RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780378|ref|YP_003064791.1| flagellar basal body rod
protein FlgG [Candidatus Liberibacter asiaticus str. psy62]
         (262 letters)



>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor,
           universal joint, bacterial flagellum, motor protein;
           7.10A {Salmonella enterica subsp}
          Length = 402

 Score =  112 bits (279), Expect = 1e-25
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 21/217 (9%)

Query: 4   FMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVAGSPSQSADKAVV 63
           F  A +G++A  TNL++I NNIAN  T G+K   A FAD                     
Sbjct: 2   FSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA------------------ 43

Query: 64  PEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNI 123
             G  +G GV+++ +   +T G   +TG  LD+A+   G+F++   + +V Y+R G F +
Sbjct: 44  --GSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKL 101

Query: 124 DSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEA 183
           D    LV   G  L             + +    I       +        +  N  +  
Sbjct: 102 DENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTD 161

Query: 184 GLRNIGD-NLLARTSVSGDPIISNPDDIGFAHVKQGY 219
            + +    ++    S +    ++  D  G AH    Y
Sbjct: 162 PVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVY 198



 Score = 97.4 bits (241), Expect = 3e-21
 Identities = 52/218 (23%), Positives = 86/218 (39%), Gaps = 1/218 (0%)

Query: 45  YQAEKVAGSPSQSADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWF 104
           Y ++  A   +    K    E           +     T    +    N  L   G    
Sbjct: 186 YDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNI 245

Query: 105 QVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGK 164
              T +     T + SF    +      +          P +    +++  G ++     
Sbjct: 246 TTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYS- 304

Query: 165 NSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGYLEASN 224
           N   Q +GQ+++ANF N  GL + GDN+ A T  SG  ++       F  +  G LEASN
Sbjct: 305 NEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASN 364

Query: 225 VDAVKEISEMISAQRAYEMNSKVIEAADEMSSLITKMR 262
           VD  KE+  MI AQR Y+ N++ I+  D++ + +  +R
Sbjct: 365 VDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR 402


>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A
           {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A
           2bgz_A
          Length = 299

 Score = 73.8 bits (180), Expect = 3e-14
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 5/127 (3%)

Query: 104 FQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVI----PEETREIKVSRSGQIL 159
             V     T+    A +F++     +    G   +         P +    +++  G ++
Sbjct: 171 GTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVV 230

Query: 160 AVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFAHVKQGY 219
                N   Q +GQ+++ANF N  GL + GDN+ A T  SG  ++       F  +  G 
Sbjct: 231 GNYS-NEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGA 289

Query: 220 LEASNVD 226
           LEASNVD
Sbjct: 290 LEASNVD 296



 Score = 58.4 bits (140), Expect = 1e-09
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 94  LDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTL 137
           LD+A+   G+F++   + +V Y+R G F +D    LV   G  L
Sbjct: 2   LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQL 45


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 36.1 bits (83), Expect = 0.007
 Identities = 46/213 (21%), Positives = 67/213 (31%), Gaps = 96/213 (45%)

Query: 29  NTTGYKRARAEFAD--------FLYQAEKVAGSP--SQSADKA-------VVPEGISI-G 70
             +G  ++R  F++        FL        SP  S     A       +V   +S   
Sbjct: 398 APSGLDQSRIPFSERKLKFSNRFL-----PVASPFHSHLLVPASDLINKDLVKNNVSFNA 452

Query: 71  SGVQISSVRNVY-TQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQL 129
             +QI     VY T       G++L                      R  S +I  +   
Sbjct: 453 KDIQIP----VYDT-----FDGSDL----------------------RVLSGSISER--- 478

Query: 130 VTADGNTLVPGIVI-P---EETREIKVSRSGQILAVTGKNSDFQP-----VGQLLIANFI 180
                  +V  I+  P   E T + K +    IL       DF P     +G L   N  
Sbjct: 479 -------IVDCIIRLPVKWETTTQFKAT---HIL-------DFGPGGASGLGVLTHRNK- 520

Query: 181 NEAGLRNIGDNLLARTSVSGDPIISNP-DDIGF 212
           +  G+R I         V+G  +  NP DD GF
Sbjct: 521 DGTGVRVI---------VAGT-LDINPDDDYGF 543



