RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780378|ref|YP_003064791.1| flagellar basal body rod
protein FlgG [Candidatus Liberibacter asiaticus str. psy62]
         (262 letters)



>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor,
           universal joint, bacterial flagellum, motor protein;
           7.10A {Salmonella enterica subsp} (A:48-116,A:315-358)
          Length = 113

 Score =  110 bits (277), Expect = 2e-25
 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 36/149 (24%)

Query: 70  GSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQL 129
           G GV+++ +   +T G   +TG  LD+A+   G+F++   + +V Y+R G F +D    L
Sbjct: 1   GLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNL 60

Query: 130 VTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIG 189
           V   G  L                                     ++ANF N  GL + G
Sbjct: 61  VNMQGMQL------------------------------------TVLANFANNEGLASQG 84

Query: 190 DNLLARTSVSGDPIISNPDDIGFAHVKQG 218
           DN+ A T  SG  ++       F  +  G
Sbjct: 85  DNVWAATQASGVALLGTAGSGNFGKLTNG 113


>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural
           protein; 1.80A {Salmonella typhimurium}
           (A:1-46,A:245-281)
          Length = 83

 Score = 90.8 bits (226), Expect = 2e-19
 Identities = 28/114 (24%), Positives = 43/114 (37%), Gaps = 36/114 (31%)

Query: 94  LDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVS 153
           LD+A+   G+F++   + +V Y+R G F +D    LV   G  L                
Sbjct: 2   LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQL---------------- 45

Query: 154 RSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNP 207
                                ++ANF N  GL + GDN+ A T  SG  ++   
Sbjct: 46  --------------------TVLANFANNEGLASQGDNVWAATQASGVALLGTA 79


>2frx_A Hypothetical protein YEBU; rossmann-type
           S-adenosylmethionine-dependent methyltransferase domain;
           2.90A {Escherichia coli} (A:24-37,A:103-409)
          Length = 321

 Score = 27.3 bits (59), Expect = 1.9
 Identities = 13/71 (18%), Positives = 24/71 (33%), Gaps = 1/71 (1%)

Query: 107 ETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNS 166
               +          N D   +L   D    +  + I     +++ SR G  LA T    
Sbjct: 247 REAGQIRQAATGVGLNWDENLRLWQRDKELWLFPVGIEALIGKVRFSRLGIKLAETHNK- 305

Query: 167 DFQPVGQLLIA 177
            ++   + +IA
Sbjct: 306 GYRWQHEAVIA 316


>1yue_A Head vertex protein GP24; bacteriophage T4, capsid protein,
           bacteriophage, virus, HK97, MAD, viral protein; 2.90A
           {Enterobacteria phage T4} (A:1-70,A:151-221,A:334-397)
          Length = 205

 Score = 26.4 bits (58), Expect = 3.9
 Identities = 8/29 (27%), Positives = 18/29 (62%)

Query: 220 LEASNVDAVKEISEMISAQRAYEMNSKVI 248
           LEA+  DA   + ++++ + A E+N  ++
Sbjct: 107 LEANGFDAPNFLEDLLATEXADEINKDIL 135


>2j7u_A RNA dependent RNA polymerase; nucleoside binding site,
           flavivirus, high-throughput assay, viral protein; HET:
           PGE; 1.85A {Dengue virus} PDB: 2j7w_A*
           (A:90-125,A:236-267,A:336-465)
          Length = 198

 Score = 26.3 bits (58), Expect = 4.2
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 185 LRNIGDNLLARTSVSGDPIISNPDDIGFA 213
           L   G   L R ++SGD  +  P D  FA
Sbjct: 115 LETKGVERLKRMAISGDDCVVKPIDDRFA 143


>1tuj_A Odorant binding protein Asp2; alpha helix, complex, TSP,
          transport protein; HET: TSD; NMR {Apis mellifera}
          (A:34-123)
          Length = 90

 Score = 26.2 bits (57), Expect = 4.5
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 46 QAEKVAGSPSQ-SADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALV 99
          QA K     SQ    KA V + I +  G ++  V  VY   EVVH GN  D+ LV
Sbjct: 3  QAAKNGADMSQLGCLKACVMKRIEMLKGTELY-VEPVYKMIEVVHAGNADDIQLV 56


>2hcn_A RNA-directed RNA polymerase (NS5); WEST-NIle virus RNA
           polymerase, structural genomics, marseilles structural
           genomics program @ AFMB, MSGP; 2.35A {Kunjin virus} PDB:
           2hcs_A 2hfz_A (A:41-83,A:279-393)
          Length = 158

 Score = 25.4 bits (56), Expect = 7.2
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 185 LRNIGDNLLARTSVSGDPIISNPDDIGFA 213
           L   G+  L+R +VSGD  +  P D  FA
Sbjct: 107 LSENGEERLSRMAVSGDDCVVKPLDDRFA 135


>1tba_A TAFII230, transcription initiation factor IID 230K chain;
           complex (transcription factors), TAF, TAFII230, solution
           structure; NMR {Drosophila melanogaster} (A:)
          Length = 67

 Score = 25.3 bits (55), Expect = 9.2
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETRE 149
           NIDS+G+L+  D      G     E RE
Sbjct: 17  NIDSEGRLLQDDDGEGRGGTGFDAELRE 44


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.313    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0695    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,784,686
Number of extensions: 77177
Number of successful extensions: 140
Number of sequences better than 10.0: 1
Number of HSP's gapped: 140
Number of HSP's successfully gapped: 14
Length of query: 262
Length of database: 4,956,049
Length adjustment: 87
Effective length of query: 175
Effective length of database: 2,015,014
Effective search space: 352627450
Effective search space used: 352627450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (24.6 bits)