BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780387|ref|YP_003064800.1| C4-dicarboxylate transporter
DctA [Candidatus Liberibacter asiaticus str. psy62]
         (426 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780387|ref|YP_003064800.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040064|gb|ACT56860.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 426

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 426/426 (100%), Positives = 426/426 (100%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT
Sbjct: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK
Sbjct: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120

Query: 121 SLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKS 180
           SLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKS
Sbjct: 121 SLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKS 180

Query: 181 DTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSA 240
           DTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSA
Sbjct: 181 DTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSA 240

Query: 241 FFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVS 300
           FFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVS
Sbjct: 241 FFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVS 300

Query: 301 MVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAF 360
           MVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAF
Sbjct: 301 MVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAF 360

Query: 361 ITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFN 420
           ITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFN
Sbjct: 361 ITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFN 420

Query: 421 KYIGIE 426
           KYIGIE
Sbjct: 421 KYIGIE 426


>gi|14025620|dbj|BAB52220.1| C4-dicarboxylate transport protein [Mesorhizobium loti MAFF303099]
          Length = 497

 Score =  303 bits (776), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 232/412 (56%), Positives = 316/412 (76%), Gaps = 1/412 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R  L+   Y+QVLVAI  G+A+GHF PQIG  ++PLGD F+K  KM+I PVIFLTVSTGI
Sbjct: 34  RKTLFAKPYVQVLVAILLGVAVGHFYPQIGENLKPLGDAFIKLVKMIIAPVIFLTVSTGI 93

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D++ +G++  KAM  F  FS  AL++GLIVGN+ +PG G+N+DL SL+ +++  + 
Sbjct: 94  AGMSDLQKVGRVAGKAMVYFVTFSTLALIVGLIVGNVIQPGAGLNIDLTSLDVQAVNGYA 153

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S  GF+ +MIP T + A   G+ILQ L  ++LFGI+L++VGE   ++   L+++
Sbjct: 154 SKAHEQSVTGFLMNMIPTTIVGAFVEGDILQVLFFSVLFGIALAMVGESGKSVLSFLQDL 213

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V I+M+ AP+GAFGAM+FTIGKYG+ S++NL  LV   Y T+  F+ GVLG +
Sbjct: 214 TAPVFKLVGILMKAAPIGAFGAMAFTIGKYGIGSVANLAMLVGTFYLTAFLFVFGVLGAV 273

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI  LI ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 274 CRYNGFSIFSLIRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 333

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN  LS+ DQ+ LLL+AM+SSKGAAGVTG+ F+TLAAT+++V
Sbjct: 334 LDGTNIYMTLAALFIAQATNTDLSVGDQVLLLLVAMLSSKGAAGVTGAGFVTLAATLSVV 393

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           P++P+AGM LILGVDRFMSECR++TN +GNAV ++VV+RWE +LD       
Sbjct: 394 PAVPVAGMALILGVDRFMSECRALTNLVGNAVASLVVARWEGELDQAQLKAA 445


>gi|238028731|ref|YP_002912962.1| C4-dicarboxylate transporter DctA [Burkholderia glumae BGR1]
 gi|237877925|gb|ACR30258.1| C4-dicarboxylate transport protein [Burkholderia glumae BGR1]
          Length = 465

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 215/416 (51%), Positives = 306/416 (73%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV TGI
Sbjct: 40  KKPFYKVLYVQVICAIIVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTGI 99

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G++  KA+  F + S FALV+GL   ++ +PG G N+D  +LN + +A   
Sbjct: 100 AGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHLLRPGAGFNIDPATLNGKEVASYA 159

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S + F+  +IP+T   A   G ILQ L++ALLFG  L+ +GE+   +   +E I
Sbjct: 160 AKAHGQSTVDFLMHIIPNTMFDAFGQGEILQILLIALLFGSVLAHIGERGKVVTDFIEGI 219

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V I+ ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F++ VLG +
Sbjct: 220 SRVLFGIVHIITKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVVVVLGAV 279

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI++ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSFN
Sbjct: 280 ARYTGFSILRFVAYIKEEMLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSFN 339

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QATN+ LS   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +V
Sbjct: 340 LDGTNIYMTMAVLFIAQATNIELSWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAVV 399

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           P++P+ GM LILG+DRFMSECR++TN +GN V T+VVS WEK+LD       +  E
Sbjct: 400 PTIPLTGMVLILGIDRFMSECRALTNIVGNGVATIVVSAWEKELDRSKLRAALNGE 455


>gi|148262464|ref|YP_001229170.1| sodium:dicarboxylate symporter [Geobacter uraniireducens Rf4]
 gi|146395964|gb|ABQ24597.1| sodium:dicarboxylate symporter [Geobacter uraniireducens Rf4]
          Length = 437

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 197/417 (47%), Positives = 305/417 (73%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++   Y+ LY QVL+AI  GM LG+F P+ GV M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKKFYQHLYFQVLLAITVGMLLGNFYPETGVAMKPLGDGFIKLIKMIIAPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M+DMK +G++  KA+  F V + FAL IGL+V ++ +PG+G N ++ +L+T+++ A+
Sbjct: 61  IAGMEDMKKVGRVGAKALLYFEVVTTFALGIGLLVVSVIEPGVGFNANVATLDTKALNAY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
             ++ +     F+ ++IP + + A   G+ILQ L+ A++FG +LS +G +   I + +++
Sbjct: 121 TSAAKSHGVTDFLLNIIPSSVVDAFAKGDILQVLLFAVMFGFALSALGARGKGIYRFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F +V ++M+ AP+GAFGAM+FTIGK+G+ S+S L  L+   Y T   F+  VLG 
Sbjct: 181 LSHVLFGIVGVIMKAAPIGAFGAMAFTIGKFGIGSLSQLGLLMGSFYLTCLLFVFVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR C F+I K I +++EE+L+VL TSSSESALP +M K+E+ GC +S+V +V+PTGYSF
Sbjct: 241 IARICGFNIFKFIRYIREELLIVLGTSSSESALPRMMAKLEKLGCTKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +F++QATN  L+ T +L++L + +++SKGAAGVTGS F+TLAAT   
Sbjct: 301 NLDGTSIYLTMAAIFVAQATNTHLTWTQKLTILFVLLLTSKGAAGVTGSGFVTLAATFAA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P++P+AG+ LILG+DRFMSE R++TN +GN + TVVVS+WE +L+ +   + +  E
Sbjct: 361 IPTIPVAGLALILGIDRFMSEARALTNLVGNGIATVVVSKWENELNEEQMQRVLNGE 417


>gi|239820022|ref|YP_002947207.1| sodium:dicarboxylate symporter [Variovorax paradoxus S110]
 gi|239804875|gb|ACS21941.1| sodium:dicarboxylate symporter [Variovorax paradoxus S110]
          Length = 465

 Score =  302 bits (772), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 206/423 (48%), Positives = 285/423 (67%), Gaps = 1/423 (0%)

Query: 5   VQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIF 64
           V        P Y+ LY QV+ AI  G+ LGHF P  G  M+PLGD F+K  KM+I P+IF
Sbjct: 18  VDQPSVAPKPFYRSLYFQVITAIVLGVLLGHFWPDTGASMKPLGDGFIKLIKMIIAPIIF 77

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            TV  GIA M+DMK +G+    A+  F + S  ALV+GL++ NI +PG GMNVD+  L+ 
Sbjct: 78  CTVVVGIAGMEDMKKVGKTGGLALLYFEIVSSIALVVGLVIINIVRPGAGMNVDVSQLDA 137

Query: 125 ESIAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTI 183
           +SIA        +S   F+ ++IP T + A   G ILQ L++A++FG +L   G +   +
Sbjct: 138 KSIAAYTGPGKMQSTTDFLLNVIPSTVVDAFAKGEILQVLLIAVMFGFALHKFGGRGTLV 197

Query: 184 RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFI 243
              +E+ +  +F +V  +M++AP+GAFGAM+FTIGKYG+SS+  L  L+   Y T   FI
Sbjct: 198 FDVIEKGSHVLFVIVGYIMKVAPIGAFGAMAFTIGKYGVSSLLQLGQLMATFYLTCLLFI 257

Query: 244 LGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVV 303
             VLG +ARF  FSI K I ++KEE+L+VL TSSSES LP +M K+E  G  +S+V +VV
Sbjct: 258 FVVLGSIARFHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENLGAKKSVVGLVV 317

Query: 304 PTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITL 363
           PTGYSFNLDG++IY+T+A +FI+QATN  ++LT Q +LL + +++SKGAAGVTGS FI L
Sbjct: 318 PTGYSFNLDGTSIYLTMAAVFIAQATNTDMTLTQQFTLLAVLLLTSKGAAGVTGSGFIVL 377

Query: 364 AATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           AAT++ V  +P+AG+ LILG+DRFMSE R++TN IGN V TVVV++W   LD     + +
Sbjct: 378 AATLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWTNDLDTVRMKRIL 437

Query: 424 GIE 426
             E
Sbjct: 438 DNE 440


>gi|226940800|ref|YP_002795874.1| Sodium:dicarboxylate symporter [Laribacter hongkongensis HLHK9]
 gi|254767687|sp|C1D8S5|DCTA_LARHH RecName: Full=C4-dicarboxylate transport protein
 gi|226715727|gb|ACO74865.1| Sodium:dicarboxylate symporter [Laribacter hongkongensis HLHK9]
          Length = 441

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 213/415 (51%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
                LYK LY QV+VAI  G+ LGHF+P  G  M+PLGD F+K  KM+ITP+IF TV  
Sbjct: 1   MQSRKLYKSLYFQVIVAIICGVLLGHFMPDSGTAMKPLGDGFIKLVKMMITPIIFCTVVV 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V +  AL+IGL+V N+ KPG GMNVD  +L+T +IA 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEVVTTLALIIGLVVVNVLKPGAGMNVDPATLDTGAIAK 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +  +S + F+  +IP++ + A   G ILQ L+ ++LFG +LS++G+    + K +E
Sbjct: 121 YTAKAGEQSVVDFVLHIIPNSVVGAFAEGEILQVLLFSVLFGFALSMMGQSGKPVVKLVE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
           +I+  +F  +  +M++AP+GAFGAM+FTIGKYG+SS+S+L  L+   Y T   FI  VLG
Sbjct: 181 DISHALFAAIGFIMKLAPIGAFGAMAFTIGKYGVSSLSSLAALMGSFYLTCLLFIGLVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            + RFC FSI KL+ ++KEE+L+VL TSSSESALP LM K+E+ GC +S+V +VVPTGYS
Sbjct: 241 TITRFCGFSIWKLVRYIKEELLIVLGTSSSESALPRLMAKLEQLGCQKSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG++IY+T+A +FI+QA  + L+LT +L+++ + +++SKGAAGVTGS FITLAAT+ 
Sbjct: 301 FNLDGTSIYLTMAAIFIAQACGIELTLTQELTIIGVLLLTSKGAAGVTGSGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
            VP +P+AG+ LILG+DRFMSE R++TN +GN V TVVV++WE  LD       +
Sbjct: 361 TVPDIPVAGLALILGIDRFMSEARALTNLVGNTVATVVVAKWENALDSDKLAAEL 415


>gi|290476625|ref|YP_003469530.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Xenorhabdus bovienii SS-2004]
 gi|289175963|emb|CBJ82766.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Xenorhabdus bovienii SS-2004]
          Length = 446

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 235/419 (56%), Positives = 322/419 (76%), Gaps = 1/419 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
           +   + PLY+ILYIQV+ AI  G+ALGHF P IG  ++PLGD F+K  KM+I PVIFLTV
Sbjct: 3   NTSKKKPLYQILYIQVIFAILLGIALGHFYPDIGESLKPLGDAFIKIVKMIIAPVIFLTV 62

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
            TGIA M +MK +G +  K+M  F  FS  AL+IGLI  NI +PG G+N+  +SL++  +
Sbjct: 63  VTGIAGMNNMKAVGSVVGKSMLYFLTFSTLALIIGLIAANIIRPGDGLNISPESLDSSKV 122

Query: 128 -AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
             +++ +H  S +GF+ ++IP+T +S L +GNILQ L +A++FGI+L+  G+K + I   
Sbjct: 123 IGYVEKAHESSIVGFLMNIIPETVVSPLVNGNILQVLFIAVIFGIALASTGKKGEPILVF 182

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
           L+  + PVF+MV I+M++AP+GAFGAM+FTIGKYG+SSI NL+ L+   Y TS  FI  V
Sbjct: 183 LQNFSEPVFKMVGILMKLAPIGAFGAMAFTIGKYGISSIGNLMMLIVTFYMTSLLFIFVV 242

Query: 247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTG 306
           LG +A++  FSIIKLI ++K+E+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PTG
Sbjct: 243 LGAVAKYNGFSIIKLIKYIKDELWLVLGTSSSEAALPSLMRKMENAGCEKSVVGLVIPTG 302

Query: 307 YSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAAT 366
           YSFNLDG+NIY+T+A LFI+QAT + LS T+Q+SLLL+AM+SSKGAAGVTG+ FITLAAT
Sbjct: 303 YSFNLDGTNIYMTMAALFIAQATGIELSFTEQISLLLVAMISSKGAAGVTGAGFITLAAT 362

Query: 367 ITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +++VPSLP+AGM LILG+DRFMSECR++TN +GNA  ++VV+RWE  LD    ++ +  
Sbjct: 363 LSVVPSLPVAGMALILGIDRFMSECRALTNLVGNACASIVVARWENALDKDKMHQALNG 421


>gi|170742881|ref|YP_001771536.1| sodium:dicarboxylate symporter [Methylobacterium sp. 4-46]
 gi|168197155|gb|ACA19102.1| sodium:dicarboxylate symporter [Methylobacterium sp. 4-46]
          Length = 449

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 227/415 (54%), Positives = 314/415 (75%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R P Y+ LY QVLVA+  G+ LGHF PQ+G +M+PLGD F+K  KM+I PVIFLTV +GI
Sbjct: 18  RRPFYRTLYFQVLVAVAIGILLGHFYPQLGAEMKPLGDAFIKLVKMIIAPVIFLTVVSGI 77

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M +++ +G++  KA+  F  FS  AL++GL+V N+ +PG G+++D KSL+ +++A   
Sbjct: 78  AGMTNLEKVGRVGAKALIYFLTFSTLALLVGLVVANVLQPGHGLHIDPKSLDPKAVATYA 137

Query: 132 -SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +  +S + F+ ++IP TA+ A   G ILQ L  ++LFG  L+ +GE+   +   ++  
Sbjct: 138 GKAKEQSIVDFLMNIIPSTAVGAFAGGEILQVLFFSVLFGFGLAFMGERGKPVLDIIKTT 197

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V I+M++APLGAFGAM+FTIGKYG++S++NL +LVF  Y TSA F+LGVLG +
Sbjct: 198 SEAIFGVVHIIMKVAPLGAFGAMAFTIGKYGVASLANLAYLVFAFYLTSAIFVLGVLGAV 257

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FS+++L+ ++KEE+LLVL TSSSESALP L+ KME AGC R +V +VVPTGYSFN
Sbjct: 258 ARYNGFSVVRLVRYIKEELLLVLGTSSSESALPSLLDKMERAGCSRPVVGLVVPTGYSFN 317

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QAT+ PLSL +Q  LLL+AM+SSKGAAGVTGS FITLAAT+ +V
Sbjct: 318 LDGTNIYMTMAALFIAQATDTPLSLGEQALLLLVAMLSSKGAAGVTGSGFITLAATLAVV 377

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+ GM LILG+DRFMSECR++TNFIGNAV  +VV+RWE +LD       +  
Sbjct: 378 PSVPVVGMALILGIDRFMSECRALTNFIGNAVACIVVARWEGELDETRLAAALAG 432


>gi|332716088|ref|YP_004443554.1| C4-dicarboxylate transport protein [Agrobacterium sp. H13-3]
 gi|325062773|gb|ADY66463.1| C4-dicarboxylate transport protein [Agrobacterium sp. H13-3]
          Length = 448

 Score =  299 bits (766), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 236/426 (55%), Positives = 325/426 (76%), Gaps = 1/426 (0%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           +  +    G  + P YK LY QVLVAI +G+ALGHF P  G Q++PLGD F++  KM+I 
Sbjct: 2   IDTTTVAAGHAKQPFYKHLYFQVLVAIIAGIALGHFYPAFGEQLKPLGDGFIRLVKMIIA 61

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           PVIFLTV+TGIA M DMK +G++  KAM  F VFS  AL++GLIV N  +PG GMN+D  
Sbjct: 62  PVIFLTVATGIAGMNDMKKVGRVAGKAMIYFLVFSTLALIVGLIVANTVQPGAGMNIDPA 121

Query: 121 SLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
           +L+ +++A +   +H ++  GF+ ++IP T + A  SG+ILQ L  ++LFGI+L +VGEK
Sbjct: 122 TLDAKAVATYADKAHEQTITGFLMNIIPTTIVGAFASGDILQVLFFSVLFGIALGIVGEK 181

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
              +   +  + +P+F++V+I+M+ AP+GAFGAM+FTIGKYG+SS++NL  L+   Y TS
Sbjct: 182 GKPVTDFMHAMMYPIFKLVAILMKAAPIGAFGAMAFTIGKYGISSVTNLAMLIGTFYVTS 241

Query: 240 AFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIV 299
           A F+  VLG + R+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V
Sbjct: 242 ALFVFVVLGAVCRYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMSKMEKAGCKRSVV 301

Query: 300 SMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSA 359
            +V+PTGYSFNLDG+NIY+TLA LFI+QAT + LS  +Q+ LLL+AM+SSKGAAG+TG+ 
Sbjct: 302 GLVIPTGYSFNLDGTNIYMTLAALFIAQATGIHLSFGEQILLLLVAMLSSKGAAGITGAG 361

Query: 360 FITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           FITLAAT+++VPS+P+AGM LILG+DRFMSECR++TNF+GNAV T+VV+RWE +LD +  
Sbjct: 362 FITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVARWEGELDQEQL 421

Query: 420 NKYIGI 425
            + +  
Sbjct: 422 ARVLSG 427


>gi|20804188|emb|CAD31391.1| PROBABLE C4-DICARBOXYLATE TRANSPORT PROTEIN TRANSPORT TRANSMEMBRANE
           INNER MEMBRANE SYMPORT [Mesorhizobium loti R7A]
          Length = 477

 Score =  299 bits (766), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 233/415 (56%), Positives = 317/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R  L+   Y+QVLVAI  G+A+GHF PQIG  ++PLGD F+K  KM+I PVIFLTVSTGI
Sbjct: 14  RKTLFAKPYVQVLVAILLGVAVGHFYPQIGENLKPLGDAFIKLVKMIIAPVIFLTVSTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D++ +G++  KAM  FF FS  AL++GLIVGN+ +PG G+N+DL SL+ +++  + 
Sbjct: 74  AGMSDLQKVGRVAGKAMVYFFTFSTLALIVGLIVGNVIQPGAGLNIDLTSLDVQAVNGYA 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S  GF+ +MIP T + A   G+ILQ L  ++LFGI+L++VGE   ++   L+++
Sbjct: 134 SKAHEQSVTGFLMNMIPTTIVGAFVEGDILQVLFFSVLFGIALAMVGESGKSVLSFLQDL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V I+M+ AP+GAFGAM+FTIGKYG+ S++NL  LV   Y T+  F+ GVLG +
Sbjct: 194 TAPVFKLVGILMKAAPIGAFGAMAFTIGKYGIGSVANLAMLVGTFYLTAFLFVFGVLGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI  LI ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 254 CRYNGFSIFSLIRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN  LS+ DQ+ LLL+AM+SSKGAAGVTG+ F+TLAAT+++V
Sbjct: 314 LDGTNIYMTLAALFIAQATNTDLSVGDQVLLLLVAMLSSKGAAGVTGAGFVTLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P++P+AGM LILGVDRFMSECR++TN +GNAV ++VV+RWE +LD          
Sbjct: 374 PAVPVAGMALILGVDRFMSECRALTNLVGNAVASLVVARWEGELDQAQLKAAFCG 428


