RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780379|ref|YP_003064792.1| flagellar hook-basal body protein FliE [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >gnl|CDD|145299 pfam02049, FliE, Flagellar hook-basal body complex protein FliE. Length = 97 Score = 49.2 bits (118), Expect = 2e-07 Identities = 17/84 (20%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Query: 26 TQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKT-SMREAVDHIMQAER 84 ++ + SF+ +L+ +KA+ ++ A GK+ + E + + +A Sbjct: 14 ASAASASAAAGGASFADVLKQALDKVNDLQQKADALAEAFATGKSVDLHEVMIAVQKASL 73 Query: 85 TLNLSIALRDKILSAVSEVSKMQI 108 + ++ +R+K++ A E+ +MQI Sbjct: 74 SFQATVQVRNKLVEAYQEIMRMQI 97 >gnl|CDD|31863 COG1677, FliE, Flagellar hook-basal body protein [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 105 Score = 41.5 bits (97), Expect = 5e-05 Identities = 20/82 (24%), Positives = 46/82 (56%), Gaps = 1/82 (1%) Query: 28 NSNEEGGSSPISFSALLQDMAKGAIGDMEKAENVSLAALQGKTS-MREAVDHIMQAERTL 86 +++++ + SF+ +L++ +KAE S A + G+ + + + + +A +L Sbjct: 24 STSQKASENGASFAEVLKNAIDDVNDTQKKAEKASEAFILGQAGDLHDVMIAMQKASVSL 83 Query: 87 NLSIALRDKILSAVSEVSKMQI 108 +I +R+K++SA E+ +MQI Sbjct: 84 QTAIQVRNKLVSAYQEIMRMQI 105 >gnl|CDD|147030 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region. GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B. Length = 230 Score = 26.0 bits (58), Expect = 2.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 68 GKTSMREAVDHIMQAERTLNL 88 GK+SMR + TL L Sbjct: 11 GKSSMRSIIFSNYSPRDTLRL 31 >gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 263 Score = 24.1 bits (52), Expect = 8.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 41 SALLQDMAKGAIGDMEKAENVSLAALQGKT 70 + + QD G ++ EN++LA +GK Sbjct: 83 ARVFQDPLAGTAPELTIEENLALAESRGKK 112 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.125 0.322 Gapped Lambda K H 0.267 0.0787 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,060,236 Number of extensions: 43807 Number of successful extensions: 89 Number of sequences better than 10.0: 1 Number of HSP's gapped: 87 Number of HSP's successfully gapped: 8 Length of query: 108 Length of database: 6,263,737 Length adjustment: 75 Effective length of query: 33 Effective length of database: 4,643,062 Effective search space: 153221046 Effective search space used: 153221046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.3 bits)