BLAST/PSIBLAST alignment of GI: 254780383 and GI: 227823996 at iteration 1
>gi|227823996|ref|YP_002827969.1| putative endonuclease III protein [Sinorhizobium fredii NGR234] Length = 317
>gi|227342998|gb|ACP27216.1| putative endonuclease III protein [Sinorhizobium fredii NGR234] Length = 317
 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 127/205 (61%), Positives = 171/205 (83%)

Query: 19  LYTPKELEEIFYLFSLKWPSPKGELYYVNHFTLIVAVLLSAQSTDVNVNKATKHLFEIAD 78
           +Y+  ++EEIF  FS++ P PKGEL +VN FTL+VAV LSAQ+TD  VNKAT+ LF +AD
Sbjct: 89  VYSKADVEEIFRRFSVQRPEPKGELEHVNAFTLLVAVALSAQATDAGVNKATRPLFAVAD 148

Query: 79  TPQKMLAIGEKKLQNYIRTIGIYRKKSENIISLSHILINEFDNKIPQTLEGLTRLPGIGR 138
           TP+KMLA+GE+KL+++I+TIG+YR K++N+I+LS  LI +F   +P+T E L  LPG+GR
Sbjct: 149 TPEKMLALGEEKLRDHIKTIGLYRNKAKNVIALSERLIADFGGAVPKTREELMTLPGVGR 208

Query: 139 KGANVILSMAFGIPTIGVDTHIFRISNRIGLAPGKTPNKVEQSLLRIIPPKHQYNAHYWL 198
           K ANV+L MAFG  TI VDTH+FRI+NRI LAPGKTP++VE  L+R+IPPK+ Y+AH+WL
Sbjct: 209 KTANVVLQMAFGQSTIAVDTHLFRIANRIRLAPGKTPDEVEAKLMRVIPPKYLYHAHHWL 268

Query: 199 VLHGRYVCKARKPQCQSCIISNLCK 223
           +LHGRYVCKAR+P+C+ CII+++CK
Sbjct: 269 ILHGRYVCKARRPECERCIIADICK 293