>gi|94313225|ref|YP_586434.1| C4-dicarboxylate transport protein 2 [Cupriavidus metallidurans
           CH34]
 gi|172046193|sp|Q1LFB1|DCTA2_RALME RecName: Full=C4-dicarboxylate transport protein 2
 gi|93357077|gb|ABF11165.1| C4-dicarboxylate transport protein 2 [Cupriavidus metallidurans
           CH34]
          Length = 452

 Score =  299 bits (766), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 209/416 (50%), Positives = 290/416 (69%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLY+ LY QV+VAI SG+ LGH+ P  G  M+PLGD F+K  KM+I P+IF TV  GI
Sbjct: 7   RKPLYRSLYFQVIVAIISGVVLGHYYPTAGEAMKPLGDGFIKLIKMIIAPIIFCTVVVGI 66

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G+    A+  F V S  AL++GL++ NI KPG GMNVD  +L+T+ IA   
Sbjct: 67  AGMEDMKKVGKTGGLALLYFEVVSSIALLLGLLIINIVKPGAGMNVDPSTLDTKGIAAYT 126

Query: 132 -SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                +  + F+ ++IP+T + A   G ILQ L+ A++FG +L   G +   +   +E+ 
Sbjct: 127 GPGKMQGTVDFLMNVIPNTVVDAFAKGEILQVLLFAVMFGFALHKFGGRGTLVFDFIEKF 186

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V  +M++APLGAFGAM+FTIGKYG+SS+  L  L+   YAT   FI  VLG +
Sbjct: 187 SHVLFTIVGYIMKVAPLGAFGAMAFTIGKYGVSSLLQLGQLMATFYATCLVFIFVVLGTI 246

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FSI K I ++KEE+L+VL TSSSES LP +M K+E  G  +S+V +V+PTGYSFN
Sbjct: 247 ARLHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENLGVRKSVVGLVIPTGYSFN 306

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QATN  ++LT QL+LL + +++SKGAAGVTGS FI LAAT++ V
Sbjct: 307 LDGTSIYLTMAAVFIAQATNTDMNLTQQLTLLAVLLLTSKGAAGVTGSGFIVLAATLSAV 366

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             +P+AG+ LILG+DRFMSE R++TN IGN V TVVV++W   LD +   + +  E
Sbjct: 367 GHVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWTGDLDLERMRRRLDDE 422


>gi|257454843|ref|ZP_05620094.1| C4-dicarboxylate transport protein [Enhydrobacter aerosaccus SK60]
 gi|257447776|gb|EEV22768.1| C4-dicarboxylate transport protein [Enhydrobacter aerosaccus SK60]
          Length = 445

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 229/431 (53%), Positives = 320/431 (74%), Gaps = 5/431 (1%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           +  +  V        Y+ILY+QV++AI  G+ LG F P++G  M+PLGD F+K  KM+I 
Sbjct: 4   IDTTTLVEPPKPRKWYQILYVQVIIAIVLGILLGVFAPEVGEAMKPLGDAFIKLVKMIIA 63

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           PVIFLTV TGIA M +MK +G++  KAM  F  FS  AL+IGL+V N+ +PG G+N+D  
Sbjct: 64  PVIFLTVVTGIAGMSNMKRVGRVAGKAMLYFITFSTLALIIGLVVANVLQPGAGLNIDPA 123

Query: 121 SLNTESIA-----HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSL 175
           +L T   A     ++  +H  +  GF+ ++IP+T +S LT GNILQ L V++LFG+SL+ 
Sbjct: 124 TLATGKDAAKVSEYVSKAHDSTITGFLMNIIPETMVSPLTEGNILQVLFVSVLFGVSLAS 183

Query: 176 VGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCL 235
           VG+++  +    +E++ PVF+ V I+M+ AP+GAFGAM+FTIGKYG+ S+ NL FL+ C 
Sbjct: 184 VGDRARPVLNFFQELSAPVFKAVEILMKAAPIGAFGAMAFTIGKYGVHSLGNLAFLIACF 243

Query: 236 YATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCH 295
           Y TS  F+L VLG +AR+  FSIIK+I ++K+E+LLVL TSSSE+ALP LM+K+E AGC 
Sbjct: 244 YITSLLFVLVVLGAVARYNGFSIIKMIKYIKDELLLVLGTSSSEAALPTLMQKLERAGCE 303

Query: 296 RSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGV 355
           +S+V +V+PTGYSFNLDG+NIY+T+A LFI+QA N+ L+LT +++LLL+AM+SSKGAAG+
Sbjct: 304 KSVVGLVIPTGYSFNLDGTNIYMTMAALFIAQACNIDLTLTQEITLLLVAMLSSKGAAGI 363

Query: 356 TGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLD 415
           TG+ FITLAAT+ +VP++PI GM LILG+DRFMSECR++TN  GNA  T+VVSRWE  LD
Sbjct: 364 TGAGFITLAATLAVVPTVPIEGMALILGIDRFMSECRALTNLTGNACATIVVSRWENALD 423

Query: 416 PKLFNKYIGIE 426
            +  +  +  +
Sbjct: 424 KQRLDAALNGQ 434


>gi|297163293|gb|ADI13005.1| sodium:dicarboxylate symporter [Streptomyces bingchenggensis BCW-1]
          Length = 498

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 177/414 (42%), Positives = 277/414 (66%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L  +LY+Q L+ + +G A G   P  G +++PLGD F+   +M+I PVIF TV  GIA
Sbjct: 19  RRLLSLLYVQCLIGVLAGAAAGWLWPSFGAELKPLGDGFIALVRMMIAPVIFCTVVHGIA 78

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M + + +G++  KA+  F V +  A+VIGL+V N+ +PG G++VD  +L+ + +    +
Sbjct: 79  SMGNARAVGRVSLKALIYFEVLTTVAMVIGLVVVNVVQPGSGLHVDPSTLSAKGLPPEAT 138

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
              +SF  F+  MIPDT +SALT   IL  L+V++LFG  L+  G+    I + +E+++ 
Sbjct: 139 ESHESFAAFVLAMIPDTLISALTGHEILPVLVVSVLFGFGLNAAGQSGQGIIQGIEKLSK 198

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +F ++  +MR+AP+GAFG+M+FTIG YGL ++ +L  LV   + T+ FF+L VLG + R
Sbjct: 199 VLFTLIRWIMRLAPIGAFGSMAFTIGNYGLDTLRHLFLLVGSFWLTALFFVLVVLGTVMR 258

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
                ++  + ++KEE+L+VL TSSSE  LP +M K+E AG  + +V + +P GYSFNLD
Sbjct: 259 INGLRLLPFLRYIKEELLIVLGTSSSEPVLPRMMAKLEHAGASKPVVGITLPAGYSFNLD 318

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+T+ ++F++QA  + LSLT QLS+L + +++SKGAAGVTGS F+ LAAT++ VP 
Sbjct: 319 GTAIYLTMGSVFLAQALGIDLSLTQQLSMLAVMLLTSKGAAGVTGSGFVALAATLSAVPH 378

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+  + LI G+DRFMSE R++T+ +GN V T+ V++WE +LD +     +  E
Sbjct: 379 VPVTALALIFGIDRFMSEARALTSVVGNGVATLAVAKWEGQLDEERARAVLKGE 432


>gi|83592773|ref|YP_426525.1| C4-dicarboxylate transporter DctA [Rhodospirillum rubrum ATCC
           11170]
 gi|123526770|sp|Q2RUF7|DCTA_RHORT RecName: Full=C4-dicarboxylate transport protein
 gi|83575687|gb|ABC22238.1| Sodium:dicarboxylate symporter [Rhodospirillum rubrum ATCC 11170]
          Length = 447

 Score =  299 bits (765), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 237/413 (57%), Positives = 317/413 (76%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
             Y+ILY+QVLVAI +G+ LGHF P +G  ++PLGD F+K  KM+I PVIFLTV TGIA 
Sbjct: 15  KFYQILYVQVLVAIVAGVLLGHFYPDLGSALKPLGDAFIKLVKMIIAPVIFLTVVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS- 132
           + DM+ +G++  KAM  F  FS  AL+IG+IV N+  PG G+N+D  SL+ +++    S 
Sbjct: 75  LTDMQKVGRVAGKAMIYFLSFSTLALIIGMIVANVVHPGSGLNIDPASLDAKAVQTYTSH 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +H +S +GF+ ++IP T +SA  SG+ILQ L  A+LFGI+L+ VGE+   +   L  +  
Sbjct: 135 AHDQSLVGFLMNIIPSTPISAFASGDILQVLFFAVLFGIALATVGERGKPVLDLLNPLLQ 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            VFR+V+IVM+ APLGAFGAM+FTIGKYG+ SI+NL  LV   Y TS  F+  VLG++AR
Sbjct: 195 VVFRLVAIVMKAAPLGAFGAMAFTIGKYGIGSIANLAMLVGTFYLTSGLFVFVVLGLVAR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           +  FS++ L+ ++KEE+LLVL TSSSE+ALP LM+K+E AGC +S+V +VVPTGYSFNLD
Sbjct: 255 YNGFSLLALLRYIKEELLLVLGTSSSEAALPTLMEKLERAGCKKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN+ LSL DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++VPS
Sbjct: 315 GTNIYMTLAALFIAQATNIDLSLQDQILLLLVAMLSSKGAAGITGAGFITLAATLSVVPS 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECR++TNFIGNAV T+VV++WE +LD       +  
Sbjct: 375 VPVAGMALILGVDRFMSECRALTNFIGNAVATIVVAKWEGELDRDRLALALKG 427


>gi|327405292|ref|YP_004346130.1| sodium:dicarboxylate symporter [Fluviicola taffensis DSM 16823]
 gi|327320800|gb|AEA45292.1| sodium:dicarboxylate symporter [Fluviicola taffensis DSM 16823]
          Length = 425

 Score =  298 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 226/412 (54%), Positives = 316/412 (76%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P Y+ LY QVL+AI  G+ LG+F P +G +M+PLGD F+   KM+I PVIF+T++ GIA
Sbjct: 13  KPWYRALYFQVLIAIVIGITLGYFKPDLGEKMKPLGDGFINLIKMIIAPVIFITITVGIA 72

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIK 131
            M D+K +G+I  KA   F  FS  AL++G+IV N+ +PG G+N+D  +L+ + ++ ++ 
Sbjct: 73  SMNDLKKVGRITGKAFIYFLTFSTLALILGMIVSNLVQPGSGLNIDPSTLDQKDVSEYVA 132

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H  SF  FM ++IP T +S+LT  NILQ L  A+LFG++LSL  +KS  +    + + 
Sbjct: 133 VAHGNSFSNFMLNIIPKTFMSSLTGENILQVLFAAILFGVALSLTADKSKPVLDFFQALT 192

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
            P+F++V I+M++AP+GAFGAM+FTIGKYG+ ++ NL FLV   Y T+A F++ +LG++A
Sbjct: 193 HPIFKIVDILMKLAPIGAFGAMAFTIGKYGVETLQNLFFLVGTFYVTAALFVVVILGLVA 252

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  F+I+KL+ +LK+E+LLVL TSSSESALP LM K+E+AGC   +V +VVPTGYSFNL
Sbjct: 253 RYNGFNILKLLRYLKDELLLVLGTSSSESALPSLMTKLEKAGCSNQVVGLVVPTGYSFNL 312

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLA LFI+QA NV LS + Q +LLL+AM+SSKGAAGV+G+ F+TLAAT+T+VP
Sbjct: 313 DGTNIYMTLAALFIAQACNVDLSFSQQATLLLVAMLSSKGAAGVSGAGFVTLAATLTVVP 372

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
            +PIAGMTLILGVD+FMSECR++TN IGNAV T+VV+RWEK+LDP+     +
Sbjct: 373 DVPIAGMTLILGVDKFMSECRALTNLIGNAVATIVVARWEKQLDPEALKAAL 424


>gi|152989555|ref|YP_001349550.1| C4-dicarboxylate transporter DctA [Pseudomonas aeruginosa PA7]
 gi|171472884|sp|A6V915|DCTA2_PSEA7 RecName: Full=C4-dicarboxylate transport protein 2
 gi|150964713|gb|ABR86738.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa PA7]
          Length = 436

 Score =  298 bits (764), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 205/418 (49%), Positives = 300/418 (71%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK LY+QVLVAI  G+ALGH+ P+  V M+P GD FVK  KM I P+IF TV T
Sbjct: 1   MTKQPFYKSLYVQVLVAIAIGIALGHWYPETAVAMKPFGDGFVKLIKMAIAPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GIA M+ MK +G+    A+  F + S  AL+IGL+V N+ +PG GM+VD  +L+T  IA 
Sbjct: 61  GIAGMQSMKSVGKTGGMALLYFEIVSTVALIIGLVVVNLVQPGAGMHVDPNTLDTSKIAA 120

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           +  +   +S + F+ ++IP T + A  +G+ILQ L  ++LFG +L  +G     + + +E
Sbjct: 121 YAAAGEKQSTVDFLMNVIPGTVVGAFANGDILQVLFFSVLFGYALHRLGSYGKPVFEFIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            ++  +F +++++M++AP+GAFGAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG
Sbjct: 181 RVSHVMFNIINVIMKVAPIGAFGAMAFTIGAYGVGSLVQLGQLMLCFYITCLLFVLIVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSI++ I +++EE+L+VL TSSSESALP ++ KME+ GC++S+V +V+PTGYS
Sbjct: 241 GIARAHGFSILRFIRYIREELLIVLGTSSSESALPRMIDKMEKLGCNKSVVGLVIPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG++IY+T+A +FI+QAT+ P+ +T Q++LLL+ +++SKGAAGVTGS FI LAAT++
Sbjct: 301 FNLDGTSIYLTMAAVFIAQATDTPMDITHQITLLLVLLIASKGAAGVTGSGFIVLAATLS 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVVS+W K+LD     + +  E
Sbjct: 361 AVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSKWCKQLDEGTLQRELAGE 418


>gi|15596380|ref|NP_249874.1| C4-dicarboxylate transporter DctA [Pseudomonas aeruginosa PAO1]
 gi|107100632|ref|ZP_01364550.1| hypothetical protein PaerPA_01001658 [Pseudomonas aeruginosa PACS2]
 gi|116049115|ref|YP_792083.1| C4-dicarboxylate transporter DctA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892853|ref|YP_002441722.1| C4-dicarboxylate transporter DctA [Pseudomonas aeruginosa LESB58]
 gi|254234316|ref|ZP_04927639.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa C3719]
 gi|296390446|ref|ZP_06879921.1| C4-dicarboxylate transporter DctA [Pseudomonas aeruginosa PAb1]
 gi|313106158|ref|ZP_07792411.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa 39016]
 gi|20137981|sp|Q9I4F5|DCTA2_PSEAE RecName: Full=C4-dicarboxylate transport protein 2
 gi|122258223|sp|Q02J03|DCTA2_PSEAB RecName: Full=C4-dicarboxylate transport protein 2
 gi|9947108|gb|AAG04572.1|AE004548_6 C4-dicarboxylate transport protein [Pseudomonas aeruginosa PAO1]
 gi|115584336|gb|ABJ10351.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166247|gb|EAZ51758.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa C3719]
 gi|218773081|emb|CAW28893.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa LESB58]
 gi|310878913|gb|EFQ37507.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa 39016]
          Length = 436

 Score =  298 bits (764), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 206/418 (49%), Positives = 300/418 (71%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK LY+QVLVAI  G+ALGH+ P+  V M+P GD FVK  KM I P+IF TV T
Sbjct: 1   MTKQPFYKSLYVQVLVAIAIGIALGHWYPETAVAMKPFGDGFVKLIKMAIAPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GIA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GM+VD  +L+T  IA 
Sbjct: 61  GIAGMQSMKSVGKTGGMALLYFEVVSTVALIIGLVVVNVVQPGAGMHVDPNTLDTSKIAA 120

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           +  +   +S + F+ ++IP T + A  +G+ILQ L  ++LFG +L  +G     + + +E
Sbjct: 121 YAAAGEKQSTVDFLMNVIPGTVVGAFANGDILQVLFFSVLFGYALHRLGSYGKPVFEFIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            ++  +F +++++M++AP+GAFGAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG
Sbjct: 181 RVSHVMFNIINVIMKVAPIGAFGAMAFTIGAYGVGSLVQLGQLMLCFYITCILFVLIVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSI++ I +++EE+L+VL TSSSESALP ++ KME+ GC++S+V +V+PTGYS
Sbjct: 241 GIARAHGFSILRFIRYIREELLIVLGTSSSESALPRMIDKMEKLGCNKSVVGLVIPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG++IY+T+A +FI+QAT+ P+ +T Q++LLL+ +++SKGAAGVTGS FI LAAT++
Sbjct: 301 FNLDGTSIYLTMAAVFIAQATDTPMDITHQITLLLVLLIASKGAAGVTGSGFIVLAATLS 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVVS+W K+LD     + +  E
Sbjct: 361 AVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSKWCKQLDEGTLQRELAGE 418


>gi|254239550|ref|ZP_04932872.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa 2192]
 gi|126192928|gb|EAZ56991.1| C4-dicarboxylate transport protein [Pseudomonas aeruginosa 2192]
          Length = 436

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 206/418 (49%), Positives = 300/418 (71%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK LY+QVLVAI  G+ALGH+ P+  V M+P GD FVK  KM I P+IF TV T
Sbjct: 1   MTKQPFYKSLYVQVLVAIAIGIALGHWYPETAVAMKPFGDGFVKLIKMAIAPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GIA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GM+VD  +L+T  IA 
Sbjct: 61  GIAGMQSMKSVGKTGGMALLYFEVVSTVALIIGLVVVNVVQPGAGMHVDPNTLDTSKIAA 120

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           +  +   +S + F+ ++IP T + A  +G+ILQ L  ++LFG +L  +G     + + +E
Sbjct: 121 YAAAGEKQSTVDFLMNVIPGTVVGAFANGDILQVLFFSVLFGYALHRLGSYGKPVFEFIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            ++  +F +++++M++AP+GAFGAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG
Sbjct: 181 RVSHVMFNIINVIMKVAPIGAFGAMAFTIGAYGVGSLVQLGQLMLCFYITCILFVLIVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSI++ I +++EE+L+VL TSSSESALP ++ KME+ GC++S+V +V+PTGYS
Sbjct: 241 GIARAHGFSILRFIKYIREELLIVLGTSSSESALPRMIDKMEKLGCNKSVVGLVIPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG++IY+T+A +FI+QAT+ P+ +T Q++LLL+ +++SKGAAGVTGS FI LAAT++
Sbjct: 301 FNLDGTSIYLTMAAVFIAQATDTPMDITHQITLLLVLLIASKGAAGVTGSGFIVLAATLS 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVVS+W K+LD     + +  E
Sbjct: 361 AVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSKWCKQLDEGTLQRELAGE 418


>gi|158316190|ref|YP_001508698.1| sodium:dicarboxylate symporter [Frankia sp. EAN1pec]
 gi|158111595|gb|ABW13792.1| sodium:dicarboxylate symporter [Frankia sp. EAN1pec]
          Length = 468

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 188/419 (44%), Positives = 283/419 (67%), Gaps = 2/419 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
            G  R   Y+ LY+ VL  I +G+ +GHF P +GV +QPLG  FV   KM+I P++F TV
Sbjct: 10  TGSARRRWYRQLYVWVLAGIVAGILVGHFSPGVGVDLQPLGTTFVDAIKMIIAPIVFCTV 69

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
             GIA++ +++ +G++  KA   F + +  ALV+GLIV N+ +PG G+N D  +L+    
Sbjct: 70  VGGIAQVDNLRKVGRVGLKAFTYFELVTTAALVLGLIVMNVLRPGDGVNADPDTLSVNET 129

Query: 128 --AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
              +I    +K +   + D++PD+ + A   G +LQ L  A+LFGI+L+L G++   I  
Sbjct: 130 VGGYIAQGESKGWGDHLADVVPDSVVGAFAEGKVLQVLFFAVLFGIALNLTGKQGAAIAG 189

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            +E +   +F+++  VM  AP+GAFGAM+FTIGKYG+ ++++L  LV   Y TS FF++ 
Sbjct: 190 GIERVGRTMFQVLRFVMYAAPVGAFGAMAFTIGKYGIDTLTSLGKLVAVFYGTSLFFVVV 249