 Score = 35.3 bits (81), Expect = 0.013
 Identities = 50/262 (19%), Positives = 86/262 (32%), Gaps = 88/262 (33%)

Query: 1   MKAFMIAAAGMSAQQTNLEIIANNIANINTTGYKRARAEFADFLYQAEKVA------GS- 53
           +++++  A G S Q     + A  IA  ++         +  F     K        G  
Sbjct: 263 LRSYLKGATGHS-QGL---VTAVAIAETDS---------WESFFVSVRKAITVLFFIGVR 309

Query: 54  -----PSQSADKAVVPEGISIGSGVQIS---SVRNVYTQGEV-VHTG--NN-------LD 95
                P+ S   +++ + +    GV  S   S+ N+ TQ +V  +    N+       ++
Sbjct: 310 CYEAYPNTSLPPSILEDSLENNEGVP-SPMLSISNL-TQEQVQDYVNKTNSHLPAGKQVE 367

Query: 96  LALV-GRGWFQVETPDKTVMYTRAGSFNIDSKGQL--VTADGNTLVPGIV---IPEETRE 149
           ++LV G     V  P ++ +Y      N+     L    A       G+    IP   R 
Sbjct: 368 ISLVNGAKNLVVSGPPQS-LY----GLNL----TLRKAKAP-----SGLDQSRIPFSER- 412

Query: 150 IKVSRSGQILAVT--------------------GKNSDFQPVGQLLIANFINEAG--LRN 187
            K+  S + L V                       N  F     + I  +    G  LR 
Sbjct: 413 -KLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNA-KDIQIPVYDTFDGSDLRV 470

Query: 188 IGDNLLARTSVSGDPIISNPDD 209
           +  ++  R  V  D II  P  
Sbjct: 471 LSGSISERI-V--DCIIRLPVK 489



 Score = 33.8 bits (77), Expect = 0.038
 Identities = 27/186 (14%), Positives = 50/186 (26%), Gaps = 93/186 (50%)

Query: 12  SAQQTNLEIIA------NN------IANINTTGYKRARAEF-ADFLYQAEKVAGSPSQSA 58
           +  + N +++A      N       + ++  T Y         D +  + +      ++ 
Sbjct: 148 AVGEGNAQLVAIFGGQGNTDDYFEELRDLYQT-YH----VLVGDLIKFSAETLSELIRTT 202

Query: 59  DKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKT--VMYT 116
                                 V+TQG        L++      W  +E P  T    Y 
Sbjct: 203 L-----------------DAEKVFTQG--------LNIL----EW--LENPSNTPDKDY- 230

Query: 117 RAGSFNIDSKGQLVTADGNTLVP------GIVIPEETREIKVSRSGQIL--AVTGKNSDF 168
                       L++       P      G++              Q+    VT K   F
Sbjct: 231 ------------LLSI------PISCPLIGVI--------------QLAHYVVTAKLLGF 258

Query: 169 QPVGQL 174
            P G+L
Sbjct: 259 TP-GEL 263


>2hcn_A RNA-directed RNA polymerase (NS5); WEST-NIle virus RNA polymerase,
           structural genomics, marseilles structural genomics
           program @ AFMB, MSGP; 2.35A {Kunjin virus} PDB: 2hcs_A
           2hfz_A
          Length = 595

 Score = 30.1 bits (68), Expect = 0.46
 Identities = 28/108 (25%), Positives = 40/108 (37%), Gaps = 22/108 (20%)

Query: 111 KTVM--YTRA---GSFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKN 165
           +TVM   +R    GS      GQ+VT   NT     V        ++ R  +   V G +
Sbjct: 280 RTVMDVISREDQRGS------GQVVTYALNTFTNLAV--------QLVRMMEGEGVIGPD 325

Query: 166 SDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIGFA 213
              +               L   G+  L+R +VSGD  +  P D  FA
Sbjct: 326 DVEKLTKGKGPKV---RTWLSENGEERLSRMAVSGDDCVVKPLDDRFA 370


>3fgb_A Uncharacterized protein Q89ZH8_bactn; BTR289B, NESG, structural
           genomics, PSI-2, protein structure initiative; 2.00A
           {Bacteroides thetaiotaomicron}
          Length = 361

 Score = 29.6 bits (65), Expect = 0.66
 Identities = 9/62 (14%), Positives = 20/62 (32%), Gaps = 2/62 (3%)

