RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] (134 letters) >d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]} Length = 654 Score = 25.1 bits (54), Expect = 2.0 Identities = 9/56 (16%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Query: 71 STFVEEFDPGHPVANASGIVKYPNVNVLVETADMRETNRLYMANLQTIKQSHDMMT 126 T+ EF GH + ++ + D E + N ++ M+ Sbjct: 446 ETYFHEF--GHVMHQLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEQEPLLRMS 499 >d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} Length = 168 Score = 24.6 bits (53), Expect = 3.0 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 17 VQSARMQIISENIANARTTGDTPGSDPYRRKTISFEEVMHGSGGVRVKKIGVDQSTFVEE 76 V + R ++N AR G S P + + ++V G+G + +KKIG + TF+ + Sbjct: 99 VTAIRRVRKTDNNRIARACGARIVSRP---EELREDDVGTGAGLLEIKKIGDEYFTFITD 155 >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Score = 24.0 bits (51), Expect = 4.2 Identities = 13/57 (22%), Positives = 22/57 (38%), Gaps = 16/57 (28%) Query: 38 TPGSDPYRRKTISFEEV-MHGSGG---------------VRVKKIGVDQSTFVEEFD 78 TPG P R + +S+ + + G+G V +KK+ D+ E Sbjct: 9 TPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQ 65 >d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} Length = 172 Score = 23.9 bits (52), Expect = 5.7 Identities = 7/47 (14%), Positives = 15/47 (31%), Gaps = 9/47 (19%) Query: 74 VEEFDPGHPVANASGIV-----KYPNVNVLV-ETA---DMRETNRLY 111 ++ G +N I+ V V + +M + R+ Sbjct: 96 LKSGKNGEHASNLGAIIAHRFSSETGVPAYVVDPVVVDEMEDVARVS 142 >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 Score = 23.7 bits (50), Expect = 6.0 Identities = 14/50 (28%), Positives = 19/50 (38%) Query: 45 RRKTISFEEVMHGSGGVRVKKIGVDQSTFVEEFDPGHPVANASGIVKYPN 94 R K I FE HG + + K G +T PG P + + P Sbjct: 134 RDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPY 183 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.130 0.359 Gapped Lambda K H 0.267 0.0475 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 468,104 Number of extensions: 19271 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 6 Length of query: 134 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 58 Effective length of database: 1,364,116 Effective search space: 79118728 Effective search space used: 79118728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (22.9 bits)