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +A     +I KL+ +++EE+L+VL TSSSES LP +M K+E  G  R +V + VPT
Sbjct: 250 VLGAIAATIGVNIFKLLRYIREELLIVLGTSSSESVLPQIMTKLERLGAPRQVVGLTVPT 309

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+ IY+TLA+L+++QA  V LSL +QL+++ + +++SKGAAGVTGS FI LAA
Sbjct: 310 GYSFNLDGTCIYLTLASLYLAQAVGVDLSLGEQLTIIGVLLLTSKGAAGVTGSGFIVLAA 369

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           T++ V ++P+A + LI GVD+FMSECR++TN  GN + T+VV+ WE  LD +   K + 
Sbjct: 370 TLSTVGTIPVAAIMLIFGVDKFMSECRALTNVCGNTLATLVVANWEGVLDKEQMRKALN 428


>gi|94984464|ref|YP_603828.1| sodium:dicarboxylate symporter [Deinococcus geothermalis DSM 11300]
 gi|122986714|sp|Q1J1H5|DCTA_DEIGD RecName: Full=C4-dicarboxylate transport protein
 gi|94554745|gb|ABF44659.1| sodium:dicarboxylate symporter [Deinococcus geothermalis DSM 11300]
          Length = 442

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 214/415 (51%), Positives = 304/415 (73%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           P +++ LY+QVL+AI  G+ +G   P  G  ++PLGD F+K  KMLI P+IF TV +GIA
Sbjct: 2   PKIFRSLYVQVLIAIVLGILVGFLFPSFGEGLKPLGDGFIKLIKMLIAPIIFATVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI-K 131
            M+D K +G++  KA+  F V + FALVIGL+V NI KPG GMNV+  +L+T +I+   +
Sbjct: 62  HMRDTKKVGRVGGKALIYFEVVTTFALVIGLVVANILKPGHGMNVNPATLDTSAISKYTQ 121

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           ++  +S   F+  +IP+T +SA T G++LQ L++++LFG +L+ +G     +   +E +N
Sbjct: 122 AAGEQSVADFLLHIIPNTLVSAFTEGDLLQVLLISVLFGFALTQLGTLGQKVLAGIEAVN 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VF ++  VMR+AP+GAFGAM+FTIGKYG+ +++ L +L+   YAT   F+  VLG++A
Sbjct: 182 SAVFVILGFVMRLAPIGAFGAMAFTIGKYGVGTLAQLAYLMVAFYATCLLFVFVVLGLIA 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           RF  FSI+K I F+KEE+LLVL TSSSESALP L+ K+E AG +RS+V +VVP GYSFNL
Sbjct: 242 RFAGFSILKFIRFIKEELLLVLGTSSSESALPRLITKLEYAGANRSVVGLVVPAGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+ATLFI+QATN  LSL  QL +L + +++SKGAAGVTGS FITLAAT++ V 
Sbjct: 302 DGTSIYLTMATLFIAQATNTHLSLGQQLGILGVLLLTSKGAAGVTGSGFITLAATLSAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ LILG+DRFMSE R++TNF+GN V T+V++R EK LD     + +  E
Sbjct: 362 HVPVAGLALILGIDRFMSEARALTNFVGNGVATLVIARSEKALDTNRLQRVLNGE 416


>gi|15891635|ref|NP_357307.1| C4-dicarboxylate transporter DctA [Agrobacterium tumefaciens str.
           C58]
 gi|20137746|sp|P58734|DCTA_AGRT5 RecName: Full=C4-dicarboxylate transport protein
 gi|15160079|gb|AAK90092.1| C4-dicarboxylate transport protein [Agrobacterium tumefaciens str.
           C58]
          Length = 448

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 236/418 (56%), Positives = 323/418 (77%), Gaps = 1/418 (0%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
           G  + P YK LY QVLVAI +G+ALGHF P  G Q++PLGD F++  KM+I PVIFLTV+
Sbjct: 10  GHAKQPFYKHLYFQVLVAIIAGIALGHFYPTFGEQLKPLGDGFIRLVKMIIAPVIFLTVA 69

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
           TGIA M DMK +G++  KAM  F VFS  AL++GLIV N  +PG GMN+D  +L+ +++A
Sbjct: 70  TGIAGMNDMKKVGRVAGKAMIYFLVFSTLALIVGLIVANTVQPGAGMNIDPATLDAKAVA 129

Query: 129 -HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
            +   +H ++  GF+ ++IP T + A  SG+ILQ L  ++LFGI+L +VGEK   +   +
Sbjct: 130 TYADKAHEQTITGFLMNIIPTTIVGAFASGDILQVLFFSVLFGIALGIVGEKGKPVTDFM 189

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
             + +P+F++V+I+M+ AP+GAFGAM+FTIGKYG+SS++NL  L+   Y TSA F+  VL
Sbjct: 190 HAMMYPIFKLVAILMKAAPIGAFGAMAFTIGKYGISSVTNLAMLIGTFYITSALFVFVVL 249

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G + R+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGY
Sbjct: 250 GAVCRYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMSKMEKAGCKRSVVGLVIPTGY 309

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+NIY+TLA LFI+QAT + LS  +Q+ LLL+AM+SSKGAAG+TG+ FITLAAT+
Sbjct: 310 SFNLDGTNIYMTLAALFIAQATGIHLSFGEQILLLLVAMLSSKGAAGITGAGFITLAATL 369

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++VPS+P+AGM LILG+DRFMSECR++TNF+GNAV T+VV+RWE +LD +   + +  
Sbjct: 370 SVVPSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVARWEGELDQEQLARVLSG 427


>gi|329910785|ref|ZP_08275383.1| Aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546077|gb|EGF31146.1| Aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 460

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 205/416 (49%), Positives = 289/416 (69%), Gaps = 1/416 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             RPPLYK LY+QVL AI  G+ALGHF P+ G  M+P GD F+K  KM+I P+IF TV  
Sbjct: 20  MSRPPLYKSLYVQVLTAIVIGVALGHFYPESGAAMKPFGDGFIKLIKMIIAPIIFCTVVI 79

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GIA M+DMK +G+    A+  F V S  AL++GL++ N+ +PG GMN+D  SL+T+ IA 
Sbjct: 80  GIAGMEDMKKVGKTGGLALLYFEVVSSIALIVGLVMVNLLQPGAGMNIDPASLDTKGIAS 139

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           +I     +S   F+ ++IP + + A   G ILQ L+ ++LFG +L  VG +   +   +E
Sbjct: 140 YIAPGKLQSTTDFLLNIIPTSVVDAFAKGEILQVLMFSILFGFALHRVGGRGTLVFDFIE 199

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
           + +  +F +V ++M+ AP+GAFGAM+FTIGKYG+ S+ +L  L+   Y T   FI  VLG
Sbjct: 200 KTSHVLFGIVGVIMKFAPIGAFGAMAFTIGKYGVGSLLSLGKLMGTFYGTCLIFIFLVLG 259

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSI K I ++KEE+ +VL TSSSES LP +M KME  G  +S+V +V+PTGYS
Sbjct: 260 SIARAHGFSIWKFIKYIKEELFIVLGTSSSESVLPRIMVKMENLGVKKSVVGLVIPTGYS 319

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG++IY+T+A +FI+QATN P++LT Q++LL + +++SKGAAG+TGS FI LAAT++
Sbjct: 320 FNLDGTSIYLTMAAIFIAQATNTPMTLTQQITLLAVLLLTSKGAAGITGSGFIVLAATLS 379

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
            V  +P+AG+ LILG+DRFMSE R++TN IGN V TVVV++W   +D       + 
Sbjct: 380 AVGGVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWTGDVDMAKLKHTLD 435


>gi|170746813|ref|YP_001753073.1| sodium:dicarboxylate symporter [Methylobacterium radiotolerans JCM
           2831]
 gi|170653335|gb|ACB22390.1| sodium:dicarboxylate symporter [Methylobacterium radiotolerans JCM
           2831]
          Length = 447

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 226/415 (54%), Positives = 316/415 (76%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            PLY+ LY QVLVA+  G+ LGHF PQ+G +++PLGD F+K  KM+I PVIFLTV +GIA
Sbjct: 18  KPLYRTLYFQVLVAVAIGILLGHFYPQLGAELKPLGDAFIKLVKMIIAPVIFLTVVSGIA 77

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK- 131
            M +++ +G++  KA+  F  FS  AL++GL+V N+ +PG G+++D KSL+ +++A    
Sbjct: 78  GMTNLEKVGRVGGKALIYFLTFSTLALIVGLVVANVLQPGNGLHIDPKSLDPKAVATYAG 137

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +  +S + F+ ++IP TA+ A   G ILQ L  ++LFG  L+ +G++   +   ++ ++
Sbjct: 138 KAKEQSIVDFLMNIIPTTAVGAFAGGEILQVLFFSVLFGFGLAFLGDRGKPVLDIIKVLS 197

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +F +V+I+M++AP+GAFGAM+FTIGKYG+SS++NL +LV   Y TSA F+L VLG +A
Sbjct: 198 EAIFGVVNIIMKVAPIGAFGAMAFTIGKYGISSLANLAYLVGAFYLTSAIFVLVVLGAVA 257

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSIIKLI ++KEE+LLVL TSSSESALP L++KME AGC + +V +VVPTGYSFNL
Sbjct: 258 RYNGFSIIKLIRYIKEELLLVLGTSSSESALPSLLEKMERAGCSKPVVGLVVPTGYSFNL 317

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+T+A LFI+QAT+ PLSL +Q  LLL+AM+SSKGAAGVTGS FITLAAT+ +VP
Sbjct: 318 DGTNIYMTMAALFIAQATDTPLSLGEQALLLLVAMLSSKGAAGVTGSGFITLAATLAVVP 377

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           S+P+ GM LILGVDRFMSECR++TNFIGNAV  +VV+RWE ++D       +  +
Sbjct: 378 SVPVVGMALILGVDRFMSECRALTNFIGNAVACIVVARWENEVDEAKLAAALSGQ 432


>gi|121606636|ref|YP_983965.1| C4-dicarboxylate transporter DctA [Polaromonas naphthalenivorans
           CJ2]
 gi|171769300|sp|A1VTR6|DCTA2_POLNA RecName: Full=C4-dicarboxylate transport protein 2
 gi|120595605|gb|ABM39044.1| sodium:dicarboxylate symporter [Polaromonas naphthalenivorans CJ2]
          Length = 448

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 203/418 (48%), Positives = 297/418 (71%), Gaps = 1/418 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
             + R P+YK LY+QVL A+  G+ LGHF P++G QM+PLGD F+K  KM+I P+IF TV
Sbjct: 3   KTNARKPIYKSLYVQVLAAVTIGVLLGHFSPELGAQMKPLGDGFIKLIKMIIAPIIFCTV 62

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
             GIA M+DMK +G+    A+  F V S  ALVIGLIV N+ +PG GM++D  SL+T+SI
Sbjct: 63  VIGIAGMEDMKKVGKTGGLALLYFEVMSTLALVIGLIVVNVLQPGSGMHIDPASLDTKSI 122

Query: 128 A-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
           A +      +  + F+ ++IP + + A   G ILQ L+ ++LFG +L   G +   +   
Sbjct: 123 AAYTAPGKMQGTVDFLLNVIPTSVVDAFAKGEILQVLLFSVLFGFALHRFGGRGTMVFDF 182

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
           +E+ +  +F +V I+M++AP+GAFGAM+FTIGKYGL S+ +L  L+   Y T   F+  V
Sbjct: 183 IEKFSHVLFDIVGIIMKVAPIGAFGAMAFTIGKYGLGSLFSLGKLMGAFYLTCLIFVFVV 242

Query: 247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTG 306
           LGI++R   FS+ K + ++KEE+L+VL TSSSES LP +M+K+E  G  +S+V +V+PTG
Sbjct: 243 LGIVSRLHGFSVFKFVRYIKEELLIVLGTSSSESVLPRMMEKLENLGARKSVVGLVIPTG 302

Query: 307 YSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAAT 366
           YSFNLDG++IY+T+A +FI+QAT+ P+SLT Q++LL + M++SKGAAG+TGS FI LAAT
Sbjct: 303 YSFNLDGTSIYLTMAAVFIAQATDTPMSLTQQITLLAVLMLTSKGAAGITGSGFIVLAAT 362

Query: 367 ITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           ++ V  +P+AG+ LILG+DRFMSE R++TN +GN V T+VV++W   LD +  ++ + 
Sbjct: 363 LSAVGGVPVAGLALILGIDRFMSEARALTNLVGNGVATLVVAKWTGDLDMQRLHQGLD 420


>gi|327193724|gb|EGE60603.1| C4-dicarboxylate transporter protein [Rhizobium etli CNPAF512]
          Length = 444

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 320/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R P Y  LY+QVL AI +G+ LGHF P +G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  RKPFYSHLYVQVLAAIAAGILLGHFYPDLGTQLKPLGDAFIKLVKMVIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-I 130
           A M D+K +G++  KAM  F  FS  ALVIG+IV N+ +PG GMN+D  SL+ +++A   
Sbjct: 75  AGMSDLKKVGRVAGKAMLYFLTFSTLALVIGMIVANVVQPGAGMNIDPASLDPKAVATFA 134

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEK + +   L  +
Sbjct: 135 DKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKGEQVVNFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+  VLG +
Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLIGTFYITSLLFVFIVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGINLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD     + +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDKAQLARALGGQ 430


>gi|241661814|ref|YP_002980174.1| C4-dicarboxylate transporter DctA [Ralstonia pickettii 12D]
 gi|240863841|gb|ACS61502.1| sodium:dicarboxylate symporter [Ralstonia pickettii 12D]
          Length = 429

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 213/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGH+ P++ V+M+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIVIGVLLGHYSPELAVKMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FAL+IGL  G+I  PG G NVD+ +++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALIYFEVVSTFALIIGLAAGHIFNPGAGFNVDVNTIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H+ S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +GE++  +   +++
Sbjct: 121 AAKAHSASTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGALSAMGERAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I+   FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ LV   Y T+  F++ VLGI
Sbjct: 181 ISHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVISLVPLLKLVGTFYLTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARLVGFNIFRFVGYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+ T QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP +P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  +
Sbjct: 361 VPDIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRAKLARVLSGD 417


>gi|120612152|ref|YP_971830.1| C4-dicarboxylate transporter DctA [Acidovorax citrulli AAC00-1]
 gi|171769195|sp|A1TSW8|DCTA_ACIAC RecName: Full=C4-dicarboxylate transport protein
 gi|120590616|gb|ABM34056.1| sodium:dicarboxylate symporter [Acidovorax citrulli AAC00-1]
          Length = 451

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 203/414 (49%), Positives = 293/414 (70%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLY+ LY+QVL A+  G+ LGHF P+IG +M+PLGD F+K  KM+I P+IF TV  GI
Sbjct: 11  KLPLYRSLYVQVLFAVVVGVLLGHFYPEIGEKMKPLGDGFIKLIKMIIAPIIFCTVVVGI 70

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G+    A+  F + S  ALVIGLIV N+ +PG GMNVD  +++T+SIA   
Sbjct: 71  AGMEDMKKVGRTGGLALLYFEIVSSVALVIGLIVVNVLQPGAGMNVDASAIDTKSIAAYT 130

Query: 132 -SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                 +   F+ ++IP T + A   G ILQ L++A++FG +L   G +   +   +E+ 
Sbjct: 131 APGKMGTTTDFLMNIIPTTVVDAFAKGEILQVLLIAVMFGFALHRFGGRGTLVFDFIEKT 190

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V  +M++AP+GAFGAMSFTIGKYG+ S+ +L  L+   Y T   F+  VLG++
Sbjct: 191 SHVLFTIVGYIMKVAPIGAFGAMSFTIGKYGVGSLLSLGKLMGSFYLTCLLFVFVVLGLI 250

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           ARF  FSI K + ++KEE+L+VL TSSSES LP +M+KME  G  ++ V +V+PTGYSFN
Sbjct: 251 ARFHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMMEKMENLGARKTTVGLVIPTGYSFN 310

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QATN PL +T Q++LLL+ +++SKGAAG+TGS FI LAAT++ V
Sbjct: 311 LDGTSIYLTMAAVFIAQATNTPLDITHQITLLLVLLLTSKGAAGITGSGFIVLAATLSAV 370

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+AG+ LILG+DRFMSE R++TN +GN V T+VV++W   LD +   + + 
Sbjct: 371 GHVPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWTGDLDTEQLKQRLD 424


>gi|86358573|ref|YP_470465.1| C4-dicarboxylate transporter DctA [Rhizobium etli CFN 42]
 gi|123511278|sp|Q2K5Z8|DCTA_RHIEC RecName: Full=C4-dicarboxylate transport protein
 gi|86282675|gb|ABC91738.1| C4-dicarboxylate transporter protein [Rhizobium etli CFN 42]
          Length = 443

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y  LY+QVL AI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  KKPFYSHLYVQVLAAIAAGILLGHFYPELGTQLKPLGDAFIKLVKMVIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-I 130
           A M D+K +G++  KAM  F  FS  ALVIG+IV N+ +PG GMN+D  SL+ +++A   
Sbjct: 75  AGMSDLKKVGRVAGKAMLYFLTFSTLALVIGMIVANVVQPGAGMNIDPASLDPKAVATFA 134

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEK + +   L  +
Sbjct: 135 DKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKGEQVVTFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++V I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +
Sbjct: 195 TAPIFKLVGILMKAAPIGAFGAMAFTIGKYGIGSIANLAMLIGTFYITSLLFVLVVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSILALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGIQLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD     + +G E
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTGQLARALGGE 430


>gi|326318181|ref|YP_004235853.1| sodium:dicarboxylate symporter [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375017|gb|ADX47286.1| sodium:dicarboxylate symporter [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 451

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 203/414 (49%), Positives = 293/414 (70%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLY+ LY+QVL A+  G+ LGHF P+IG +M+PLGD F+K  KM+I P+IF TV  GI
Sbjct: 11  KLPLYRSLYVQVLFAVVVGVLLGHFYPEIGEKMKPLGDGFIKLIKMIIAPIIFCTVVVGI 70

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G+    A+  F + S  ALVIGLIV N+ +PG GMNVD  +++T+SIA   
Sbjct: 71  AGMEDMKKVGRTGGLALLYFEIVSSIALVIGLIVVNVLQPGAGMNVDASAIDTKSIAAYT 130

Query: 132 -SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                 +   F+ ++IP T + A   G ILQ L++A++FG +L   G +   +   +E+ 
Sbjct: 131 APGKMGTTTDFLMNIIPTTVVDAFAKGEILQVLLIAVMFGFALHRFGGRGTLVFDFIEKT 190

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V  +M++AP+GAFGAMSFTIGKYG+ S+ +L  L+   Y T   F+  VLG++
Sbjct: 191 SHVLFTIVGYIMKVAPIGAFGAMSFTIGKYGVGSLLSLGKLMGSFYLTCLLFVFVVLGLI 250

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           ARF  FSI K + ++KEE+L+VL TSSSES LP +M+KME  G  ++ V +V+PTGYSFN
Sbjct: 251 ARFHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMMEKMENLGAKKTTVGLVIPTGYSFN 310

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QATN PL +T Q++LLL+ +++SKGAAG+TGS FI LAAT++ V
Sbjct: 311 LDGTSIYLTMAAVFIAQATNTPLDITHQITLLLVLLLTSKGAAGITGSGFIVLAATLSAV 370

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+AG+ LILG+DRFMSE R++TN +GN V T+VV++W   LD +   + + 
Sbjct: 371 GHVPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWTGDLDTEQLRQRLD 424


>gi|187927294|ref|YP_001897781.1| C4-dicarboxylate transporter DctA [Ralstonia pickettii 12J]
 gi|309780007|ref|ZP_07674760.1| C4-dicarboxylate transport protein 1 [Ralstonia sp. 5_7_47FAA]
 gi|187724184|gb|ACD25349.1| sodium:dicarboxylate symporter [Ralstonia pickettii 12J]
 gi|308921177|gb|EFP66821.1| C4-dicarboxylate transport protein 1 [Ralstonia sp. 5_7_47FAA]
          Length = 429

