BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780379|ref|YP_003064792.1| flagellar hook-basal body protein FliE [Candidatus Liberibacter asiaticus str. psy62] (108 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780379|ref|YP_003064792.1| flagellar hook-basal body protein FliE [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 219 bits (559), Expect = 7e-60, Method: Compositional matrix adjust. Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAEN 60 MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAEN Sbjct: 1 MMIEQIQGTNSFISHTDTIGMRYDFTQNSNEEGGSSPISFSALLQDMAKGAIGDMEKAEN 60 Query: 61 VSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI 108 VSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI Sbjct: 61 VSLAALQGKTSMREAVDHIMQAERTLNLSIALRDKILSAVSEVSKMQI 108 >gi|255764472|ref|YP_003064841.2| 2-methylthioadenine synthetase (miaB-like) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 469 Score = 23.5 bits (49), Expect = 0.87, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 19/29 (65%) Query: 70 TSMREAVDHIMQAERTLNLSIALRDKILS 98 ++M E VD ++AER L L LR++ +S Sbjct: 376 SNMLEQVDENVKAERLLCLQKKLREQQVS 404 >gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62] Length = 219 Score = 21.6 bits (44), Expect = 3.4, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 82 AERTLNLSIALRDKILSAVSEVSKMQ 107 E +LN S RDK L ++E+ ++ Sbjct: 33 PEESLNQSEEFRDKYLRVIAEMENLR 58 >gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] Length = 99 Score = 20.8 bits (42), Expect = 6.1, Method: Compositional matrix adjust. Identities = 9/12 (75%), Positives = 11/12 (91%) Query: 95 KILSAVSEVSKM 106 KIL A+SEVSK+ Sbjct: 87 KILRALSEVSKL 98 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.125 0.322 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,509 Number of Sequences: 1233 Number of extensions: 1846 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 108 length of database: 328,796 effective HSP length: 62 effective length of query: 46 effective length of database: 252,350 effective search space: 11608100 effective search space used: 11608100 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 32 (16.9 bits)