RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] (134 letters) >1v33_A DNA primase small subunit; nucleotidyl transferase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: DNA; 1.80A {Pyrococcus horikoshii} (A:1-179,A:304-344) Length = 220 Score = 27.1 bits (60), Expect = 0.82 Identities = 6/27 (22%), Positives = 12/27 (44%), Gaps = 1/27 (3%) Query: 55 MHGSGGVRVKKIGVDQSTFVEEFDPGH 81 +H G+ K +G ++ F+P Sbjct: 193 LHSKVGLIAKYVGTNERDV-MRFNPFK 218 >2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (A:550-614) Length = 65 Score = 24.3 bits (52), Expect = 5.9 Identities = 4/7 (57%), Positives = 5/7 (71%) Query: 94 NVNVLVE 100 NV V +E Sbjct: 1 NVEVKIE 7 >2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* (A:) Length = 174 Score = 23.9 bits (51), Expect = 7.1 Identities = 9/47 (19%), Positives = 21/47 (44%) Query: 51 FEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNV 97 F EV +V + V+ T V++ D V +++ + +++ Sbjct: 85 FAEVYFAQSQQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISI 131 >2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (B:550-611) Length = 62 Score = 23.9 bits (51), Expect = 7.2 Identities = 4/7 (57%), Positives = 5/7 (71%) Query: 94 NVNVLVE 100 NV V +E Sbjct: 1 NVEVKIE 7 >3gek_A Putative thioesterase YHDA; X-RAY, structure genomics, NESG, KR113, Q9CHK5_lacla, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} (A:) Length = 146 Score = 23.7 bits (51), Expect = 8.1 Identities = 5/43 (11%), Positives = 9/43 (20%), Gaps = 2/43 (4%) Query: 60 GVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETA 102 + + + H A G + L E Sbjct: 19 NSDKFVSKIYKFSSKXILSDFH--AQPQGFLNGGASLALAEIT 59 >1fui_A L-fucose isomerase; ketol isomerase, fucose metabolism, L-fucose to L-fuculose conversion; HET: FOC; 2.50A {Escherichia coli K12} (A:174-591) Length = 418 Score = 23.9 bits (51), Expect = 8.2 Identities = 5/62 (8%), Positives = 16/62 (25%) Query: 67 GVDQSTFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMT 126 + + E+ G ++ + L +A +++ D+ Sbjct: 257 ATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWSVELPKDVHD 316 Query: 127 TT 128 Sbjct: 317 IL 318 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.130 0.359 Gapped Lambda K H 0.267 0.0598 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 957,440 Number of extensions: 38614 Number of successful extensions: 72 Number of sequences better than 10.0: 1 Number of HSP's gapped: 72 Number of HSP's successfully gapped: 8 Length of query: 134 Length of database: 4,956,049 Length adjustment: 79 Effective length of query: 55 Effective length of database: 2,285,454 Effective search space: 125699970 Effective search space used: 125699970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)