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 213/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGH+ P++ V+M+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIVIGVLLGHYSPELAVKMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FAL+IGL  G+I  PG G NVD+ +++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEVVSTFALIIGLAAGHIFNPGAGFNVDVNTIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H+ S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +GE++  +   +++
Sbjct: 121 AAKAHSASTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGALSAMGERAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I+   FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ LV   Y T+  F++ VLGI
Sbjct: 181 ISHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVISLVPLLKLVGTFYFTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARVVGFNIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+ T QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP +P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  +
Sbjct: 361 VPDIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRAKLARVLSGD 417


>gi|161621446|ref|NP_106434.2| C4-dicarboxylate transporter DctA [Mesorhizobium loti MAFF303099]
 gi|20137907|sp|Q98AV2|DCTA1_RHILO RecName: Full=C4-dicarboxylate transport protein 1
          Length = 477

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 232/415 (55%), Positives = 316/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R  L+   Y+QVLVAI  G+A+GHF PQIG  ++PLGD F+K  KM+I PVIFLTVSTGI
Sbjct: 14  RKTLFAKPYVQVLVAILLGVAVGHFYPQIGENLKPLGDAFIKLVKMIIAPVIFLTVSTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D++ +G++  KAM  F  FS  AL++GLIVGN+ +PG G+N+DL SL+ +++  + 
Sbjct: 74  AGMSDLQKVGRVAGKAMVYFVTFSTLALIVGLIVGNVIQPGAGLNIDLTSLDVQAVNGYA 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S  GF+ +MIP T + A   G+ILQ L  ++LFGI+L++VGE   ++   L+++
Sbjct: 134 SKAHEQSVTGFLMNMIPTTIVGAFVEGDILQVLFFSVLFGIALAMVGESGKSVLSFLQDL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V I+M+ AP+GAFGAM+FTIGKYG+ S++NL  LV   Y T+  F+ GVLG +
Sbjct: 194 TAPVFKLVGILMKAAPIGAFGAMAFTIGKYGIGSVANLAMLVGTFYLTAFLFVFGVLGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI  LI ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 254 CRYNGFSIFSLIRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN  LS+ DQ+ LLL+AM+SSKGAAGVTG+ F+TLAAT+++V
Sbjct: 314 LDGTNIYMTLAALFIAQATNTDLSVGDQVLLLLVAMLSSKGAAGVTGAGFVTLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P++P+AGM LILGVDRFMSECR++TN +GNAV ++VV+RWE +LD          
Sbjct: 374 PAVPVAGMALILGVDRFMSECRALTNLVGNAVASLVVARWEGELDQAQLKAAFCG 428


>gi|253699669|ref|YP_003020858.1| sodium:dicarboxylate symporter [Geobacter sp. M21]
 gi|259645143|sp|C6E2F4|DCTA_GEOSM RecName: Full=C4-dicarboxylate transport protein
 gi|251774519|gb|ACT17100.1| sodium:dicarboxylate symporter [Geobacter sp. M21]
          Length = 439

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 211/416 (50%), Positives = 298/416 (71%), Gaps = 2/416 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y+ LY QVL AI  G+ALG+++P  G  M+PLGD F+K  KM+ITP+IF TV TGIA
Sbjct: 4   KKFYQHLYFQVLTAISFGVALGYYLPDTGTAMKPLGDGFIKMIKMIITPIIFCTVVTGIA 63

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M DMK +G++  KA+  F   S  AL IGL+V NI +PG+GMN D+  L+T+ +    +
Sbjct: 64  GMDDMKKVGRVGGKALLYFEAVSTLALGIGLVVINIIQPGVGMNADVTKLDTKGLDTYTA 123

Query: 133 SHAK--SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + AK  SF+ F+  +IP++ + A   G ILQ L  A+LFG++LS +GEK   + + ++E+
Sbjct: 124 TAAKGHSFVDFVLGVIPNSVVDAFAKGEILQVLFFAILFGLALSAMGEKGKPVYRLIDEV 183

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
               F +V+I+M+ AP+GAFGAM+FTIGK+GL S++ L  L+   Y T   F+  VLG +
Sbjct: 184 AHAFFGVVNIIMKFAPIGAFGAMAFTIGKFGLGSLTKLGMLMGSFYLTCLLFVFVVLGTI 243

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            + C F+I K I ++KEE+L+VL TSSSESALP +M K+E  GC +S+V +V+PTGYSFN
Sbjct: 244 GKLCGFNIFKFISYIKEELLIVLGTSSSESALPRMMAKLENLGCSKSVVGLVIPTGYSFN 303

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +F++QATN PL LT  L++L + M++SKGAAGVTGS F+TLAAT   +
Sbjct: 304 LDGTSIYLTMAAVFVAQATNTPLDLTQTLTILGVLMLTSKGAAGVTGSGFVTLAATFAAI 363

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           P++P+AG+ LILG+DRFMSE R++TN +GN V TVVVSRWE +LD    ++ +  E
Sbjct: 364 PTIPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSRWENELDVARMSQVLNKE 419


>gi|134297064|ref|YP_001120799.1| C4-dicarboxylate transporter DctA [Burkholderia vietnamiensis G4]
 gi|134140221|gb|ABO55964.1| sodium:dicarboxylate symporter [Burkholderia vietnamiensis G4]
          Length = 455

 Score =  297 bits (760), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 213/415 (51%), Positives = 307/415 (73%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P YK+LY+QV+ AI  G+ LGHF P +   M+PLGD F+K  KM+I P+IF TV TGI
Sbjct: 29  KKPFYKVLYVQVIFAIIVGVILGHFYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVTGI 88

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G++  KA+  F + S FAL++GL   ++ +PG+G N+D  +L+ +++A   
Sbjct: 89  AGMEDMKKVGRVGGKALLYFEIVSTFALLLGLAATHLLRPGVGFNIDPATLDGKAVASYA 148

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++ +
Sbjct: 149 AKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFIDGL 208

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG +
Sbjct: 209 TRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSIVFVLVVLGTI 268

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           ARF  FSI++ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSFN
Sbjct: 269 ARFTGFSIVRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSFN 328

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +V
Sbjct: 329 LDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAVV 388

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  
Sbjct: 389 PTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRDALKG 443


>gi|229490588|ref|ZP_04384426.1| sodium:dicarboxylate symporter [Rhodococcus erythropolis SK121]
 gi|229322408|gb|EEN88191.1| sodium:dicarboxylate symporter [Rhodococcus erythropolis SK121]
          Length = 521

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 160/421 (38%), Positives = 264/421 (62%), Gaps = 6/421 (1%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +PP Y+ L++Q++ AI  G+ +G   P+ G  ++PL D F+K  KMLI P+IF TV  GI
Sbjct: 74  KPPWYRSLFVQLIAAIVIGVLIGWLWPEFGANLKPLADGFIKLIKMLIAPIIFCTVVIGI 133

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL---NTESIA 128
           A + D+K +G+I  KA+  F V + FAL+ GL++GN+ KPG G ++D ++L        A
Sbjct: 134 AHVGDLKAVGRIGVKALIYFEVVTTFALLFGLLIGNLMKPGAGFDIDPETLANGADAVAA 193

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT-IRKCL 187
              S      + F+ ++IP + +SA     +LQ L  A+LFG++L+  GE     + + +
Sbjct: 194 KTGSGELPHTVEFLLNIIPVSIVSAFAENALLQVLFFAVLFGLALAKAGESGPPIVFELV 253

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + ++   F ++  +MR+APLGA GAM++ +G+YG++S+ +   L+   Y  +  FIL + 
Sbjct: 254 DRLSHLFFTIIGWIMRLAPLGALGAMAYIVGQYGIASLGSYGKLIAACYLAAVLFILILA 313

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
            I+  F   ++ K + ++K+E+ L L T+S+E  LP +M K+  AGC R+   +VVPTGY
Sbjct: 314 AIVRYFAGVNLWKFVKYIKDELFLALGTASTEVVLPRIMVKLTNAGCSRTTTGLVVPTGY 373

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+ +Y+++  LF++QA  V L+L +Q++ +L+ M++SKG AGV GS+F+ L+AT+
Sbjct: 374 SFNLDGATLYLSICMLFLAQALGVDLTLGEQITAVLVLMLTSKGMAGVPGSSFLALSATV 433

Query: 368 TLV--PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
             +   ++P+A + L+LG DR M   R   N +GN V T VV+ WE +LD +   + +  
Sbjct: 434 AAIGHGAIPVAAVALLLGADRIMDSMRVSVNLLGNCVATFVVANWEGQLDKERMRRVLDG 493

Query: 426 E 426
           E
Sbjct: 494 E 494


>gi|190892722|ref|YP_001979264.1| C4-dicarboxylate transporter protein [Rhizobium etli CIAT 652]
 gi|226723842|sp|B3PUW1|DCTA_RHIE6 RecName: Full=C4-dicarboxylate transport protein
 gi|190698001|gb|ACE92086.1| C4-dicarboxylate transporter protein [Rhizobium etli CIAT 652]
          Length = 444

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R P Y  LY+QVL AI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  RKPFYSHLYVQVLAAIAAGILLGHFYPELGTQLKPLGDAFIKLVKMVIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-I 130
           A M D+K +G++  KAM  F  FS  ALVIG+IV N+ +PG GMN+D  SL+ +++A   
Sbjct: 75  AGMSDLKKVGRVAGKAMLYFLTFSTLALVIGMIVANVVQPGAGMNIDPASLDPKAVATFA 134

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEK + +   L  +
Sbjct: 135 DKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKGEQVVNFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+  VLG +
Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLIGTFYITSLLFVFIVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGINLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD     + +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTAQLARALGGQ 430


>gi|332971503|gb|EGK10453.1| aerobic C4-dicarboxylate transporter [Kingella kingae ATCC 23330]
          Length = 435

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 227/416 (54%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   Y+ILY+QV+ AI  G+ LGHF PQ G  M+PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 17  KQKFYQILYVQVVFAIVLGILLGHFFPQTGEAMKPLGDAFIKIVKMIIAPVIFLTVVTGI 76

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M +MK +G++  KA   F +FS  AL++G+++ N+ +PG G+N+D  +L++  +  ++
Sbjct: 77  AGMTNMKKVGRVAGKAFVYFIIFSTLALIVGMVIANVIQPGAGLNIDPHTLDSSKVEGYV 136

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             S   + + F+ ++IP T +S LT GNILQ L VA+LFG++L+ VG+K+  I   L+E+
Sbjct: 137 AKSKDATVVNFLMNIIPTTIVSPLTEGNILQVLFVAILFGVALASVGDKARPITNLLQEL 196

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           + PVF+MV+++M +AP+GAFGAM+FTIGKYG+ SISNL+ LV   Y TS  F++ +LG +
Sbjct: 197 SAPVFKMVAMLMNLAPIGAFGAMAFTIGKYGIKSISNLLMLVGAFYITSILFVVVILGAV 256

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           A++  FSIIKLI ++K+E+ LVL TSSSE+ALP LM KME+AGC +S+V +V+PTGYSFN
Sbjct: 257 AKYNGFSIIKLIKYIKDELWLVLGTSSSEAALPTLMHKMEQAGCEKSVVGLVIPTGYSFN 316

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA  + LS  +Q SLLL+AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 317 LDGTNIYMTMAALFIAQAVGIDLSWGEQFSLLLVAMLSSKGAAGVTGAGFITLAATLSVV 376

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNA  T+VV+RWE  LD +  +K +  +
Sbjct: 377 PSVPVAGMALILGIDRFMSECRALTNLVGNACATIVVARWENALDKEQLDKALNRQ 432


>gi|94309173|ref|YP_582383.1| C4-dicarboxylate transporter DctA [Cupriavidus metallidurans CH34]
 gi|172046198|sp|Q1LRW2|DCTA1_RALME RecName: Full=C4-dicarboxylate transport protein 1
 gi|93353025|gb|ABF07114.1| C4-dicarboxylic acid transport protein [Cupriavidus metallidurans
           CH34]
          Length = 429

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 223/417 (53%), Positives = 315/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P YKILY+QVL AIF G+ LGH+ P  GV M+PLGD F+K  KM+I P+IF TV +G
Sbjct: 1   MRKPFYKILYVQVLFAIFVGILLGHYWPDTGVAMKPLGDAFIKLIKMIIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH- 129
           IA M+DMK +G++  KA+  F + S FAL++GLI  +  KPG+G N+D  +L+T+SIA  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEIVSTFALLLGLIATHALKPGVGFNIDPATLDTKSIAQY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +  +H +S + F   +IPDT  SA  +G+ILQ L+V++ FG +L++VGE++  I   +++
Sbjct: 121 VSKAHGQSTVEFFMHIIPDTIFSAFANGDILQILMVSMFFGSALAVVGERARIIHDMVDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   F +V ++ ++AP+GAFGAM+FTIGKYGL S+  L+ L+   Y T+  F+L VLG 
Sbjct: 181 VSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLIPLLKLIGTFYLTAIVFVLVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSII+ + ++KEE+L+VL TSSSE+ALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 VARLTGFSIIRFVAYIKEELLIVLGTSSSEAALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FI+QATN+ L+L  QL++L +AMV+SKGA+GVTGS FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFIAQATNIELTLMQQLTILAVAMVTSKGASGVTGSGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AGM LILG+DRFMSECR++TN +GN V TVVVS WE +LD     + +  E
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEHELDRARLTRVLRGE 417


>gi|209550297|ref|YP_002282214.1| C4-dicarboxylate transporter DctA [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226723843|sp|B5ZXG4|DCTA_RHILW RecName: Full=C4-dicarboxylate transport protein
 gi|209536053|gb|ACI55988.1| sodium:dicarboxylate symporter [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 443

 Score =  296 bits (757), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 322/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y  LY+QVL AI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  KKPFYSHLYVQVLAAIAAGILLGHFYPELGAQLKPLGDAFIKLVKMIIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M D+K +G++  KAM  F  FS  ALVIG++V N+ +PG GMN+D  SL+  ++A   
Sbjct: 75  AGMSDLKKVGRVAGKAMLYFLTFSTLALVIGMVVANVVQPGAGMNIDPASLDPTAVATYA 134

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           S +H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEK + +   L  +
Sbjct: 135 SKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKGEQVVNFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +
Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGIGSIANLAMLIGTFYLTSLLFVLVVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSILALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGINLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD     + +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTAQLARALGGQ 430


>gi|302382274|ref|YP_003818097.1| sodium:dicarboxylate symporter [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192902|gb|ADL00474.1| sodium:dicarboxylate symporter [Brevundimonas subvibrioides ATCC
           15264]
          Length = 480

 Score =  296 bits (757), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 229/413 (55%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
            Y+ LY+QVL AI  G  +GHF P  G  ++PLGD F+K  KM+I PVIFLT+ TGIA M
Sbjct: 45  WYRHLYVQVLGAILLGGLIGHFFPAFGESLKPLGDGFIKLVKMVIAPVIFLTIVTGIAGM 104

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI-KSS 133
           +D+  +G++  KA   F VFS  AL++GL+VGN+ +PG G+N+D  SL+  ++A    ++
Sbjct: 105 RDLGRVGRVAAKAFGYFLVFSTLALIVGLVVGNLVQPGRGLNIDPASLDPAAVAQYSTAA 164

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
           H  + IGF+  +IPDT +SA ++GNILQ L V++LFGI+L+ VG+    +   LE ++  
Sbjct: 165 HETTIIGFLLGVIPDTFVSAFSTGNILQVLFVSVLFGIALAGVGDAGKPVLTFLEAVSSA 224

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
            F++V+IVM+ AP+GAFGA +FTIG YG+++++NLI LV   Y T+A F++GVLG++   
Sbjct: 225 FFKLVAIVMKAAPIGAFGAFAFTIGAYGIATVANLIALVATFYLTAAIFVIGVLGLVGVA 284

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
             FSI KLI +LKEE+LLVL TSSSE+ALP L++KME AG  +S+V +VVPTGYSFNLDG
Sbjct: 285 NGFSIFKLIRYLKEELLLVLGTSSSEAALPSLLQKMERAGASKSVVGLVVPTGYSFNLDG 344

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           +NIY+T+A LFI+QA N+ LSL DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+ +VPS+
Sbjct: 345 TNIYMTMAALFIAQALNIDLSLQDQILLLLVAMLSSKGAAGITGAGFITLAATLAVVPSV 404

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PIAGM LILG+DRFMSECR++TNFIGNAV T+VV+RWE +LD     + +  +
Sbjct: 405 PIAGMALILGIDRFMSECRALTNFIGNAVATLVVARWEGELDRDALREALDGQ 457


>gi|319784862|ref|YP_004144338.1| sodium:dicarboxylate symporter [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170750|gb|ADV14288.1| sodium:dicarboxylate symporter [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 442

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 229/426 (53%), Positives = 318/426 (74%), Gaps = 1/426 (0%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           + +  +     R P Y  LY+QVLVAI  G+ LGHF P +G  M+PLGD F+K  KM+I 
Sbjct: 3   IADQSRALAAQRKPFYAQLYVQVLVAITVGILLGHFYPSVGESMKPLGDAFIKLVKMIIA 62

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           PVIFLTV+TGIA M D++ +G++  KAM  F  FS  AL+IGL+V N+ +PG G N+D  
Sbjct: 63  PVIFLTVTTGIAGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLVVANVVQPGAGFNIDPA 122

Query: 121 SLNTESI-AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
           +L+  ++  +   +H +S  GF+ ++IP T + A   G+ILQ L  ++LFGI+L+LVG+K
Sbjct: 123 TLDASTVNTYAAKAHDQSVTGFLMNIIPSTIVGAFADGDILQVLFFSVLFGIALALVGDK 182

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
            + +   L+ +  P+F++VS++M+ AP+GAFGAM+FTIGKYG+ ++ NL  LV   Y TS
Sbjct: 183 GEPVLNFLQALTTPIFKLVSVLMKAAPIGAFGAMAFTIGKYGIGAVINLAMLVGTFYVTS 242

Query: 240 AFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIV 299
             F+  VLG + R+  FSI+ LI ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V
Sbjct: 243 FLFVFIVLGAVCRYNGFSILALIRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVV 302

Query: 300 SMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSA 359
            +V+PTGYSFNLDG+NIY+TLA LFI+QATN+ LS+ DQ+ LLL+AM+SSKGAAG+TG+ 
Sbjct: 303 GLVIPTGYSFNLDGTNIYMTLAALFIAQATNIHLSMGDQILLLLVAMLSSKGAAGITGAG 362

Query: 360 FITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           FITLAAT+++VP++P+AGM LILGVDRFMSECR++TNF+GNAV T+VV+RWE +LD    
Sbjct: 363 FITLAATLSVVPAVPVAGMALILGVDRFMSECRALTNFVGNAVATLVVARWEGELDEAKL 422

Query: 420 NKYIGI 425
            + +  
Sbjct: 423 ARALAG 428


>gi|325284214|ref|YP_004256755.1| C4-dicarboxylate transport protein [Deinococcus proteolyticus MRP]
 gi|324316023|gb|ADY27138.1| C4-dicarboxylate transport protein [Deinococcus proteolyticus MRP]
          Length = 442

 Score =  295 bits (756), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 214/415 (51%), Positives = 295/415 (71%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           P ++  LYIQV++AI  G+ +G   P  G  ++PLGD FVK  KM+I P+IF TV +G+A
Sbjct: 2   PKIFHSLYIQVIIAIVLGILVGFLFPSFGESLKPLGDGFVKLIKMIIAPIIFATVVSGVA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI-K 131
            M+D K +G++  KA+  F + S  AL+IGL V N+ +PG GMNV+   L++  I    +
Sbjct: 62  HMRDTKKVGRVGGKALIYFELVSTLALIIGLAVVNVLQPGRGMNVNPADLDSSGIEKYRE 121

