RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780378|ref|YP_003064791.1| flagellar basal body rod
protein FlgG [Candidatus Liberibacter asiaticus str. psy62]
         (262 letters)



>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella
           typhimurium [TaxId: 90371]}
          Length = 293

 Score = 66.9 bits (162), Expect = 2e-12
 Identities = 32/151 (21%), Positives = 54/151 (35%), Gaps = 5/151 (3%)

Query: 77  SVRNVYTQGEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNT 136
           S     T      T    +   +      V     T+    A +F++     +    G  
Sbjct: 144 SSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGAN 203

Query: 137 LVPGIVIPEETR----EIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNL 192
            +                +++  G ++     N   Q +GQ+++ANF N  GL + GDN+
Sbjct: 204 NIVATNQNGYKPGDLVSYQINNDGTVVG-NYSNEQEQVLGQIVLANFANNEGLASQGDNV 262

Query: 193 LARTSVSGDPIISNPDDIGFAHVKQGYLEAS 223
            A T  SG  ++       F  +  G LEAS
Sbjct: 263 WAATQASGVALLGTAGSGNFGKLTNGALEAS 293



 Score = 58.4 bits (140), Expect = 7e-10
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 94  LDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTL 137
           LD+A+   G+F++   + +V Y+R G F +D    LV   G  L
Sbjct: 2   LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQL 45


>d1n45a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo
           sapiens) [TaxId: 9606]}
          Length = 214

 Score = 26.2 bits (57), Expect = 3.2
 Identities = 19/125 (15%), Positives = 39/125 (31%), Gaps = 13/125 (10%)

Query: 144 PEETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNIGDNLLARTSVSGDPI 203
           P     I  + + Q                L+   +    G  + G  +L + +     +
Sbjct: 90  PRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQ-VLKKIAQKALDL 148

Query: 204 ISNPDDIGF---------AHVKQGYLEASN--VDAVKEISEMI-SAQRAYEMNSKVIEAA 251
            S+ + + F            KQ Y    N           +I  A+ A+ +N ++ E  
Sbjct: 149 PSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEEL 208

Query: 252 DEMSS 256
            E+ +
Sbjct: 209 QELLT 213


>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3
           (respiratory fumarate reductase) {Shewanella
           putrefaciens [TaxId: 24]}
          Length = 322

 Score = 25.3 bits (54), Expect = 4.7
 Identities = 12/65 (18%), Positives = 22/65 (33%), Gaps = 11/65 (16%)

Query: 78  VRNVYTQGEVVHTGNNLDLAL-VGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNT 136
           ++          TG+ LD+AL  G                  G   ID+K ++ +     
Sbjct: 227 LKGFKATNHPGATGDGLDVALQAGAAT----------RDLEMGGLVIDTKAEVKSEKTGK 276

Query: 137 LVPGI 141
            + G+
Sbjct: 277 PITGL 281


>d1tbaa_ a.15.1.1 (A:) TAF(II)230 TBP-binding fragment {Fruit fly
           (Drosophila melanogaster) [TaxId: 7227]}
          Length = 67

 Score = 24.9 bits (54), Expect = 6.9
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 122 NIDSKGQLVTADGNTLVPGIVIPEETRE 149
           NIDS+G+L+  D      G     E RE
Sbjct: 17  NIDSEGRLLQDDDGEGRGGTGFDAELRE 44


>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp.
           pisi [TaxId: 169388]}
          Length = 197

 Score = 24.9 bits (54), Expect = 7.9
 Identities = 14/70 (20%), Positives = 24/70 (34%), Gaps = 5/70 (7%)

Query: 171 VGQLLIANFINEAGLRNIGDNLLARTSV---SGDPIISNPDDIGFAHVKQGYLEASNVDA 227
            G +L     N      I +    RT V   +GD + +    +   H    Y   +   A
Sbjct: 126 AGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGDLVCTGSLIVAAPH--LAYGPDARGPA 183

Query: 228 VKEISEMISA 237
            + + E + A
Sbjct: 184 PEFLIEKVRA 193


>d2qmwa1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus
           aureus [TaxId: 1280]}
          Length = 184

 Score = 24.4 bits (52), Expect = 9.8
 Identities = 5/23 (21%), Positives = 8/23 (34%), Gaps = 2/23 (8%)

Query: 11  MSAQQTNLEIIANNIANI--NTT 31
            S +      I  +I +   N T
Sbjct: 146 GSGEAYGFTPIDTHIEDYPHNVT 168


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.313    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0415    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 879,467
Number of extensions: 39154
Number of successful extensions: 64
Number of sequences better than 10.0: 1
Number of HSP's gapped: 64
Number of HSP's successfully gapped: 13
Length of query: 262
Length of database: 2,407,596
Length adjustment: 84
Effective length of query: 178
Effective length of database: 1,254,276
Effective search space: 223261128
Effective search space used: 223261128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)