Query: 108 TPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIPEET--REIKVSRSGQILAVTGKN 165
           +PD   +Y              +  +   L            R   ++ +G+ L V  ++
Sbjct: 259 SPDGKFLYASNRLKADGLAIFSIHPENGMLTKVGYQLTGIHPRNFIITPNGKYLLVACRD 318

Query: 166 SD 167
           S+
Sbjct: 319 SN 320


>2frx_A Hypothetical protein YEBU; rossmann-type
           S-adenosylmethionine-dependent methyltransferase domain;
           2.90A {Escherichia coli}
          Length = 479

 Score = 28.1 bits (62), Expect = 1.8
 Identities = 13/58 (22%), Positives = 23/58 (39%), Gaps = 1/58 (1%)

Query: 120 SFNIDSKGQLVTADGNTLVPGIVIPEETREIKVSRSGQILAVTGKNSDFQPVGQLLIA 177
             N D   +L   D    +  + I     +++ SR G  LA T     ++   + +IA
Sbjct: 348 GLNWDENLRLWQRDKELWLFPVGIEALIGKVRFSRLGIKLAETHNK-GYRWQHEAVIA 404


>2j7u_A RNA dependent RNA polymerase; nucleoside binding site, flavivirus,
           high-throughput assay, viral protein; HET: PGE; 1.85A
           {Dengue virus} PDB: 2j7w_A*
          Length = 635

 Score = 27.4 bits (61), Expect = 3.1
 Identities = 31/122 (25%), Positives = 41/122 (33%), Gaps = 28/122 (22%)

Query: 97  ALVGRGWFQVETPDKTVM--YTRA---GSFNIDSKGQLVTADGNTLVPGIVIPEETREIK 151
             V R      TP  TVM   +R    GS      GQ+ T   NT              +
Sbjct: 312 VKVQR-----PTPTGTVMDIISRKDQRGS------GQVGTYGLNTFTNMEA--------Q 352

Query: 152 VSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPIISNPDDIG 211
           + R  +   V  K +D +    L          L   G   L R ++SGD  +  P D  
Sbjct: 353 LVRQMEGEGVLTK-ADLENPHLLEKKI---TQWLETKGVERLKRMAISGDDCVVKPIDDR 408

Query: 212 FA 213
           FA
Sbjct: 409 FA 410


>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein
           of unknown function, structural genomics; HET: MSE;
           1.27A {Cytophaga hutchinsonii atcc 33406}
          Length = 114

 Score = 26.6 bits (58), Expect = 6.3
 Identities = 15/102 (14%), Positives = 35/102 (34%), Gaps = 11/102 (10%)

Query: 10  GMSAQQTNLEIIANNIANINTTGYKRARAEFA-DFLYQAEKVAGSPSQSADKAVVPEGIS 68
           GM  Q T  +++   I  +NT  +  A+     +F +        P    + +       
Sbjct: 1   GMKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFN------GPMGHREGSERYMND- 53

Query: 69  IGSGVQISSVRNVYTQGE---VVHTGNNLDLALVGRGWFQVE 107
           +        V  ++ +G    +++  N     +   G + +E
Sbjct: 54  MEKMKFKYVVHKMFEEGNDVCLIYDINMNGKTIAASGLYHLE 95


>1tuj_A Odorant binding protein Asp2; alpha helix, complex, TSP,
          transport protein; HET: TSD; NMR {Apis mellifera}
          Length = 123

 Score = 26.2 bits (57), Expect = 8.5
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 46 QAEKVAGSPSQ-SADKAVVPEGISIGSGVQISSVRNVYTQGEVVHTGNNLDLALV 99
          QA K     SQ    KA V + I +  G ++  V  VY   EVVH GN  D+ LV
Sbjct: 36 QAAKNGADMSQLGCLKACVMKRIEMLKGTELY-VEPVYKMIEVVHAGNADDIQLV 89


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.313    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0469    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,053,504
Number of extensions: 92319
Number of successful extensions: 214
Number of sequences better than 10.0: 1
Number of HSP's gapped: 213
Number of HSP's successfully gapped: 20
Length of query: 262
Length of database: 5,693,230
Length adjustment: 91
Effective length of query: 171
Effective length of database: 3,487,026
Effective search space: 596281446
Effective search space used: 596281446
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 56 (26.0 bits)