+ + E+++M+++ R+YE N   I A   M S
Sbjct: 97  EGYVSMPNVNVLNEMADMMASTRSYEANVTAINAEKSMFS 136


>gnl|CDD|183697 PRK12714, flgK, flagellar hook-associated protein FlgK;
          Provisional.
          Length = 624

 Score = 34.9 bits (80), Expect = 0.019
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 13 AQQTNLEIIANNIANINTTGYKRARAEFA 41
          A Q  L  +++N+ANINT GY R R EFA
Sbjct: 13 AFQRALSTVSHNVANINTEGYSRQRVEFA 41



 Score = 26.5 bits (58), Expect = 6.7
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 221 EASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
             S V+  +E + M+  Q+AY+  +++I  AD M
Sbjct: 582 SISGVNLDEEAANMLKLQQAYQAAAQMISTADTM 615


>gnl|CDD|171613 PRK12621, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 136

 Score = 34.3 bits (79), Expect = 0.030
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 11 MSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQA 47
          M  Q     ++ +N+AN+NT GYK    EF   L  A
Sbjct: 16 MDMQLQRQNVVMSNLANVNTPGYKPRELEFEKELQAA 52


>gnl|CDD|180702 PRK06802, flgC, flagellar basal body rod protein FlgC; Reviewed.
          Length = 141

 Score = 34.4 bits (79), Expect = 0.030
 Identities = 14/38 (36%), Positives = 27/38 (71%)

Query: 217 QGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
           QGY+   +V+ V+E+++M+SA R++E N +V+ +   M
Sbjct: 94  QGYVFYPDVNVVEEMADMMSASRSFETNVEVLNSVKSM 131



 Score = 29.4 bits (66), Expect = 1.1
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 9/84 (10%)

Query: 4  FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
          + IA + M+AQ   L  +A+N+AN        + A  A   Y+A     +   SA     
Sbjct: 7  YRIAGSAMTAQTIRLNTVASNLANAE------SPAASAATAYKARSPVFAAVYSARTLAD 60

Query: 64 PEGISIGSGVQISSVRNVYTQGEV 87
          P G+  G+ VQ+  V  V   G V
Sbjct: 61 PRGVQ-GAQVQVLDV--VQVGGSV 81


>gnl|CDD|79089 PRK12628, flgC, flagellar basal body rod protein FlgC; Provisional.
          Length = 140

 Score = 33.3 bits (75), Expect = 0.061
 Identities = 13/39 (33%), Positives = 28/39 (71%)

Query: 216 KQGYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
           K G++  SN++ V+E++ +ISA R+Y+MN +++    ++
Sbjct: 93  KDGFVYTSNINYVEEMANIISASRSYQMNIELLNTTKQL 131


>gnl|CDD|180699 PRK06799, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 431

 Score = 31.8 bits (72), Expect = 0.18
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 14/73 (19%)

Query: 9  AGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVVPEGIS 68
          +GM A Q  L+    N++NI+T GY R    +              S  A   ++PE   
Sbjct: 11 SGMLAAQMGLQTTQQNLSNIHTPGYVRQMVNYG-------------SVGASGGLLPEQ-Q 56

Query: 69 IGSGVQISSVRNV 81
          IG GVQ   V  +
Sbjct: 57 IGYGVQTLGVDRI 69


>gnl|CDD|181014 PRK07521, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 483

 Score = 31.8 bits (73), Expect = 0.19
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 3  AFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAE 39
          A   A +G++A      +++ NIAN  T GY R  A 
Sbjct: 6  ALNTAQSGLTATSRQTSVVSRNIANAGTPGYSRREAS 42



 Score = 30.3 bits (69), Expect = 0.50
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 222 ASNVDAVKEISEMISAQRAYEMNSKVIEAADEM 254
           A+ VD   E++ ++  +++Y  ++KVI   DEM
Sbjct: 443 ATGVDTDDEMALLLDLEQSYAASAKVISTVDEM 475


>gnl|CDD|183632 PRK12626, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 162

 Score = 31.8 bits (72), Expect = 0.19
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 19 EIIANNIANINTTGYKRARAEFADFLYQAEKVAG---SPSQSADKAVV-PEGISIG 70
          E++++NIAN +T GY+    +FA  L +A K      + S +A   +  P G++ G
Sbjct: 24 ELLSSNIANADTPGYRARDVDFASTLARALKQTDGGAAASNAAQLPMAQPAGVTSG 79