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           ++  +S   ++  +IPDT  S   +G++LQ L+VALLFG +L  +G   D I   ++ +N
Sbjct: 122 AAGEQSVTDYLLHVIPDTLFSPFITGDLLQVLLVALLFGFALLRLGRLGDQILHGIDMVN 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +F ++  VMR+AP+GAFGAM+FTIGKYGL S+  L FL+   Y T   FI GVLG++A
Sbjct: 182 QTIFIILGFVMRLAPIGAFGAMAFTIGKYGLGSLQQLGFLMGSFYLTCLIFIFGVLGLIA 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           RF  FS++KLI ++KEE+L+VL TSSSESALP LM KME AG  +S+V +VVPTGYSFNL
Sbjct: 242 RFFGFSVVKLIRYIKEELLIVLGTSSSESALPRLMMKMEHAGAEKSVVGLVVPTGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+A +FI+QATN P+ LT+QL LL + +++SKGAAGVTGS FITLAAT+  V 
Sbjct: 302 DGTSIYLTMAAVFIAQATNTPMGLTEQLGLLAVLLLTSKGAAGVTGSGFITLAATLGAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+ G+ LILG+DRFMSE R++TNFIGNAV T VV+R E  LD   F + +  E
Sbjct: 362 HVPVEGLALILGIDRFMSEARALTNFIGNAVATAVVARSENALDMDRFTRALNGE 416


>gi|188582499|ref|YP_001925944.1| sodium:dicarboxylate symporter [Methylobacterium populi BJ001]
 gi|179345997|gb|ACB81409.1| sodium:dicarboxylate symporter [Methylobacterium populi BJ001]
          Length = 446

 Score =  295 bits (756), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 222/414 (53%), Positives = 315/414 (76%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P+Y+ LY QVLVA+  G+ LGHF P++G  M+PLGD F+K  KM+I PVIFLTV +GIA
Sbjct: 18  KPIYRTLYFQVLVAVAIGITLGHFYPKLGADMKPLGDAFIKLVKMIIAPVIFLTVVSGIA 77

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK- 131
            M +++ +G++  KA+  F  FS  AL++GLIV N+ +PG G+++D  SL+ +++A    
Sbjct: 78  GMTNLEKVGRVGGKALAYFLTFSTLALIVGLIVANVLQPGHGLHIDPNSLDPKAVATYAG 137

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +  ++   F+ ++IP TA+ A   G ILQ L  ++LFG  L+ +GE+   +   ++ ++
Sbjct: 138 KAKEQNIADFLMNIIPTTAVGAFAGGEILQVLFFSVLFGFGLAFLGERGKPVLDIIKVMS 197

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +F +V+I+M++AP+GAFGAM+FTIGKYG+SS++NL +LV   Y TSA F+LGVLG +A
Sbjct: 198 EAIFGVVNIIMKVAPIGAFGAMAFTIGKYGISSLANLAYLVGAFYLTSAIFVLGVLGAVA 257

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSII+LI ++KEE++LVL TSSSESALP L++KME AGC R +V +VVPTGYSFNL
Sbjct: 258 RYNGFSIIRLIRYIKEELMLVLGTSSSESALPSLIEKMERAGCSRPVVGLVVPTGYSFNL 317

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+T+A LFI+QAT+ P++  +Q+ LLL+AM+SSKGAAGVTGS FITLAAT+ +VP
Sbjct: 318 DGTNIYMTMAALFIAQATDTPITYGEQILLLLVAMLSSKGAAGVTGSGFITLAATLAVVP 377

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           S+P+ GM LILG+DRFMSECR++TNFIGNAV  +VV+RWE ++D    +  +G 
Sbjct: 378 SVPVVGMALILGIDRFMSECRALTNFIGNAVACIVVARWEGEVDEAKLHAALGG 431


>gi|239833782|ref|ZP_04682110.1| C4-dicarboxylate transport protein [Ochrobactrum intermedium LMG
           3301]
 gi|239821845|gb|EEQ93414.1| C4-dicarboxylate transport protein [Ochrobactrum intermedium LMG
           3301]
          Length = 461

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 236/414 (57%), Positives = 323/414 (78%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P YK LY+QVLVAI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGIA
Sbjct: 33  IPFYKHLYVQVLVAIAAGILLGHFYPELGTQLKPLGDAFIKLVKMIIAPVIFLTVATGIA 92

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M DMK +G++  KAM  F  FS  AL++GLIV N+ +PG GM++D  SL+ +++A+  +
Sbjct: 93  GMTDMKKVGRVASKAMIYFLTFSTLALIVGLIVANVVQPGAGMHIDPASLDPKAVANYAA 152

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H ++  GF+ ++IP T + A   G+ILQ L  ++LFGI+L+LVG+K   +   L  + 
Sbjct: 153 KAHEQTITGFLSNIIPTTIVGAFAEGDILQVLFFSVLFGIALALVGDKGKPVTDFLHVLT 212

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
            PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +A
Sbjct: 213 APVFKLVAILMKAAPIGAFGAMAFTIGKYGIGSIANLALLIGTFYLTSLLFVLVVLGAVA 272

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSI+ LI ++KEE+LLVL TSSSE+ALP LM KME+AGC RS+V +V+PTGYSFNL
Sbjct: 273 RYNGFSILALIRYIKEELLLVLGTSSSEAALPALMDKMEKAGCKRSVVGLVIPTGYSFNL 332

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLA LFI+QAT++PLSL+DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++VP
Sbjct: 333 DGTNIYMTLAALFIAQATDIPLSLSDQILLLLVAMLSSKGAAGITGAGFITLAATLSVVP 392

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD       +  
Sbjct: 393 AVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTDKLAAAMNG 446


>gi|325266819|ref|ZP_08133491.1| DAACS family dicarboxylate/amino acid:cation symporter [Kingella
           denitrificans ATCC 33394]
 gi|324981751|gb|EGC17391.1| DAACS family dicarboxylate/amino acid:cation symporter [Kingella
           denitrificans ATCC 33394]
          Length = 436

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 228/425 (53%), Positives = 319/425 (75%), Gaps = 1/425 (0%)

Query: 2   KESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITP 61
            E        +   Y+ILY+QV+ AI  G+ LGHF P  G  M+PLGD F+K  KM+I P
Sbjct: 7   SELNSAQPIKKQKFYQILYVQVIFAIVVGILLGHFFPHTGEAMKPLGDAFIKIVKMIIAP 66

Query: 62  VIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKS 121
           VIFLTV TGIA M +MK +G++  K+   F  FS  AL++G++V N+ +PG  +N+D  +
Sbjct: 67  VIFLTVVTGIAGMTNMKKVGRVAGKSFVYFLTFSTLALLVGMLVANVIQPGSHLNIDPAT 126

Query: 122 LNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKS 180
           L+   ++ ++  +   S +GF+ ++IPDT +S L +GNILQ L V++LFG+SL++VG+K+
Sbjct: 127 LDAGKVSTYVDKAKDSSVVGFLMNIIPDTVVSPLVNGNILQVLFVSILFGVSLAMVGDKA 186

Query: 181 DTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSA 240
             I   L+E++ PVFRMV+++M +AP+GAFGAM+FTIGKYG+SSI +L+ LV   Y TS 
Sbjct: 187 RPITNLLQELSAPVFRMVAMLMNLAPVGAFGAMAFTIGKYGISSIGSLLLLVATFYITSI 246

Query: 241 FFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVS 300
            F+L VLG +A++  FSIIKL+ ++K+E+ LVL TSSSE+ALP LM+KME+AGC +S+V 
Sbjct: 247 LFVLVVLGAVAKYNGFSIIKLVKYIKDEMWLVLGTSSSEAALPTLMQKMEKAGCEKSVVG 306

Query: 301 MVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAF 360
           +V+PTGYSFNLDG+NIY+T+A LFI+QA  + LS  +Q SLLL+AM+SSKGAAGVTG+ F
Sbjct: 307 LVIPTGYSFNLDGTNIYMTMAALFIAQAVGIDLSWGEQFSLLLVAMLSSKGAAGVTGAGF 366

Query: 361 ITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFN 420
           ITLAAT+++VPS+P+AGM LILG+DRFMSECR++TN +GNA  TVVV+RWE  LD +   
Sbjct: 367 ITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNLVGNACATVVVARWENALDAEKLR 426

Query: 421 KYIGI 425
           + +  
Sbjct: 427 EALDG 431


>gi|322420767|ref|YP_004199990.1| sodium:dicarboxylate symporter [Geobacter sp. M18]
 gi|320127154|gb|ADW14714.1| sodium:dicarboxylate symporter [Geobacter sp. M18]
          Length = 437

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 214/416 (51%), Positives = 302/416 (72%), Gaps = 2/416 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y++LY QVL+AI  G+ALG+++P+ G  M+PLGD F+K  KM+ITPVIF TV TGIA
Sbjct: 4   KKFYQVLYFQVLLAISIGIALGYYLPETGAAMKPLGDGFIKMIKMIITPVIFCTVVTGIA 63

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M DMK +G++  KA+  F V S  AL IGL+V N+ +PG+GMN D+  L+T+ +A   +
Sbjct: 64  GMDDMKKVGRVGGKALLYFEVVSTLALGIGLLVINVVQPGVGMNADVTKLDTKGLAAYTA 123

Query: 133 SHAKS--FIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + AKS  F  F   +IP + + A   G ILQ L  A+LFG++LS +GE+   I K ++++
Sbjct: 124 TAAKSHSFADFALSIIPSSVVDAFAKGEILQVLFFAILFGLALSALGERGKPIYKFIDDV 183

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V+++M+ AP+GAFGAM+FTIGK+GL S++ L  L+   Y T   FI  VLG +
Sbjct: 184 SHALFAVVNMIMKFAPIGAFGAMAFTIGKFGLGSLAKLGMLMGSFYLTCLLFIFVVLGSI 243

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            + C FSI K I ++KEE+L+VL TSSSESALP +M K+E  GC +S+V MV+PTGYSFN
Sbjct: 244 CKICGFSIFKFITYIKEELLIVLGTSSSESALPRMMAKLENLGCTKSVVGMVIPTGYSFN 303

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +F++QATN PL++T  L++L + M++SKGAAGVTGS F+TLAAT   +
Sbjct: 304 LDGTSIYLTMAAIFVAQATNTPLTMTQTLTILGVLMLTSKGAAGVTGSGFVTLAATFAAI 363

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           P++P+AG+ LILG+DRFMSE R++TN +GN V TVVVSRWE +LD     + +  E
Sbjct: 364 PTIPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSRWENELDIDRMTRVLNQE 419


>gi|294788202|ref|ZP_06753445.1| C4-dicarboxylate transport protein [Simonsiella muelleri ATCC
           29453]
 gi|294483633|gb|EFG31317.1| C4-dicarboxylate transport protein [Simonsiella muelleri ATCC
           29453]
          Length = 438

 Score =  295 bits (755), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 236/419 (56%), Positives = 317/419 (75%), Gaps = 1/419 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +    +   Y++LY QV+VAI  G+ LGHF P  G  M+PLGD F+K  KM+I PVIFLT
Sbjct: 11  IQTVKKKKFYQVLYFQVIVAIVVGILLGHFFPNTGEAMKPLGDAFIKIVKMIIAPVIFLT 70

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V TGIA M DMK +G++  KA   F  FS  AL++G+IV N+ +PG GMN+D  +LN + 
Sbjct: 71  VVTGIAGMSDMKKVGRVAGKAFIYFITFSTLALIVGMIVANVVQPGAGMNIDPATLNPKK 130

Query: 127 IA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           ++ ++  +   S +GF+ ++IP+T +S L +GNILQ L V++LFGISL++VGEK+ TI  
Sbjct: 131 VSDYVIKAKESSVVGFLMNIIPETVVSPLNNGNILQVLFVSILFGISLAMVGEKARTITD 190

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            L++++ PVF+MVSI+M +AP+GAFGAMSFTIGKYG+ S+S L  LV   Y TS  F+L 
Sbjct: 191 FLQDLSAPVFKMVSILMNLAPIGAFGAMSFTIGKYGIQSVSKLFLLVGTFYLTSVLFVLI 250

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +AR+  FSIIKL+ ++K+E+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PT
Sbjct: 251 VLGAVARYNGFSIIKLVKYIKDELWLVLGTSSSEAALPTLMQKMERAGCEKSVVGLVIPT 310

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+T+A LFI+QA  + L L  Q+SLLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 311 GYSFNLDGTNIYMTMAALFIAQAVGIQLELHQQISLLLVAMLSSKGAAGVTGAGFITLAA 370

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           T+++VPS+P+ GM LILGVDRFMSECR++TN +GNA  TVVV+RWE  LD +     + 
Sbjct: 371 TLSVVPSVPVEGMALILGVDRFMSECRALTNLVGNACATVVVARWENALDKEQLTASLN 429


>gi|170741708|ref|YP_001770363.1| sodium:dicarboxylate symporter [Methylobacterium sp. 4-46]
 gi|168195982|gb|ACA17929.1| sodium:dicarboxylate symporter [Methylobacterium sp. 4-46]
          Length = 454

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 198/414 (47%), Positives = 288/414 (69%), Gaps = 1/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
             Y  LY+QVL AI  G+ LGHF PQIG QM+PLGD F+K  KM+I P+IF  V  GIA 
Sbjct: 14  KWYSHLYVQVLGAITVGVVLGHFYPQIGEQMKPLGDAFIKAIKMIIAPIIFFAVVHGIAS 73

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS- 132
           M DMK +G++  KA+  F V +  AL+IGL+V N+ KPG+G+N+DL +++ +SIA   + 
Sbjct: 74  MGDMKKVGRVGLKALIYFEVVTTLALIIGLVVVNLWKPGVGINLDLSTVDAKSIASFTAE 133

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +  +S + F+ ++IP T + A   G ILQ L  A+LF   L  +GE+   + + ++ +  
Sbjct: 134 AKDQSTVHFLMEIIPSTVVGAFAKGEILQVLFFAILFAFGLQALGERGGGVLRLIDTVGH 193

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F++V  +M+ AP+GAFGAM+FTIGKYG+S++ +L   +   Y T   FI  VLG +A 
Sbjct: 194 VFFKIVGYIMKAAPIGAFGAMAFTIGKYGISTLLSLGNFMLSFYTTCLLFIFVVLGSIAA 253

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FSI+K I ++KEE+L+VL TSSSES LP ++ KME  G  +S+V +VVPTGYSFNLD
Sbjct: 254 LHGFSILKFIRYIKEELLIVLGTSSSESVLPRMIAKMENLGADKSVVGLVVPTGYSFNLD 313

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+T+A +F++QATN+ L++  +L ++ + +++SKGAAGVTGS FI LAAT+  V +
Sbjct: 314 GTCIYLTMAVIFLAQATNIDLTVWQELGIIGVLLLTSKGAAGVTGSGFIVLAATLASVGT 373

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+A + LILGVDRFMSE R++TN IGN + T+VV++WE  LD ++  + +  E
Sbjct: 374 IPVASIALILGVDRFMSEARALTNVIGNGLATIVVAKWEGVLDEEVLRRRLNAE 427


>gi|172044377|sp|A4JI61|DCTA_BURVG RecName: Full=C4-dicarboxylate transport protein
          Length = 429

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 213/417 (51%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FAL++GL   ++ +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALLLGLAATHLLRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSIVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSI++ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 TIARFTGFSIVRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRDALKG 417


>gi|319791421|ref|YP_004153061.1| sodium:dicarboxylate symporter [Variovorax paradoxus EPS]
 gi|315593884|gb|ADU34950.1| sodium:dicarboxylate symporter [Variovorax paradoxus EPS]
          Length = 447

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 287/415 (69%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P YK LY QV+ AI  G+ LGHF P  G  M+PLGD F+K  KM+I P+IF TV  GIA
Sbjct: 8   KPFYKSLYFQVITAIVLGVLLGHFWPDTGASMKPLGDGFIKLIKMIIAPIIFCTVVVGIA 67

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK- 131
            M+DMK +G+    A+  F + S  ALV+GL++ NI +PG GMNVD+  L+ +S+A    
Sbjct: 68  GMEDMKKVGKTGGLALLYFEIVSSIALVVGLVIINIVRPGAGMNVDVSQLDAKSVAAYTG 127

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
               +S   F+ ++IP+T + A   G ILQ L++A++FG +L   G +   +   +E+ +
Sbjct: 128 PGKMQSTTDFLLNVIPNTVVDAFAKGEILQVLLIAVMFGFALHKFGGRGTLVFDVIEKGS 187

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +F +V  +M++AP+GAFGAM+FTIGKYG+SS+  L  L+   Y T   FI  VLG +A
Sbjct: 188 HVLFVIVGYIMKVAPIGAFGAMAFTIGKYGVSSLLQLGQLMATFYLTCLLFIFVVLGGIA 247

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           RF  FSI K I ++KEE+L+VL TSSSES LP +M K+E  G  +S+V +VVPTGYSFNL
Sbjct: 248 RFHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENLGAKKSVVGLVVPTGYSFNL 307

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+A +FI+QATN  ++LT QL+LL + +++SKGAAGVTGS FI LAAT++ V 
Sbjct: 308 DGTSIYLTMAAVFIAQATNTDMTLTQQLTLLAVLLLTSKGAAGVTGSGFIVLAATLSAVG 367

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ LILG+DRFMSE R++TN IGN V TVVV++W   LD    N+ +  E
Sbjct: 368 HVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWTDDLDTVRMNRILNQE 422


>gi|325104652|ref|YP_004274306.1| sodium:dicarboxylate symporter [Pedobacter saltans DSM 12145]
 gi|324973500|gb|ADY52484.1| sodium:dicarboxylate symporter [Pedobacter saltans DSM 12145]
          Length = 427

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 219/413 (53%), Positives = 308/413 (74%), Gaps = 1/413 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y+ILY+QVL+AI  G++LG+F P+ G  M+P GD F+   KM+I PVIF+TVS GIA
Sbjct: 13  KKFYQILYVQVLIAIAIGISLGYFYPETGEMMKPFGDGFIHLVKMIIAPVIFITVSMGIA 72

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-IK 131
            M D+K +G++  K+   F  FS  AL++GL V NI +PG G+N+D  +L+   + H I 
Sbjct: 73  GMNDLKSVGRVAGKSFAYFLTFSTLALIVGLFVSNIVQPGKGLNIDPTTLDKNQVTHFIS 132

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +   S + F+ ++IP T +S L+  NILQ L  A+LFG+ L+   EKS  +    + ++
Sbjct: 133 EAEHSSLLSFVMNVIPKTLISPLSGDNILQVLFAAILFGVGLARTSEKSKPVIDFFQALS 192

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
           +PVF++V ++M++APLGAFGAM+FTIGKYG+S++ NL +LV   Y TS  F++ +LG +A
Sbjct: 193 YPVFKIVELLMKLAPLGAFGAMAFTIGKYGISAVVNLAYLVLTFYFTSILFVVLILGAVA 252

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSI KL+ ++K+E+LLVL TSSSE+ALP LM+KME  GC +S+V +V+PTGYSFNL
Sbjct: 253 RYNGFSIFKLLNYIKDELLLVLGTSSSEAALPSLMQKMENVGCSKSVVGLVIPTGYSFNL 312

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+T+A LFI+QA N+ L++  Q+ LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP
Sbjct: 313 DGTNIYMTMAALFIAQACNIELNIQQQVVLLLVAMLSSKGAAGVTGAGFITLAATLAVVP 372

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
            +PIAGMTLILGVDRFMSECR++TN  GNAV TVVV++WE +LD +  ++ + 
Sbjct: 373 EVPIAGMTLILGVDRFMSECRALTNLAGNAVATVVVAKWEGQLDKEKLDESLN 425


>gi|218674572|ref|ZP_03524241.1| C4-dicarboxylate transporter DctA [Rhizobium etli GR56]
          Length = 444

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 237/416 (56%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R P Y  LY+QVL AI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  RKPFYSHLYVQVLAAIAAGILLGHFYPELGTQLKPLGDAFIKLVKMVIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-I 130
           A M D+K +G++  KAM  F  FS  ALVIG+IV N+ +PG GMN+D  SL+ +++A   
Sbjct: 75  AGMSDLKKVGRVAGKAMLYFLTFSTLALVIGMIVANVVQPGAGMNIDPASLDPKAVATFA 134

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEK + +   L  +
Sbjct: 135 DKAHEQSIVGFLSNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKGEQVVTFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++V I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +
Sbjct: 195 TAPIFKLVGILMKAAPIGAFGAMAFTIGKYGIGSIANLAMLIGTFYITSLLFVLVVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSILALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGIQLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWEK+LD       +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWEKELDTAQLAAALGGQ 430


>gi|188591033|ref|YP_001795633.1| c4-dicarboxylate transporter dcta [Cupriavidus taiwanensis LMG
           19424]
 gi|226723829|sp|B2AGL2|DCTA_CUPTR RecName: Full=C4-dicarboxylate transport protein
 gi|170937927|emb|CAP62911.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Cupriavidus taiwanensis LMG 19424]
          Length = 433

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 221/414 (53%), Positives = 315/414 (76%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P YKILY+QVL AI  G+ LGHF P  GV M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MRKPFYKILYVQVLFAICIGILLGHFWPDTGVAMKPLGDGFIKLIKMIIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH- 129
           IA M DMK +G++  KA+  F V S FAL+IGL   ++ KPG+G N+D  +L+T++IA  
Sbjct: 61  IAGMSDMKKVGRVGGKALLYFEVVSTFALLIGLGAAHLLKPGVGFNIDPATLDTKAIAQY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +  +H +S + F+  +IPDT  SA  +G+ILQ L+V+L FG +L+++GE++  + + +E+
Sbjct: 121 VSKAHGQSTVEFLMHIIPDTVFSAFANGDILQILLVSLFFGAALAVLGERARIVVQLIEQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   F +V ++ ++AP+GAFGAM+FTIGKYGL S+  L+ L+   Y T+  F+L VLG 
Sbjct: 181 VSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLVPLLKLIGTFYFTAIVFVLVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI++ I ++KEE+L+VL TSSSE+ALP +M+K+E+ GC +S+V +VVPTGYSF
Sbjct: 241 IARMTGFSIVRFIAYIKEELLIVLGTSSSEAALPHMMEKLEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FI+QAT + L+L  QL++L +AM++SKGA+GVTGS FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFIAQATGIELTLMQQLTILAVAMITSKGASGVTGSGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           VP++P+AGM LILG+DRFMSECR++TN IGN V TVVVS WE++LD K   + +
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNIIGNGVATVVVSAWERELDRKRLARVL 414


>gi|220916960|ref|YP_002492264.1| sodium:dicarboxylate symporter [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|254767173|sp|B8J708|DCTA_ANAD2 RecName: Full=C4-dicarboxylate transport protein
 gi|219954814|gb|ACL65198.1| sodium:dicarboxylate symporter [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 440

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 195/414 (47%), Positives = 295/414 (71%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L + LY+QVL+A+  G  +GH  P  G  ++PLGD F+K  KMLI P++F TV TGIA
Sbjct: 2   KRLARSLYLQVLLAVVLGALVGHLFPATGASLKPLGDGFIKLVKMLIAPIVFATVVTGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M D++ +G++  K +  F V +  AL IGL+V  +A+PG GMNVD  +L+T++IA   +
Sbjct: 62  KMGDLRKVGRVGLKGLLYFEVLTTVALAIGLVVARLARPGAGMNVDPATLDTKAIASYTN 121

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            + A   + F+ ++IP     A   G+ILQ L+ ++LFG +L+ + +K   + + ++ ++
Sbjct: 122 GAQAHGTVDFLMNVIPRDVADAFARGDILQVLLFSVLFGAALAALKDKGRPVLEFVDGLS 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V  VMR+AP+GAFGAM+FT+GKYG++++ +L  L+ C YATSA F++ +LG++ 
Sbjct: 182 LVLFRIVGFVMRLAPVGAFGAMAFTVGKYGIATLLSLGKLIACFYATSALFVVLMLGLVL 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+C  S+ + + ++KEE+ +VL TSSSESALP +M+KME+ GC + +V +VVP GYSFNL
Sbjct: 242 RWCGLSLFRFLRYIKEEIFVVLGTSSSESALPLMMRKMEKLGCSKPVVGLVVPMGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+TLATLFI+QATN  ++L  +L +L + +++SKGAA VTG  FITLAAT++ V 
Sbjct: 302 DGTSIYLTLATLFIAQATNTHVTLVQELEILAVLLLTSKGAAAVTGGGFITLAATLSAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AG+ L+LGVDRFMSE R++TN IGN V +V VSRWE +LD       +  
Sbjct: 362 NIPVAGLALLLGVDRFMSEARAITNLIGNGVASVAVSRWEGELDQARARAVLAG 415


>gi|239815033|ref|YP_002943943.1| C4-dicarboxylate transporter DctA [Variovorax paradoxus S110]
 gi|239801610|gb|ACS18677.1| sodium:dicarboxylate symporter [Variovorax paradoxus S110]
          Length = 447

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 200/421 (47%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +    + PLY+ LY+QV+ A+  G+ LGHF P +G  M+PLGD F+K  KM+I P+IF T
Sbjct: 6   ITPTRKLPLYRSLYVQVITAVIIGVLLGHFQPALGEAMKPLGDGFIKLIKMIIAPIIFCT 65

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V  GIA M+DMK +G+    A+  F + S  ALV+GL++ N+ KPG GMN+D  +L+T++
Sbjct: 66  VVVGIAGMEDMKKVGKTGGLALLYFEIVSSIALVVGLVLVNLLKPGAGMNIDPSTLDTKA 125

Query: 127 IAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           +A           + F+ ++IP T + A   G ILQ L++A+LFG +L   G +   +  
Sbjct: 126 LASYTGPGKMTGTVDFLLNVIPSTLVDAFAKGEILQVLLIAVLFGFALHRFGGRGTLVFD 185

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            +E+ +  +F +V  +M++AP+GAFGAM+FTIGKYGL S+ +L  L+   Y T   FI  
Sbjct: 186 VIEKGSHVLFVIVGYIMKLAPIGAFGAMAFTIGKYGLGSLFSLGKLMGTFYLTCLLFIFV 245

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG++ARF  FSI K I ++KEE+L+VL TSSSES LP +M+KME  G +++ V +V+PT
Sbjct: 246 VLGLIARFHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMEKMENLGANKTCVGLVIPT 305

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG++IY+T+A +FI+QATN P++L  +++LL + +++SKGAAGVTGS FI LAA
Sbjct: 306 GYSFNLDGTSIYLTMAAVFIAQATNTPMTLMQEITLLAVLLLTSKGAAGVTGSGFIVLAA 365

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           T++ V  +P+AG+ LILG+DRFMSE R++TN IGN V T+VV++W  +LD +  +  +  
Sbjct: 366 TLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKWTNELDTERLHAGLNN 425

Query: 426 E 426
           E
Sbjct: 426 E 426


>gi|197122184|ref|YP_002134135.1| sodium:dicarboxylate symporter [Anaeromyxobacter sp. K]
 gi|226723824|sp|B4UMI5|DCTA_ANASK RecName: Full=C4-dicarboxylate transport protein
 gi|196172033|gb|ACG73006.1| sodium:dicarboxylate symporter [Anaeromyxobacter sp. K]
          Length = 440

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 195/414 (47%), Positives = 295/414 (71%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L + LY+QVL+A+  G  +GH  P  G  ++PLGD F+K  KMLI P++F TV TGIA
Sbjct: 2   KRLARSLYLQVLLAVVLGALVGHLFPATGASLKPLGDGFIKLVKMLIAPIVFATVVTGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M D++ +G++  K +  F V +  AL IGL+V  +A+PG GMNVD  +L+T++IA   +
Sbjct: 62  KMGDLRKVGRVGLKGLLYFEVLTTVALAIGLVVARLARPGAGMNVDPATLDTKAIASYTN 121

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            + A   + F+ ++IP     A   G+ILQ L+ ++LFG +L+ + +K   + + ++ ++
Sbjct: 122 GAQAHGTVDFLMNVIPRDVADAFARGDILQVLLFSVLFGAALAALKDKGRPVLEFVDGLS 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V  VMR+AP+GAFGAM+FT+GKYG++++ +L  L+ C YATSA F++ +LG++ 
Sbjct: 182 LVLFRIVGFVMRLAPVGAFGAMAFTVGKYGIATLLSLGKLIACFYATSALFVVLMLGLVL 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+C  S+ + + ++KEE+ +VL TSSSESALP +M+KME+ GC + +V +VVP GYSFNL
Sbjct: 242 RWCGLSLFRFLRYIKEEIFVVLGTSSSESALPLMMRKMEKLGCSKPVVGLVVPMGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+TLATLFI+QATN  ++L  +L +L + +++SKGAA VTG  FITLAAT++ V 
Sbjct: 302 DGTSIYLTLATLFIAQATNTHVTLVQELEILAVLLLTSKGAAAVTGGGFITLAATLSAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AG+ L+LGVDRFMSE R++TN IGN V +V VSRWE +LD       +  
Sbjct: 362 NIPVAGLALLLGVDRFMSEARAITNLIGNGVASVAVSRWEGELDQARARAVLAG 415


>gi|317403469|gb|EFV83977.1| C4-dicarboxylate transporter [Achromobacter xylosoxidans C54]
          Length = 446

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 228/416 (54%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   Y+ILY+QVL AI  G+ LG+F P +G  MQPLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 12  KLKFYQILYVQVLFAIVVGILLGYFKPDLGQAMQPLGDGFIKLVKMIIAPVIFLTVATGI 71

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+K +G++  KAM  F VFS  AL++G++V ++ +PG GM+++  +L+ ++++ ++
Sbjct: 72  AAMSDLKKVGRVAGKAMLYFLVFSTLALIVGMLVSHLVQPGAGMHINPATLDQKAVSGYV 131

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H  +  GF+ ++IP T  S    G+ILQ L VA+LFGI+L+ VGE+   +   L  +
Sbjct: 132 AKAHDSTITGFLLNVIPTTIFSPFVGGDILQVLFVAVLFGIALAQVGERGKPVLDFLTAL 191

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++V+I+M+ AP+GAFGAM+FTIGKYG+ SI NL  LV   YATS  F++ VLG++
Sbjct: 192 AQPIFKLVAILMKAAPIGAFGAMAFTIGKYGIKSIINLAMLVGTFYATSVLFVVVVLGLV 251

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+KL+ +++EE+LLVL TSSSE+ALP LM+KME AGC +S+V +VVPTGYSFN
Sbjct: 252 ARYNGFSILKLVRYIREELLLVLGTSSSEAALPTLMQKMERAGCSKSVVGLVVPTGYSFN 311

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA ++PLSL DQ+ LLL+AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 312 LDGTNIYMTMAALFIAQACDIPLSLGDQILLLLVAMLSSKGAAGVTGAGFITLAATLSVV 371

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           P++P+AGM LILGVDRFMSECR++TN +GNA   VVV+RWE +LD    +  +  E
Sbjct: 372 PTVPVAGMALILGVDRFMSECRALTNLVGNATAAVVVARWEGELDKDQLHAALEGE 427


>gi|330818418|ref|YP_004362123.1| C4-dicarboxylate transport protein [Burkholderia gladioli BSR3]
 gi|327370811|gb|AEA62167.1| C4-dicarboxylate transport protein [Burkholderia gladioli BSR3]
          Length = 428

 Score =  293 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 215/418 (51%), Positives = 306/418 (73%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FALV+GL   ++ +PG G N+D  +LN + +A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHLLRPGAGFNIDPATLNGKEVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T   A   G ILQ L++ALLFG  L+ +GE+   +   +E
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMFDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
             +  +F +V I+ ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TSA F++ VLG
Sbjct: 181 GTSRVLFGIVHIITKLAPIGAFGAMAFTIGKYGVGSLIPLLKLIGTFYLTSAVFVVVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FS+I+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARFTGFSVIRFVAYIKEEMLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +VP++P+ GM LILG+DRFMSECR++TN +GN V T+VVS WEK+LD       +  E
Sbjct: 361 VVPTIPLTGMVLILGIDRFMSECRALTNIVGNGVATIVVSAWEKELDRNKLRAALNGE 418


>gi|107023806|ref|YP_622133.1| C4-dicarboxylate transporter DctA [Burkholderia cenocepacia AU
           1054]
 gi|116690893|ref|YP_836516.1| C4-dicarboxylate transporter DctA [Burkholderia cenocepacia HI2424]
 gi|122978675|sp|Q1BT95|DCTA_BURCA RecName: Full=C4-dicarboxylate transport protein
 gi|171855187|sp|A0KAU6|DCTA_BURCH RecName: Full=C4-dicarboxylate transport protein
 gi|105893995|gb|ABF77160.1| sodium:dicarboxylate symporter [Burkholderia cenocepacia AU 1054]
 gi|116648982|gb|ABK09623.1| sodium:dicarboxylate symporter [Burkholderia cenocepacia HI2424]
          Length = 430

 Score =  293 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 308/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P I   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPSIATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FAL++GL   ++ +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALLLGLAATHLLRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALKG 417


>gi|121603891|ref|YP_981220.1| C4-dicarboxylate transporter DctA [Polaromonas naphthalenivorans
           CJ2]
 gi|171769327|sp|A1VKX1|DCTA1_POLNA RecName: Full=C4-dicarboxylate transport protein 1
 gi|120592860|gb|ABM36299.1| sodium:dicarboxylate symporter [Polaromonas naphthalenivorans CJ2]
          Length = 452

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 201/416 (48%), Positives = 292/416 (70%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLY+ LY QV+ A+ +G+ALG+F P +G  M+PLGD F+K  KM+I P+IF TV  GI
Sbjct: 9   KLPLYRSLYFQVVCAVIAGVALGYFYPSVGESMKPLGDGFIKLIKMMIAPIIFCTVVVGI 68

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G+    A+  F V S FAL+IGL++ N+ +PG GMN+D  +L+T+SIA   
Sbjct: 69  AGMEDMKKVGKTGGLALLYFEVVSTFALIIGLLLVNLFQPGAGMNIDAATLDTKSIAAYT 128

Query: 132 -SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                 S   F+ ++IP   + A   G ILQ L++A+LFG +L   G +   +   +E+ 
Sbjct: 129 GPGKMVSTTDFILNVIPTAFVDAFAKGEILQVLLLAILFGFALHRFGGRGTLVFDMIEKS 188

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V  +M++AP+GAFGAM+FTIGKYG+ S+ +L  L+   Y T   FI GVLG +
Sbjct: 189 SHVLFTIVGFIMKVAPIGAFGAMAFTIGKYGVGSLFSLGKLMGAFYLTCLIFIFGVLGAI 248

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FS+ K I ++KEE+L+VL TSSSES LP +M+KME  G  ++ V +V+PTGYSFN
Sbjct: 249 ARIHGFSVWKFIKYIKEELLIVLGTSSSESVLPRMMEKMENLGAKKTTVGLVIPTGYSFN 308

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QATN P++L  +++LL + +++SKGAAGVTGS FI LAAT++ V
Sbjct: 309 LDGTSIYLTMAAVFIAQATNTPMTLMQEITLLGVLLLTSKGAAGVTGSGFIVLAATLSAV 368

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            ++P+AG+ LILG+DRFMSE R++TN IGN V T+VV++W  +LD +     +  E
Sbjct: 369 GTVPVAGLALILGIDRFMSEARALTNLIGNGVATLVVAKWTNELDMERLQAGLNNE 424


>gi|260220197|emb|CBA27495.1| C4-dicarboxylate transport protein 2 [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 469

 Score =  293 bits (750), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 200/414 (48%), Positives = 292/414 (70%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLYK LY+QVL A+  G+ LGHF PQ G  M+PLGD F+K  KM+I P+IF TV  GI
Sbjct: 28  RKPLYKSLYVQVLTAVALGVFLGHFFPQTGADMKPLGDAFIKLIKMIIAPIIFCTVVVGI 87

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G+    A+  F V S  AL+IGL+V N+ +PG GM+VD  SL+T+ IA   
Sbjct: 88  AGMEDMKKVGKTGGLALLYFEVVSTVALIIGLVVVNLLQPGSGMHVDPASLDTKGIAAYT 147

Query: 132 -SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                +  + F+ ++IP + + A   G ILQ L+ ++LFG +L   G +   +   +E+ 
Sbjct: 148 APGKMQGTVDFLLNIIPTSVIDAFAKGEILQVLLFSVLFGFALHKFGGRGTMVFDLIEKT 207

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V+I+M++AP+GAFGAM+FTIGKYG+ S+ +L  L+   Y T   F+ GVLGI+
Sbjct: 208 SHVLFDIVAIIMKVAPIGAFGAMAFTIGKYGVDSLFSLGKLMGAFYVTCLIFVFGVLGII 267

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           +R   FS+ + + ++KEE+L+VL TSSSES LP +M+K+E  G  +S+V +V+PTGYSFN
Sbjct: 268 SRLHGFSVWRFVRYIKEELLIVLGTSSSESVLPRMMEKLENLGARKSVVGLVIPTGYSFN 327

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QAT+ P+ LT QL+LL + +++SKGAAG+TGS FI LAAT++ V
Sbjct: 328 LDGTSIYLTMAAVFIAQATDTPMDLTQQLTLLAVLLLTSKGAAGITGSGFIVLAATLSAV 387

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+AG+ LILG+DRFMSE R++TN +GN V T+VV++W   LD +   + + 
Sbjct: 388 GHVPVAGLALILGIDRFMSEARALTNLVGNGVATLVVAKWTGDLDMERLTQGLA 441


>gi|71737962|ref|YP_275870.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123635489|sp|Q48FG6|DCTA_PSE14 RecName: Full=C4-dicarboxylate transport protein
 gi|71558515|gb|AAZ37726.1| C4-dicarboxylate transport protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 460

 Score =  293 bits (750), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 200/421 (47%), Positives = 298/421 (70%), Gaps = 1/421 (0%)

Query: 5   VQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIF 64
            +     R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF
Sbjct: 7   RKTAMTTRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIF 66

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            TV +GIA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+ 
Sbjct: 67  CTVVSGIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDA 126

Query: 125 ESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTI 183
             IA ++ +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +
Sbjct: 127 SKIAAYVTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPV 186

Query: 184 RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFI 243
              ++     +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T A F+
Sbjct: 187 LDFIDRFAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFV 246

Query: 244 LGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVV 303
           + VLG + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+
Sbjct: 247 VLVLGAICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVI 306

Query: 304 PTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITL 363
           PTGYSFNLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI L
Sbjct: 307 PTGYSFNLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVL 366

Query: 364 AATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           AAT++ V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       +
Sbjct: 367 AATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSEL 426

Query: 424 G 424
            
Sbjct: 427 A 427


>gi|170734218|ref|YP_001766165.1| C4-dicarboxylate transporter DctA [Burkholderia cenocepacia MC0-3]
 gi|254247103|ref|ZP_04940424.1| hypothetical protein BCPG_01881 [Burkholderia cenocepacia PC184]
 gi|226723826|sp|B1JZ77|DCTA_BURCC RecName: Full=C4-dicarboxylate transport protein
 gi|124871879|gb|EAY63595.1| hypothetical protein BCPG_01881 [Burkholderia cenocepacia PC184]
 gi|169817460|gb|ACA92043.1| sodium:dicarboxylate symporter [Burkholderia cenocepacia MC0-3]
          Length = 430

 Score =  293 bits (750), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 308/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P I   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPSIATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FAL++GL   ++ +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALLLGLAATHLLRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALKG 417


>gi|260459930|ref|ZP_05808183.1| sodium:dicarboxylate symporter [Mesorhizobium opportunistum
           WSM2075]
 gi|259034141|gb|EEW35399.1| sodium:dicarboxylate symporter [Mesorhizobium opportunistum
           WSM2075]
          Length = 442

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 231/415 (55%), Positives = 316/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLY  LY+QVLVAI  G+ LGH+ P IG  M+PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 14  RKPLYAQLYVQVLVAITVGILLGHYYPSIGESMKPLGDAFIKLVKMIIAPVIFLTVATGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D++ +G++  KAM  F  FS  AL+IGL+V N+ +PG G N+D  +L+  ++  + 
Sbjct: 74  AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLVVANVVQPGAGFNIDPATLDASTVNTYA 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S  GF+ ++IP T + A   G+ILQ L  ++LFGI+L+LVG++   +   L+ +
Sbjct: 134 AKAHDQSVTGFLMNIIPGTIVGAFADGDILQVLFFSVLFGIALALVGDRGAPVLNFLQAL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++VS++M+ AP+GAFGAM+FTIGKYG+ S+ NL  LV   YATS  F+  VLG +
Sbjct: 194 MAPMFKLVSVLMKAAPIGAFGAMAFTIGKYGIGSVINLAMLVGTFYATSLLFVFVVLGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI+ L+ ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 254 CRYNGFSILSLLRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN+ LS+ DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTLAALFIAQATNIHLSIGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILGVDRFMSECR++TNF+GNAV T+VV+RWE +LD     + +  
Sbjct: 374 PSVPVAGMALILGVDRFMSECRALTNFVGNAVATLVVARWEGELDEAKLARALAG 428


