RPSBLAST alignment of GI: 254780383 and protein with PDBid: 1orn

>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Length = 226
 Score =  181 bits (460), Expect = 1e-46
 Identities = 84/204 (41%), Positives = 133/204 (65%), Gaps = 1/204 (0%)

Query: 21  TPKELEEIFYLFSLKWPSPKGELYYVNHFTLIVAVLLSAQSTDVNVNKATKHLFEIADTP 80
           T +++       +  +P    EL + N F L++AV+LSAQ TD  VNK TK LFE   TP
Sbjct: 6   TKQQIRYCLDEMAKMFPDAHCELVHRNPFELLIAVVLSAQCTDALVNKVTKRLFEKYRTP 65

Query: 81  QKMLAIGEKKLQNYIRTIGIYRKKSENIISLSHILINEFDNKIPQTLEGLTRLPGIGRKG 140
              +A+  ++L+  IR+IG+YR K+ NI  L  +LI++++ ++P+  + L +LPG+GRK 
Sbjct: 66  HDYIAVPLEELEQDIRSIGLYRNKARNIQKLCAMLIDKYNGEVPRDRDELMKLPGVGRKT 125

Query: 141 ANVILSMAFGIPTIGVDTHIFRISNRIGLAPG-KTPNKVEQSLLRIIPPKHQYNAHYWLV 199
           ANV++S+AFG+P I VDTH+ R+S R+G      +  +VE++L++IIP +     H+ ++
Sbjct: 126 ANVVVSVAFGVPAIAVDTHVERVSKRLGFCRWDDSVLEVEKTLMKIIPKEEWSITHHRMI 185

Query: 200 LHGRYVCKARKPQCQSCIISNLCK 223
             GRY CKA+ PQC SC + +LC+
Sbjct: 186 FFGRYHCKAQSPQCPSCPLLHLCR 209