>gnl|CDD|183627 PRK12619, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 130

 Score = 30.9 bits (69), Expect = 0.36
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 4  FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQ 56
          F I A  + A+     ++ANNIAN+NT  +K    +F + L     +AG+  Q
Sbjct: 9  FGIHAKALIARDQRASVLANNIANVNTPNFKARDVDFNEVL--TATMAGNSQQ 59


>gnl|CDD|180697 PRK06797, flgB, flagellar basal body rod protein FlgB; Reviewed.
          Length = 135

 Score = 30.4 bits (68), Expect = 0.47
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 11 MSAQQTNLEIIANNIANINTTGYKRARAEFADFL 44
          M+   T    +++NIAN NT GYK     FA+ +
Sbjct: 12 MNYLVTKRNTVSSNIANANTPGYKAQDVTFAEQM 45


>gnl|CDD|183629 PRK12622, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 135

 Score = 29.9 bits (67), Expect = 0.71
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 20 IIANNIANINTTGYKRARAEFADFLYQA 47
          +IA+NIAN++T  +KR++  F   L +A
Sbjct: 24 VIADNIANVDTPNFKRSKVTFESELERA 51


>gnl|CDD|183634 PRK12629, flgC, flagellar basal body rod protein FlgC; Provisional.
          Length = 135

 Score = 29.3 bits (65), Expect = 1.1
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 218 GYLEASNVDAVKEISEMISAQRAYEMNSKVIEAADEMS 255
           GY+ + +VD V ++  MISA R Y+   +++  A E++
Sbjct: 90  GYVFSPDVDPVSQMVNMISASRNYQAGVEMLNTAKELA 127


>gnl|CDD|168340 PRK06003, flgB, flagellar basal body rod protein FlgB; Reviewed.
          Length = 126

 Score = 29.2 bits (66), Expect = 1.1
 Identities = 24/81 (29%), Positives = 33/81 (40%), Gaps = 11/81 (13%)

Query: 19 EIIANNIANINTTGYKRAR--AEFADFLYQAEKVAGSPSQSADKAVVPEGISIGSGVQIS 76
            +A NIAN NT GY+ AR    FAD L     +  + +          GI +       
Sbjct: 22 ATVAGNIANANTPGYR-ARDVQPFADVL-DKTGLTMAATSPGHLGASATGIDVTEARPDD 79

Query: 77 SVRNVYTQGEVVHTGNNLDLA 97
          S        EV H+GN++ L 
Sbjct: 80 S-------WEVTHSGNSVSLE 93


>gnl|CDD|75964 PRK07182, flgB, flagellar basal body rod protein FlgB; Reviewed.
          Length = 148

 Score = 28.7 bits (63), Expect = 1.5
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 2  KAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEK---VAGSPSQSA 58
          KA  +    M  + T  E+++ N+AN+NT  ++    +FA  + +A++   V  +P +S+
Sbjct: 7  KALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSS 66


>gnl|CDD|180650 PRK06665, flgK, flagellar hook-associated protein FlgK;
          Validated.
          Length = 627

 Score = 28.5 bits (64), Expect = 1.7
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 23/76 (30%)

Query: 10 GMSAQQTNLEIIANNIANINTTGYKRARAEFADF-------LYQAEKVAGSPSQSADKAV 62
           + A +  L+   +NI+N +T GY R R     F       L +AEK    P Q      
Sbjct: 14 SLFAHKQALQTTGHNISNASTKGYSRQRVTMKTFDPLYAPSLNRAEK----PGQ------ 63

Query: 63 VPEGISIGSGVQISSV 78
                IG GV+I S+
Sbjct: 64 ------IGQGVEIQSI 73



 Score = 27.7 bits (62), Expect = 3.2
 Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 223 SNVDAVKEISEMISAQRAYEMNSKVIEAADEM-SSLITKM 261
           S V+  +E++ MI  Q  Y  +++ I  ++E+  ++I +M
Sbjct: 586 SGVNLDEELANMIEFQHGYNASARFISVSNELLDTIINRM 625


>gnl|CDD|183628 PRK12620, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 132

 Score = 28.4 bits (63), Expect = 1.9
 Identities = 11/45 (24%), Positives = 25/45 (55%)

