RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780386|ref|YP_003064799.1| Type I secretion membrane fusion protein, HlyD [Candidatus Liberibacter asiaticus str. psy62] (440 letters) >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Score = 37.8 bits (88), Expect = 0.002 Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 48 GEILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 E+ N+ VVEI SP G + + V G+ G L+T + Sbjct: 36 CEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLD 76 >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Score = 36.1 bits (83), Expect = 0.006 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 59 IKSPFSGIIKKFQVENGSQILQGTPLLTFE 88 I++ SG +K VE+G + PL+ E Sbjct: 51 IEADKSGTVKAILVESGQPVEFDEPLVVIE 80 >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Score = 35.5 bits (82), Expect = 0.009 Identities = 14/47 (29%), Positives = 20/47 (42%) Query: 49 EILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFEDIETTDL 95 E+ ++ V I S + G+IKK G PL+ E DL Sbjct: 40 EVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDL 86 >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 237 Score = 34.7 bits (78), Expect = 0.016 Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 55 NVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 + E++ +GII K + GS + G L + Sbjct: 14 RIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDP 48 >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Score = 32.8 bits (75), Expect = 0.053 Identities = 8/41 (19%), Positives = 17/41 (41%) Query: 49 EILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 EI + V+E+ + GI+ + G+ + L + Sbjct: 38 EIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGRLRE 78 >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Score = 31.4 bits (71), Expect = 0.15 Identities = 10/43 (23%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Query: 48 GEILNEDNVVEIKSPFSGIIKKFQVENGSQILQ-GTPLLTFED 89 EI + + + G + K V G++ + GTPL + Sbjct: 40 AEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVE 82 >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Score = 31.3 bits (71), Expect = 0.16 Identities = 9/41 (21%), Positives = 18/41 (43%) Query: 49 EILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLTFED 89 +I + V+E+ + G+I + G +L G L + Sbjct: 37 DIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTE 77 >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Score = 31.0 bits (70), Expect = 0.21 Identities = 8/38 (21%), Positives = 15/38 (39%) Query: 49 EILNEDNVVEIKSPFSGIIKKFQVENGSQILQGTPLLT 86 + EI +P G ++K V+ + G L+ Sbjct: 38 VLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIK 75 >d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Length = 584 Score = 29.0 bits (64), Expect = 0.81 Identities = 15/169 (8%), Positives = 53/169 (31%), Gaps = 10/169 (5%) Query: 98 LKKVSIKNLRCHIDTEKSALDFLNNKYDVLEKAFESREEQLLDFLGKYHSTCSKVFNYGI 157 L+ + + L + ++ +S++ Q + + + Sbjct: 254 LRLLQCYPPPEDPAVRGRLTECLETILNKAQEPPKSKKVQHSNAKNAVLFEAISLIIHHD 313 Query: 158 SSVYRSLKMKLTRMRSIYLNRLDLENKSSLLRALLSSHQKDLTMMKNLFEKNAVSQNDLN 217 S +L ++ +L + + L ++ + + + V Sbjct: 314 SE--PNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEFSHEAVKTHIETVINALKT 371 Query: 218 QQERIVYKSTLELRENIHEQKNMLRHINELYDEANLEFANYLKEISRDL 266 +++ V + ++L + ++ N + + E+ +YL+ + Sbjct: 372 ERDVSVRQRAVDLLYAMCDRSNAQQIVAEM--------LSYLETADYSI 412 >d1qxoa_ d.258.1.1 (A:) Chorismate synthase, AroC {Streptococcus pneumoniae [TaxId: 1313]} Length = 388 Score = 26.9 bits (59), Expect = 3.7 Identities = 18/99 (18%), Positives = 28/99 (28%), Gaps = 12/99 (12%) Query: 251 ANLEFANYLKEISRDLEQNQ------RTFADEMSKLTILEKTREQKTILSPIAGTIVYNQ 304 A L ++I+ DL + Q E ++ R KT +PI V N+ Sbjct: 23 AGLPLT--AEDINEDLRRRQGGYGRGGRMKIENDQVVFTSGVRHGKTTGAPI-TMDVINK 79 Query: 305 SFSSSNYAQQSQPLMKIVPHSKLTYIRAKVTPKQIQHVK 343 ++ I K P V Sbjct: 80 DHQKWLDIMSAED---IEDRLKSKRKITHPRPGHADLVG 115 >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Score = 26.5 bits (58), Expect = 4.3 Identities = 11/66 (16%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Query: 298 GTIVYNQSFSSSNYAQQSQPLMK--IVPHSKLTYIRAKVTPKQIQHVKKGYTATVRFPHY 355 GT+ F+ A+ + MK + I + Q Q +++ + + Sbjct: 5 GTVRPAGDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNAQRQQIRQTFKSHFGRDLM 64 Query: 356 ADIREK 361 AD++ + Sbjct: 65 ADLKSE 70 >d3c0na2 f.8.1.1 (A:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]} Length = 384 Score = 25.6 bits (56), Expect = 8.5 Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 10/51 (19%) Query: 296 IAGTIVYNQSFSSSN-------YAQQSQPLMKIVPHSKLTYIRAKVTPKQI 339 ++ I NQS++S N +Q +P + SK+ + ++ I Sbjct: 171 LSIEIAANQSWASQNGGSTTTSLSQSVRP--TVPARSKIPV-KIELYKADI 218 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.133 0.368 Gapped Lambda K H 0.267 0.0535 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,583,417 Number of extensions: 74726 Number of successful extensions: 219 Number of sequences better than 10.0: 1 Number of HSP's gapped: 219 Number of HSP's successfully gapped: 30 Length of query: 440 Length of database: 2,407,596 Length adjustment: 88 Effective length of query: 352 Effective length of database: 1,199,356 Effective search space: 422173312 Effective search space used: 422173312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.0 bits)