>gi|28868888|ref|NP_791507.1| C4-dicarboxylate transport protein [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971920|ref|ZP_03400020.1| C4-dicarboxylate transport protein [Pseudomonas syringae pv. tomato
           T1]
 gi|38257472|sp|Q885Z9|DCTA_PSESM RecName: Full=C4-dicarboxylate transport protein
 gi|28852127|gb|AAO55202.1| C4-dicarboxylate transport protein [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923345|gb|EEB56940.1| C4-dicarboxylate transport protein [Pseudomonas syringae pv. tomato
           T1]
          Length = 460

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 199/421 (47%), Positives = 298/421 (70%), Gaps = 1/421 (0%)

Query: 5   VQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIF 64
            +     R P+YK LY QV+VAI  G+ +GHF P+ G  ++PLGD F+K  KM+I P+IF
Sbjct: 7   RKTAMTTRQPIYKSLYFQVIVAIVIGILIGHFYPETGKALKPLGDGFIKLIKMVIAPIIF 66

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            TV +GIA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+ 
Sbjct: 67  CTVVSGIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDA 126

Query: 125 ESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTI 183
             IA ++ +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +
Sbjct: 127 SKIAAYVTAGKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPV 186

Query: 184 RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFI 243
              ++     +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T   F+
Sbjct: 187 LDFIDRFAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFV 246

Query: 244 LGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVV 303
           + VLG + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+
Sbjct: 247 VLVLGSICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAQKSVVGLVI 306

Query: 304 PTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITL 363
           PTGYSFNLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI L
Sbjct: 307 PTGYSFNLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVL 366

Query: 364 AATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           AAT++ V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       +
Sbjct: 367 AATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSEL 426

Query: 424 G 424
            
Sbjct: 427 A 427


>gi|311105289|ref|YP_003978142.1| C4-dicarboxylate transporter [Achromobacter xylosoxidans A8]
 gi|310759978|gb|ADP15427.1| C4-dicarboxylate transport protein [Achromobacter xylosoxidans A8]
          Length = 458

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 235/422 (55%), Positives = 326/422 (77%), Gaps = 1/422 (0%)

Query: 6   QVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFL 65
           QV    +   Y+ILY+QV+ AI  G+ LG F P++G QMQPLGD F+K  KM+I PVIFL
Sbjct: 6   QVAPARKLKFYQILYVQVIFAIVVGVLLGAFKPELGQQMQPLGDAFIKLVKMIIAPVIFL 65

Query: 66  TVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTE 125
           TV+TGIA M D+K +G++  KAM  F VFS  AL++G+IV +I +PG GM++D ++L+ +
Sbjct: 66  TVATGIAAMSDLKKVGRVAGKAMLYFLVFSTLALIVGMIVSHIVQPGAGMHIDPRTLDEK 125

Query: 126 SIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIR 184
           +++ ++  +H  +  GF+ ++IP T  S    G+ILQ L VA+LFGI+L++VGE+   I 
Sbjct: 126 AVSGYVAKAHDSTITGFLMNVIPTTIFSPFVGGDILQVLFVAVLFGIALAMVGERGQPIL 185

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
             +  +  PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ S+ NL  LV   YATS  F++
Sbjct: 186 NFMTALAQPVFKLVAILMKAAPVGAFGAMAFTIGKYGIKSVINLAMLVGTFYATSVLFVV 245

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLG++AR+  FSI+KL+ +++EE+LLVL TSSSE+ALP LM+KME AGC +S+V +VVP
Sbjct: 246 VVLGLVARYNGFSILKLVRYIREELLLVLGTSSSEAALPTLMQKMERAGCSKSVVGLVVP 305

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDG+NIY+T+A LFI+QA ++PLSL DQ+ LLL+AM+SSKGAAGVTG+ FITLA
Sbjct: 306 TGYSFNLDGTNIYMTMAALFIAQACDIPLSLGDQILLLLVAMLSSKGAAGVTGAGFITLA 365

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           AT+++VPS+P+AGM LILGVDRFMSECR++TN +GNA  TVVV+RWE +LD +  +  + 
Sbjct: 366 ATLSVVPSVPVAGMALILGVDRFMSECRALTNLVGNATATVVVARWEGELDQEQLHAALE 425

Query: 425 IE 426
            E
Sbjct: 426 GE 427


>gi|319794507|ref|YP_004156147.1| sodium:dicarboxylate symporter [Variovorax paradoxus EPS]
 gi|315596970|gb|ADU38036.1| sodium:dicarboxylate symporter [Variovorax paradoxus EPS]
          Length = 447

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 202/425 (47%), Positives = 292/425 (68%), Gaps = 1/425 (0%)

Query: 3   ESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
           E        + PLY+ LY+QV+ A+  G+ LG+F P IG  M+PLGD F+K  KM+I P+
Sbjct: 2   EHTTNTSAKKLPLYRSLYVQVITAVIIGVLLGYFYPAIGESMKPLGDGFIKLIKMIIAPI 61

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IF TV  GIA M+DMK +G+    A+  F V S  ALV+GL++ N+ KPG GMN+D  +L
Sbjct: 62  IFCTVVVGIAGMEDMKKVGKTGGLALLYFEVVSSIALVVGLVLVNVLKPGAGMNIDAATL 121

Query: 123 NTESIAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSD 181
           +T++IA           + F+ ++IP T + A   G ILQ L++A+LFG +L   G +  
Sbjct: 122 DTKAIAAYTGPGKMTGTVDFLLNIIPSTIVDAFAKGEILQVLLIAVLFGFALHRFGGRGT 181

Query: 182 TIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAF 241
            +   +E+ +  +F +V  +M++AP+GAFGAM+FTIGKYG+ S+ +L  L+   Y T   
Sbjct: 182 LVFDVIEKGSHVLFVIVGYIMKLAPIGAFGAMAFTIGKYGVGSLFSLGKLMGTFYLTCLL 241

Query: 242 FILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSM 301
           FI  VLG++ARF  FSI K I ++KEE+L+VL TSSSES LP +M+KME  G +++ V +
Sbjct: 242 FIFVVLGLIARFHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMEKMENLGANKTCVGL 301

Query: 302 VVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFI 361
           V+PTGYSFNLDG++IY+T+A +FI+QATN P++L  +++LL + +++SKGAAGVTGS FI
Sbjct: 302 VIPTGYSFNLDGTSIYLTMAAVFIAQATNTPMTLVQEITLLAVLLLTSKGAAGVTGSGFI 361

Query: 362 TLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNK 421
            LAAT++ V  +P+AG+ LILG+DRFMSE R++TN IGN V T+VV++W  +LD      
Sbjct: 362 VLAATLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKWTNELDMNRLQA 421

Query: 422 YIGIE 426
            +  E
Sbjct: 422 GLNNE 426


>gi|148767471|gb|ABR10708.1| DctA [Mesorhizobium sp. CJ1]
          Length = 442

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 234/415 (56%), Positives = 316/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLY  LY+QVLVAI  G+ LGH+ P IG  M+PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 14  RKPLYAQLYVQVLVAITVGILLGHYYPSIGESMKPLGDAFIKLVKMIIAPVIFLTVATGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D++ +G++  KAM  F  FS  AL+IGLIV N+ +PG G N+D  +L+  ++  + 
Sbjct: 74  AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLIVANVVQPGAGFNIDPATLDASTVNTYA 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S  GF+ ++IP T + A   G+ILQ L  ++LFGI+L+LVG+K   +   L+ +
Sbjct: 134 AKAHDQSVTGFLMNIIPGTIVGAFADGDILQVLFFSVLFGIALALVGDKGAPVLNFLQAL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++VS++M+ AP+GAFGAM+FTIGKYG+ S+ NL  LV   YATS  F+  VLG +
Sbjct: 194 MAPMFKLVSVLMKAAPIGAFGAMAFTIGKYGIGSVINLAMLVGTFYATSFLFVFVVLGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI+ LI ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 254 CRYNGFSILSLIRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN+ LS+ DQ+ LLL+AM+SSKGAAG+TG+ F+TLAAT+++V
Sbjct: 314 LDGTNIYMTLAALFIAQATNIHLSIGDQILLLLVAMLSSKGAAGITGAGFVTLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILGVDRFMSECR++TNFIGNAV T+VV+RWE +LD     + +  
Sbjct: 374 PSVPVAGMALILGVDRFMSECRALTNFIGNAVATLVVARWEGELDEAKLARALAG 428


>gi|113866329|ref|YP_724818.1| C4-dicarboxylate transporter DctA [Ralstonia eutropha H16]
 gi|123134494|sp|Q0KEX1|DCTA_RALEH RecName: Full=C4-dicarboxylate transport protein
 gi|113525105|emb|CAJ91450.1| Sodium:dicarboxylate symporter: DAACS family [Ralstonia eutropha
           H16]
          Length = 432

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 221/416 (53%), Positives = 314/416 (75%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P YKILY+QVL AI  G+ LGH+ P  GV M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MRKPFYKILYVQVLFAICVGILLGHYWPDTGVAMKPLGDGFIKLIKMIIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH- 129
           IA M DMK +G++  KA+  F V S FAL+IGL   ++ KPG+G N+D  +L+T++IA  
Sbjct: 61  IAGMSDMKKVGRVGGKALLYFEVVSTFALLIGLGAAHLLKPGVGFNIDPATLDTKAIAQY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +  +H +S + F+  +IPDT  SA  +G+ILQ L+V+L FG +L+++GE++  + + +E+
Sbjct: 121 VSKAHGQSTVEFLMHIIPDTVFSAFANGDILQILLVSLFFGAALAVLGERARIVVQLIEQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   F +V ++ ++AP+GAFGAM+FTIGKYGL S+  L+ L+   Y T+  F+L VLG 
Sbjct: 181 VSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLVPLLKLIGTFYFTAIIFVLVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI++ I ++KEE+L+VL TSSSE+ALP +M+K+E+ GC RS+V +VVPTGYSF
Sbjct: 241 IARMTGFSIVRFISYIKEELLIVLGTSSSEAALPHMMEKLEKLGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FI+QAT + L+L  QL++L +AM++SKGA+GVTGS FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFIAQATGIELTLMQQLTILAVAMITSKGASGVTGSGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P+AGM LILG+DRFMSECR++TN IGN V TVVVS WE++LD K     +  
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNIIGNGVATVVVSAWERELDRKRLASVLNG 416


>gi|71908607|ref|YP_286194.1| C4-dicarboxylate transporter DctA [Dechloromonas aromatica RCB]
 gi|123626841|sp|Q47BQ7|DCTA_DECAR RecName: Full=C4-dicarboxylate transport protein
 gi|71848228|gb|AAZ47724.1| Sodium:dicarboxylate symporter [Dechloromonas aromatica RCB]
          Length = 449

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 213/418 (50%), Positives = 303/418 (72%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             +  ++K LY QVLVAI  G++LGHF P+ G  M+PLGD F+K  KM+I P+IF T+  
Sbjct: 1   MAKKAVFKSLYFQVLVAIAIGVSLGHFYPETGAAMKPLGDGFIKLIKMIIAPIIFCTIVV 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GIA M+DMK +G+    A+  F V S  ALVIGLIV N+  PG+GMNVD+ +L+T+ IA 
Sbjct: 61  GIAGMEDMKKVGKTGGLAVLYFEVVSTIALVIGLIVVNVWAPGVGMNVDVSTLDTKGIAK 120

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           + +    ++   F+ ++IP + + A   G++LQ L  ++LFG ++   GE+   + + +E
Sbjct: 121 YAQPGQMQTTTDFLMNIIPTSVVDAFAKGDMLQVLFFSILFGYAMHSFGERGKPVFELIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
           +++  +F +V ++M++AP+GAFGAM++TIGK+G+ S++ L  L+   Y T   FILGVLG
Sbjct: 181 KLSHVLFGIVGVIMKVAPIGAFGAMAYTIGKHGVGSLAQLASLMGAFYLTCVIFILGVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +A F  FSIIKLI ++KEE+ LVL TSSSESALP LM KME AG  +S+V +VVPTGYS
Sbjct: 241 SIAAFHGFSIIKLIKYIKEELFLVLGTSSSESALPRLMAKMENAGAQKSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG++IY+T+A +FI+QATN PL L  Q++LL+I +++SKGAAGVTGS FI LAAT++
Sbjct: 301 FNLDGTSIYLTMAAVFIAQATNTPLDLQHQVTLLVILLLTSKGAAGVTGSGFIVLAATLS 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V ++P+AG+ LILG+DRFMSE R++TNFIGN+V T+VV++W   LD K  N  +  E
Sbjct: 361 AVGTVPVAGLALILGIDRFMSEARALTNFIGNSVATLVVAKWCNALDAKRMNAVLNNE 418


>gi|260461271|ref|ZP_05809519.1| sodium:dicarboxylate symporter [Mesorhizobium opportunistum
           WSM2075]
 gi|319785448|ref|YP_004144924.1| sodium:dicarboxylate symporter [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032808|gb|EEW34071.1| sodium:dicarboxylate symporter [Mesorhizobium opportunistum
           WSM2075]
 gi|317171336|gb|ADV14874.1| sodium:dicarboxylate symporter [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 452

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 216/415 (52%), Positives = 305/415 (73%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R   Y  LY+QVL AI  G+A+G+  P  G  ++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 33  RKAFYAQLYVQVLTAIALGVAVGYLYPGTGEALKPLGDAFIKLVKMIIAPVIFLTVTTGI 92

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D+K +G++  KAM  F  FS  AL++GL+V N+ +PG G+++D  SL+ +++  ++
Sbjct: 93  AGMNDLKKVGRVAGKAMIYFLTFSSLALMVGLVVANVVQPGSGLDIDPASLDGQAVQGYV 152

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
              H +S  GF+ ++IP T + A   GNILQ L  ++LFG +L++ G+    +   L+ +
Sbjct: 153 AKVHDQSVTGFLMNIIPSTIVGAFAEGNILQVLFFSILFGSALAMAGDTGKPVLSLLQAL 212

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V I+M+ AP+GAFGAM+FTIGKYG+ S+ NL  LV   Y T+  F+ G+LG +
Sbjct: 213 LAPVFKLVGILMQAAPVGAFGAMAFTIGKYGIGSVVNLAMLVATFYFTAFVFVFGILGAV 272

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI  L+ ++KEE+LLVL+TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 273 CRYNGFSIFSLVRYIKEELLLVLATSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 332

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN  LS+ DQ+ LL++AM+SSKGAAG+TG+ F+TLAAT++++
Sbjct: 333 LDGTNIYMTLAALFIAQATNTHLSVADQILLLVVAMLSSKGAAGITGAGFVTLAATLSVI 392

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P++P+AGM LILGVDRFMSECR++TN +GNAV  +VV+RWE +LD          
Sbjct: 393 PTVPVAGMALILGVDRFMSECRALTNVVGNAVAALVVARWEGELDEARMKAAFCG 447


>gi|86158522|ref|YP_465307.1| Sodium/dicarboxylate symporter [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|123736671|sp|Q2IJN7|DCTA_ANADE RecName: Full=C4-dicarboxylate transport protein
 gi|85775033|gb|ABC81870.1| Sodium/dicarboxylate symporter [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 440

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 195/414 (47%), Positives = 295/414 (71%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L + LY+QVL+A+  G  +GH  P  G  ++PLGD F+K  KMLI P++F TV TGIA
Sbjct: 2   KRLARSLYLQVLLAVVLGALVGHLFPATGASLKPLGDGFIKLVKMLIAPIVFATVVTGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M D++ +G++  K +  F V +  AL IGL+V  +A+PG GMNVD  +L+T++IA   +
Sbjct: 62  KMGDLRKVGRVGLKGLLYFEVLTTVALAIGLVVARLARPGAGMNVDPATLDTKAIASYTN 121

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            + A   + F+ ++IP     A   G+ILQ L+ ++LFG +L+ + +K   + + ++ ++
Sbjct: 122 GAQAHGTVDFLMNVIPRDVADAFARGDILQVLLFSVLFGAALAALKDKGRPVLEFVDGLS 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V  VMR+AP+GAFGAM+FT+GKYG++++ +L  L+ C YATSA F++ +LG++ 
Sbjct: 182 LVLFRIVGFVMRLAPVGAFGAMAFTVGKYGIATLLSLGKLIACFYATSALFVVLMLGLVL 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+C  S+ + + ++KEE+ +VL TSSSESALP +M+KME+ GC + +V +VVP GYSFNL
Sbjct: 242 RWCGLSLFRFLRYIKEEIFVVLGTSSSESALPLMMRKMEKLGCSKPVVGLVVPMGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+TLATLFI+QATN  ++L  +L +L + +++SKGAA VTG  FITLAAT++ V 
Sbjct: 302 DGTSIYLTLATLFIAQATNTHVTLVQELEILAVLLLTSKGAAAVTGGGFITLAATLSAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AG+ L+LGVDRFMSE R++TN IGN V +V VSRWE +LD       +  
Sbjct: 362 NIPVAGLALLLGVDRFMSEARAITNLIGNGVASVAVSRWEGELDQARARAVLAG 415


>gi|150376320|ref|YP_001312916.1| C4-dicarboxylate transporter DctA [Sinorhizobium medicae WSM419]
 gi|171460834|sp|A6UH53|DCTA_SINMW RecName: Full=C4-dicarboxylate transport protein
 gi|150030867|gb|ABR62983.1| sodium:dicarboxylate symporter [Sinorhizobium medicae WSM419]
          Length = 454

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 234/416 (56%), Positives = 328/416 (78%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLY+ LY+QVL AI +G+ LGHF P IG Q++PLGD F++  KM+I PVIFLTV+TGI
Sbjct: 24  KTPLYRHLYVQVLAAIAAGILLGHFYPDIGTQLKPLGDAFIRLVKMIIAPVIFLTVATGI 83

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+  +G++  KAM  F  FS  AL++GL+V N+ +PG GM++D  SL+ +++A + 
Sbjct: 84  AGMTDLAKVGRVAGKAMIYFLAFSTLALLVGLVVANLVQPGAGMHIDPASLDAKAVATYA 143

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L+ +
Sbjct: 144 QKAHEQSITGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKKAEPVVDFLQAL 203

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 204 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGIASIANLAMLIGTFYLTSFLFVFVVLGAV 263

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 264 ARYNGFSILSLVRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 323

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+ PLS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 324 LDGTNIYMTLAALFIAQATDTPLSYGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 383

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TNF+GNAV T+VV++WE +LD    +  +G E
Sbjct: 384 PSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVAKWEGELDQAQLSAALGGE 439


>gi|254251317|ref|ZP_04944635.1| Na+/H+-dicarboxylate symporter [Burkholderia dolosa AUO158]
 gi|124893926|gb|EAY67806.1| Na+/H+-dicarboxylate symporter [Burkholderia dolosa AUO158]
          Length = 429

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGH+ P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHYYPSLATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLLHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSLVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRSKLRDALKG 417


>gi|153010801|ref|YP_001372015.1| C4-dicarboxylate transporter DctA [Ochrobactrum anthropi ATCC
           49188]
 gi|167012303|sp|A6X4N2|DCTA_OCHA4 RecName: Full=C4-dicarboxylate transport protein
 gi|151562689|gb|ABS16186.1| sodium:dicarboxylate symporter [Ochrobactrum anthropi ATCC 49188]
          Length = 444

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 237/414 (57%), Positives = 323/414 (78%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P YK LY+QVLVAI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGIA
Sbjct: 16  IPFYKHLYVQVLVAIAAGILLGHFYPELGTQLKPLGDAFIKLVKMIIAPVIFLTVATGIA 75

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M DMK +G++  KAM  F  FS  AL+IGLIV N+ +PG GM++D  SL+ +++A+  +
Sbjct: 76  GMTDMKKVGRVAGKAMIYFLTFSTLALIIGLIVANVVQPGAGMHIDPASLDPKAVANYAA 135