Query: 4  FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAE 48
            +    ++ ++  +++IA+N++N++T GYK     F   L  A+
Sbjct: 9  LGVHGDALTLREQRMKLIASNLSNVDTPGYKAKDLNFEAALKSAQ 53


>gnl|CDD|183631 PRK12625, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 132

 Score = 28.3 bits (63), Expect = 1.9
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 10 GMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQA 47
          G+ AQ+   E+I++NIAN +T  YK    +F+  +  A
Sbjct: 17 GIRAQRA--EVISSNIANADTPHYKARDVDFSAAMQAA 52


>gnl|CDD|185238 PRK15338, PRK15338, type III secretion system regulator InvE;
           Provisional.
          Length = 372

 Score = 28.3 bits (63), Expect = 2.1
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 210 IGFAHVKQGYLEASNVDAVKEI-SEMISAQRAYEMNS------KVIEAADEMSSLITKMR 262
           IG +  +    E S+ DA +   ++   AQ+A E +S      K +++ DEMS+ + + R
Sbjct: 7   IGISFSRILARETSHQDATQHTDAQQAEAQQAAEDSSPGAEVQKFVQSTDEMSAALAQFR 66


>gnl|CDD|139107 PRK12624, flgB, flagellar basal body rod protein FlgB;
          Provisional.
          Length = 143

 Score = 28.1 bits (62), Expect = 2.3
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 1  MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQA------EKVAGSP 54
          MK   +   GM+      ++I++NIAN +   +KR+   F   + +A      EK    P
Sbjct: 8  MKTQDLLERGMNNSIQKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIEKEKEVP 67

Query: 55 SQSADK 60
          +Q +D+
Sbjct: 68 TQISDE 73


>gnl|CDD|179447 PRK02597, rpoC2, DNA-directed RNA polymerase subunit beta';
           Provisional.
          Length = 1331

 Score = 28.0 bits (63), Expect = 2.4
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 11/59 (18%)

Query: 106 VETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGK 164
           VE  + T+    +G   +   G LV   G+ L PG+  PE         SG++ AV+G 
Sbjct: 887 VERDEDTITIPLSGKPTV-KVGDLVV-AGDELAPGVPAPE---------SGEVEAVSGG 934


>gnl|CDD|184868 PRK14866, PRK14866, hypothetical protein; Provisional.
          Length = 451

 Score = 27.3 bits (61), Expect = 4.7
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 125 SKGQLVTADGNTLVPGIVIPEETREIKV 152
           + GQ V  DG T+ P +V  E T+ I +
Sbjct: 418 AAGQPVEVDGETITPEMVHRETTKRIHL 445


>gnl|CDD|181520 PRK08645, PRK08645, bifunctional homocysteine
           S-methyltransferase/5,10-methylenetetrahydrofolate
           reductase protein; Reviewed.
          Length = 612

 Score = 26.7 bits (60), Expect = 5.6
 Identities = 9/12 (75%), Positives = 10/12 (83%)

Query: 138 VPGIVIPEETRE 149
           VPGI +PEE RE
Sbjct: 540 VPGITLPEEIRE 551


>gnl|CDD|181572 PRK08871, flgK, flagellar hook-associated protein FlgK; Validated.
          Length = 626

 Score = 26.7 bits (59), Expect = 6.3
 Identities = 12/42 (28%), Positives = 27/42 (64%)

Query: 221 EASNVDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
             S V+  +E + M+  Q+AY  +S++++AA++  + I ++R
Sbjct: 585 SISGVNLDEEAANMMKFQQAYMASSRIMQAANDTFNTILQLR 626


>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase;
           Provisional.
          Length = 380

 Score = 26.0 bits (58), Expect = 9.4
 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 3/40 (7%)

Query: 59  DKAVVPEGISIGSGVQISSVRN---VYTQGEVVHTGNNLD 95
           ++A++ E   IG GV I   +    V  + EV+  G  + 
Sbjct: 341 ERAIIGENAVIGDGVIIGGGKEVITVIGENEVIGVGTVIG 380


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.313    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0765    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 4,121,310
Number of extensions: 262289
Number of successful extensions: 525
Number of sequences better than 10.0: 1
Number of HSP's gapped: 470
Number of HSP's successfully gapped: 97
Length of query: 262
Length of database: 5,994,473
Length adjustment: 92
Effective length of query: 170
Effective length of database: 4,006,537
Effective search space: 681111290
Effective search space used: 681111290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 56 (25.3 bits)