RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780379|ref|YP_003064792.1| flagellar hook-basal body protein FliE [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >2v8t_A Manganese-containing pseudocatalase; manganese catalase, oxidoreductase; 0.98A {Thermus thermophilus} PDB: 2v8u_A 2cwl_A (A:1-138) Length = 138 Score = 26.4 bits (58), Expect = 1.3 Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Query: 1 MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDME 56 + + G + + M Y Q+ N G + + L+ ++A +G +E Sbjct: 25 AVQALLGGRFGEM----STLMNY-MYQSFNFRGKKALKPYYDLIANIATEELGHIE 75 >1nml_A DI-HAEM cytochrome C peroxidase; oxidoreductase, electron transport; HET: HEM CIT; 2.20A {Marinobacter hydrocarbonoclasticus} (A:79-102,A:180-326) Length = 171 Score = 26.2 bits (57), Expect = 1.5 Identities = 7/27 (25%), Positives = 12/27 (44%) Query: 71 SMREAVDHIMQAERTLNLSIALRDKIL 97 S+ EAV + A+ L+ I+ Sbjct: 112 SLEEAVAVMGTAQLGTELNNDEVKSIV 138 >1zzh_A Cytochrome C peroxidase; heme groups, oxidoreductase; HET: HEC; 2.70A {Rhodobacter capsulatus} (A:82-115,A:183-328) Length = 180 Score = 26.1 bits (57), Expect = 1.8 Identities = 7/28 (25%), Positives = 13/28 (46%) Query: 71 SMREAVDHIMQAERTLNLSIALRDKILS 98 +REAV + ++ L D+I + Sbjct: 122 DLREAVSVMANSQLGATLDDTQVDQITA 149 >3lov_A Protoporphyrinogen oxidase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} (A:1-41,A:248-300,A:415-475) Length = 155 Score = 24.5 bits (53), Expect = 5.0 Identities = 3/35 (8%), Positives = 7/35 (20%) Query: 51 AIGDMEKAENVSLAALQGKTSMREAVDHIMQAERT 85 G + KT + + + Sbjct: 117 LAGLAYDGVGLPDCVASAKTXIESIELEQSHTDES 151 >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} (A:508-600) Length = 93 Score = 23.6 bits (51), Expect = 8.8 Identities = 4/27 (14%), Positives = 8/27 (29%) Query: 42 ALLQDMAKGAIGDMEKAENVSLAALQG 68 A + A+ + V + G Sbjct: 67 AYFERAARHQTQSGSATDWVQVRDTTG 93 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.313 0.125 0.322 Gapped Lambda K H 0.267 0.0595 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 665,698 Number of extensions: 23300 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's gapped: 40 Number of HSP's successfully gapped: 8 Length of query: 108 Length of database: 4,956,049 Length adjustment: 64 Effective length of query: 44 Effective length of database: 2,792,529 Effective search space: 122871276 Effective search space used: 122871276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.3 bits)