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H ++  GF+ ++IP T + A   G+ILQ L  ++LFGI+L+LVG+K   +   L  + 
Sbjct: 136 KAHEQTITGFLSNIIPTTIVGAFADGDILQVLFFSVLFGIALALVGDKGKPVTDFLHVLT 195

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
            PVF++VSI+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y T+  F+L VLG +A
Sbjct: 196 APVFKLVSILMKAAPIGAFGAMAFTIGKYGIGSIANLALLIGTFYLTALLFVLVVLGAVA 255

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSI+ LI ++KEE+LLVL TSSSE+ALP LM KME+AGC RS+V +V+PTGYSFNL
Sbjct: 256 RYNGFSILALIRYIKEELLLVLGTSSSEAALPALMDKMEKAGCKRSVVGLVIPTGYSFNL 315

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLA LFI+QAT++PLSL+DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++VP
Sbjct: 316 DGTNIYMTLAALFIAQATDIPLSLSDQILLLLVAMLSSKGAAGITGAGFITLAATLSVVP 375

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD       +  
Sbjct: 376 AVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTDKLAAAMNG 429


>gi|170702729|ref|ZP_02893589.1| sodium:dicarboxylate symporter [Burkholderia ambifaria IOP40-10]
 gi|170132364|gb|EDT00832.1| sodium:dicarboxylate symporter [Burkholderia ambifaria IOP40-10]
          Length = 429

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V S FAL++GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEVVSTFALLLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLLHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 TIARVTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALTG 417


>gi|161523610|ref|YP_001578622.1| C4-dicarboxylate transporter DctA [Burkholderia multivorans ATCC
           17616]
 gi|189351621|ref|YP_001947249.1| C4-dicarboxylate transporter DctA [Burkholderia multivorans ATCC
           17616]
 gi|221199907|ref|ZP_03572950.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2M]
 gi|221207424|ref|ZP_03580433.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2]
 gi|221211117|ref|ZP_03584096.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD1]
 gi|226723827|sp|A9AEI1|DCTA_BURM1 RecName: Full=C4-dicarboxylate transport protein
 gi|160341039|gb|ABX14125.1| sodium:dicarboxylate symporter [Burkholderia multivorans ATCC
           17616]
 gi|189335643|dbj|BAG44713.1| DAACS family dicarboxylate/amino acid:cation (Na+ or H+) symporter
           [Burkholderia multivorans ATCC 17616]
 gi|221168478|gb|EEE00946.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD1]
 gi|221172627|gb|EEE05065.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2]
 gi|221180146|gb|EEE12550.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2M]
          Length = 429

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 309/417 (74%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGH+ P +  +M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIVVGVILGHYYPSLATEMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLRQALKG 417


>gi|134098512|ref|YP_001104173.1| sodium/dicarboxylate symporter family protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291003272|ref|ZP_06561245.1| sodium/dicarboxylate symporter family protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133911135|emb|CAM01248.1| sodium:dicarboxylate symporter: DAACS family [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 489

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 161/414 (38%), Positives = 261/414 (63%), Gaps = 2/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   L++QVL+A   G+  GHF P  G  ++P+GD F++  KM+I P+IF  V  GIA
Sbjct: 14  KNVLSSLFVQVLIAAVIGIIAGHFWPDFGEALKPVGDGFIRLIKMVIAPLIFCVVVVGIA 73

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-IK 131
           +  DM+ +G+I  KA+  F + +  AL +GL+ GN+ +PG G+NVD  +L+T  +    +
Sbjct: 74  KAGDMRSVGRIGLKALIYFEIVTTAALALGLVAGNVFQPGAGLNVDPSTLDTSGVEEKTQ 133

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVG-EKSDTIRKCLEEI 190
                    F+  MIPD+A+ A     +LQ L+ A+LF   L  VG +++  +   +E+ 
Sbjct: 134 GGQMPGPAEFVLHMIPDSAVGAFAENELLQVLLFAVLFASGLLHVGIDRAPQVFNFIEQA 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              +F+++  VMR+AP+  FG+M++ IG+YGLSS+S    L+   Y ++  FI+ +  ++
Sbjct: 194 GEIIFKVIGYVMRLAPIAVFGSMAYLIGQYGLSSLSTYAKLIGACYGSALLFIVLLGILM 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
                 S+++ + + +EE  L + T+SSE  +P +M+K+E AGC +  V +VVPTGYSFN
Sbjct: 254 RVLTGLSLVRFLRYTREEFALAVGTASSECVMPRMMEKLERAGCRKEAVGLVVPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY++LATLF++QA  V L++  Q++++L+ +++SKG AGV GSAFI L+AT + V
Sbjct: 314 LDGASIYLSLATLFMAQAVGVDLTIGQQVTVVLVLILTSKGMAGVPGSAFIALSATASAV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+A + L+LG DR M   R VTN +GN V T +VS+W+  LD     + + 
Sbjct: 374 GVIPVAAVALMLGADRIMDTMRVVTNLLGNCVATFIVSKWDNALDQNQARQVLS 427


>gi|172061831|ref|YP_001809483.1| C4-dicarboxylate transporter DctA [Burkholderia ambifaria MC40-6]
 gi|226723825|sp|B1YNL7|DCTA_BURA4 RecName: Full=C4-dicarboxylate transport protein
 gi|171994348|gb|ACB65267.1| sodium:dicarboxylate symporter [Burkholderia ambifaria MC40-6]
          Length = 429

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V S FAL++GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEVVSTFALLLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLLHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSIVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 TIARVTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALAG 417


>gi|171321611|ref|ZP_02910540.1| sodium:dicarboxylate symporter [Burkholderia ambifaria MEX-5]
 gi|171093110|gb|EDT38329.1| sodium:dicarboxylate symporter [Burkholderia ambifaria MEX-5]
          Length = 429

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V S FAL++GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEVVSTFALLLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLLHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARVTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALTG 417


>gi|222109252|ref|YP_002551516.1| sodium:dicarboxylate symporter [Acidovorax ebreus TPSY]
 gi|254767175|sp|B9M9U5|DCTA_DIAST RecName: Full=C4-dicarboxylate transport protein
 gi|221728696|gb|ACM31516.1| sodium:dicarboxylate symporter [Acidovorax ebreus TPSY]
          Length = 450

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 239/418 (57%), Positives = 313/418 (74%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            +R P Y+ LY QV+ AI  G+ LGHF P+ G  M+P GD F+K  KM+I PVIFLT+ T
Sbjct: 12  SVRLPFYRQLYFQVVFAIIIGVLLGHFQPEYGAAMKPFGDAFIKLIKMIIAPVIFLTIVT 71

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-A 128
           GIA M  +  +G++F KAM  F  FS  ALV+GL+V N+ +PG GM++++  L+  ++  
Sbjct: 72  GIASMSHLSAVGRVFGKAMAYFLTFSTLALVVGLVVANVMQPGTGMHINVAELDQTAVKG 131

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           ++  SH  +  GF  D+IP T +S     NILQ L+VA+LFG+SL++VG+    I   L+
Sbjct: 132 YVSKSHEMTLTGFALDIIPKTLISPFVGDNILQVLLVAVLFGVSLAMVGDAGKPILDFLD 191

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +  PVF++V+IVM+ AP+GAFGAM+FTIGK+GL S+ NL  LV   Y TSA F+L VLG
Sbjct: 192 GLTKPVFKLVNIVMKAAPIGAFGAMAFTIGKFGLGSLVNLAELVLTFYITSAVFVLVVLG 251

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +VVPTGYS
Sbjct: 252 AVARACGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCSKSVVGLVVPTGYS 311

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+TLA LFI+QAT+  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ 
Sbjct: 312 FNLDGTNIYMTLAALFIAQATDTHLTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLA 371

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD    ++ +  E
Sbjct: 372 VVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDADRLHRVLDGE 429


>gi|262278423|ref|ZP_06056208.1| aerobic C4-dicarboxylate transporter [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258774|gb|EEY77507.1| aerobic C4-dicarboxylate transporter [Acinetobacter calcoaceticus
           RUH2202]
          Length = 452

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 302/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G +++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGILVGHFSPSSTQIVNGVEQHIPGLGEKLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F V S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEVVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S I F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NVDPTTLDTSGIQKYVSSGESQSTIDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K ++++    F +V++VM++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKFIDQVAHVFFNIVNMVMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYITCLLFIFLILGTISRISGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDVQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N+ + 
Sbjct: 421 DKDKLNEALN 430


>gi|115352979|ref|YP_774818.1| C4-dicarboxylate transporter DctA [Burkholderia ambifaria AMMD]
 gi|123128072|sp|Q0BBI9|DCTA_BURCM RecName: Full=C4-dicarboxylate transport protein
 gi|115282967|gb|ABI88484.1| sodium:dicarboxylate symporter [Burkholderia ambifaria AMMD]
          Length = 429

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGHF P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHFYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V S FAL++GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEVVSTFALLLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLLHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSIVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 TIARVTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALTG 417


>gi|325920584|ref|ZP_08182503.1| Na+/H+ dicarboxylate symporter [Xanthomonas gardneri ATCC 19865]
 gi|325548931|gb|EGD19866.1| Na+/H+ dicarboxylate symporter [Xanthomonas gardneri ATCC 19865]
          Length = 448

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 241/413 (58%), Positives = 313/413 (75%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F K+M  F  FS  AL++G+IV ++ +PG GMN++   L+  ++  +++ 
Sbjct: 75  MTHLKTVGRVFAKSMAYFLFFSTLALIVGMIVAHVVQPGAGMNINPAELDQSAVNTYVQK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  S +GF+ D+IP T +SA   GNILQ L VA+LFGI+L+LVGE+   +   LE +  
Sbjct: 135 SHELSLVGFLMDIIPATLISAFVDGNILQVLFVAVLFGIALALVGERGRPVLSFLEALTA 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVFR+V ++MR AP+GAFGA++FTIGKYGL S+ NL +LV   Y TS FF+L +LGI+ R
Sbjct: 195 PVFRLVHMLMRAAPIGAFGAIAFTIGKYGLESLVNLAWLVGSFYVTSLFFVLVILGIVCR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
            C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +VVPTGYSFNLD
Sbjct: 255 LCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATNV L+L  Q++LL +AM+SSKGAAGVTG+ FITLAAT+++VP 
Sbjct: 315 GTNIYMTLAALFIAQATNVDLTLGQQITLLAVAMLSSKGAAGVTGAGFITLAATLSVVPD 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       +  
Sbjct: 375 VPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDQLKLVLDG 427


>gi|13476029|ref|NP_107599.1| C4-dicarboxylate transporter DctA [Mesorhizobium loti MAFF303099]
 gi|20137906|sp|Q986R8|DCTA2_RHILO RecName: Full=C4-dicarboxylate transport protein 2
 gi|14026789|dbj|BAB53385.1| C4-dicarboxylate transport protein [Mesorhizobium loti MAFF303099]
          Length = 442

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 233/415 (56%), Positives = 316/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLY  LY+QVLVAI  G+ LGH+ P IG  M+PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 14  RKPLYAQLYVQVLVAITVGILLGHYYPSIGESMKPLGDAFIKLVKMIIAPVIFLTVATGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M D++ +G++  KAM  F  FS  AL+IGL+V N+ +PG G N+D  +L+  ++  + 
Sbjct: 74  AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLVVANVVQPGAGFNIDPATLDASTVNTYA 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H +S  GF+ ++IP T + A   G+ILQ L  ++LFGI+L+LVG+K   +   L+ +
Sbjct: 134 AKAHDQSVTGFLMNIIPGTIVGAFADGDILQVLFFSVLFGIALALVGDKGAPVLNFLQAL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++VS++M+ AP+GAFGAM+FTIGKYG+ S+ NL  LV   YATS  F+  VLG +
Sbjct: 194 MAPMFKLVSVLMKAAPIGAFGAMAFTIGKYGIGSVINLAMLVGTFYATSLLFVFVVLGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI+ L+ ++KEE+LLVL TSSSE+ALP LM+KME+AG  RS+V +V+PTGYSFN
Sbjct: 254 CRYNGFSILSLLRYIKEELLLVLGTSSSEAALPSLMEKMEKAGAKRSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QATN+ LS+ DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTLAALFIAQATNIHLSMGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILGVDRFMSECR++TNFIGNAV T+VV+RWE +LD     + +  
Sbjct: 374 PSVPVAGMALILGVDRFMSECRALTNFIGNAVATLVVARWEGELDEAKLARALAG 428


>gi|17545049|ref|NP_518451.1| C4-dicarboxylate transporter DctA [Ralstonia solanacearum GMI1000]
 gi|20137806|sp|Q8Y2K5|DCTA1_RALSO RecName: Full=C4-dicarboxylate transport protein 1
 gi|17427339|emb|CAD13858.1| probable c4-dicarboxylate transport 1. transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 428

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 216/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGHF P++ V M+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIVIGVLLGHFEPKLAVNMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FALVIGL+ G+I  PG G NVD+ S++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEVVSTFALVIGLVAGHIFNPGSGFNVDVNSIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + + S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +GE++  +   +++
Sbjct: 121 AAKAQSSSTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGALSAMGERAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I    FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y T+  F++ VLGI
Sbjct: 181 IAHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVVSLVPLLKLIGTFYLTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+LT QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTLTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  +
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRTKLARVMSGD 417


>gi|167585337|ref|ZP_02377725.1| C4-dicarboxylate transporter DctA [Burkholderia ubonensis Bu]
          Length = 429

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 219/417 (52%), Positives = 307/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGH+ P +  +M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHYYPSLATEMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V S FALV+GL   +I +PG+G N+D  +LN + +A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEVVSTFALVLGLAATHILRPGVGFNIDPATLNGKEVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L+VALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLVALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR   FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARITGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN IGN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIIGNGVATVVVSAWEKELDRNKLRQAMKG 417


>gi|299769370|ref|YP_003731396.1| C4-dicarboxylate transporter DctA [Acinetobacter sp. DR1]
 gi|298699458|gb|ADI90023.1| C4-dicarboxylate transporter DctA [Acinetobacter sp. DR1]
          Length = 452

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 202/430 (46%), Positives = 301/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G +++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGVLVGHFSPSSTQIVNGVEQHIPGLGEKLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F V S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEVVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           N+D  +L+T  I  ++ S  ++S I F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NIDPTTLDTSGIQKYVSSGESQSTIDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K ++++    F +V+++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKFIDQVAHVFFNIVNMIMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLILC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYVTCLLFIFLILGTISRMSGFSILKMIRMIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DKDKLNDALN 430


>gi|38257448|sp|Q848I3|DCTA_PSECL RecName: Full=C4-dicarboxylate transport protein
 gi|28932741|gb|AAO60164.1| dicarboxylic acid transporter [Pseudomonas chlororaphis]
          Length = 444

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 199/415 (47%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY QV+VAI  G+ LGHF PQ GV ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGL+V N+ +PG GM++D+ +L+   +A +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GA GAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K+LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAELA 417


>gi|241205680|ref|YP_002976776.1| C4-dicarboxylate transporter DctA [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859570|gb|ACS57237.1| sodium:dicarboxylate symporter [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 444

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 320/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y  LY+QVL AI +G+ LGHF P+ G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  KKPFYSHLYVQVLAAIAAGILLGHFYPEFGTQLKPLGDAFIKLVKMIIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M D++ +G++  KAM  F  FS  AL+IGLIV N+ +PG GMN+D  SL+  ++A   
Sbjct: 75  AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLIVANVVQPGAGMNIDPASLDPAAVAGYA 134

Query: 132 SS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           +  H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEKS+ +   L  +
Sbjct: 135 AKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKSEPVVNFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +
Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLIGTFYLTSLLFVLVVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGIHLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD       +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTAQLAAALGGQ 430


>gi|78067684|ref|YP_370453.1| C4-dicarboxylate transporter DctA [Burkholderia sp. 383]
 gi|123567558|sp|Q39CK7|DCTA_BURS3 RecName: Full=C4-dicarboxylate transport protein
 gi|77968429|gb|ABB09809.1| Sodium/dicarboxylate symporter [Burkholderia sp. 383]
          Length = 429

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 214/417 (51%), Positives = 308/417 (73%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YK+LY+QV+ AI  G+ LGH+ P +   M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPFYKVLYVQVIFAIIVGVILGHYYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FAL++GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALLLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 TIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALTG 417


>gi|34499162|ref|NP_903377.1| C4-dicarboxylic acids transport protein (Na+/H+ dicarboxylate
           symporter) [Chromobacterium violaceum ATCC 12472]
 gi|81654553|sp|Q7NRS3|DCTA_CHRVO RecName: Full=C4-dicarboxylate transport protein
 gi|34105013|gb|AAQ61369.1| C4-dicarboxylic acids transport protein (Na+/H+ dicarboxylate
           symporter) [Chromobacterium violaceum ATCC 12472]
          Length = 441

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 202/417 (48%), Positives = 300/417 (71%), Gaps = 2/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            + P +  LY+QVL+AI  G+ LG   P +G +M+PLGD F+K  KM+I P+IF TV  G
Sbjct: 3   TKTPFFSRLYVQVLIAIALGVTLGALAPDLGAKMKPLGDAFIKLIKMMIAPIIFATVVVG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA+M DMK +G++  KA+F F   +  ALVIGLIV N+ +PG G+N+D  +L+ + IA  
Sbjct: 63  IAKMGDMKEVGRVGVKALFYFEAVTTLALVIGLIVVNLLQPGAGLNIDPHTLHAKDIAKF 122

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +   + + F+  +IPDT + A  SG ILQ L  ++L G++L+ +G+   TI   L+E
Sbjct: 123 TAGAKEMNTVDFLLHIIPDTVVGAFASGEILQVLTFSVLLGLALTKMGDNGKTIVHILDE 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++M++AP+GAFGAM+FTIGKYG+ S+  L FL+ C+Y T   F+  VLG 
Sbjct: 183 FSHALFGVINMLMKLAPIGAFGAMAFTIGKYGIGSLKQLGFLMACVYLTCFAFVFIVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FS+ + ++++KEE+LLVL TSSSESALPG+MKK+E  GC + +V MVVPTGYSF
Sbjct: 243 IARFSGFSLWRFLVYIKEEILLVLGTSSSESALPGIMKKLENLGCSKPVVGMVVPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATNV L+L ++L+++ + +++SKGAA VTG  FITLAAT+  
Sbjct: 303 NLDGTSIYLTMAAIFIAQATNVNLTLGEELAIIGVLLLTSKGAAAVTGGGFITLAATLAT 362

Query: 370 VPS-LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +   LP+ G+ L++G+DRFMSE R++TN IGN V TVV+++WEK LD +   + +  
Sbjct: 363 LGGKLPVEGLALLIGIDRFMSEARAITNLIGNGVATVVIAKWEKALDVERMRQVLEG 419


>gi|171915871|ref|ZP_02931341.1| sodium:dicarboxylate symporter [Verrucomicrobium spinosum DSM 4136]
          Length = 461

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 203/417 (48%), Positives = 289/417 (69%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P YKILY+QV++AI  G+ LG+F P  G  M+PLGD F++  KMLI P+IF TV  G
Sbjct: 13  TRKPFYKILYVQVIMAIVIGVLLGYFFPATGAAMKPLGDGFIRLIKMLIAPIIFCTVVVG 72

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G+    A+  F V S  AL++GL++ N+ +PG GMN    + +  S+A  
Sbjct: 73  IAGMEDMKKVGKTGGLALLYFEVVSTLALILGLVMINLVQPGKGMNKVATATDAASVAQY 132

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
             S   +S   F+ ++IP + + A   G ILQ L+ A+LFG +L   G +   +   +E+
Sbjct: 133 SDSDKMQSTTDFLMNIIPTSVVDAFAKGEILQVLLFAILFGFALHRFGGRGTLVFDLIEK 192

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +V IVM++AP+GAFGAM+FTIGKYG+SS+ NL  L+   YAT   FI GVLG+
Sbjct: 193 TSHVLFGIVGIVMKVAPIGAFGAMAFTIGKYGVSSLWNLGGLMATFYATCLLFIFGVLGL 252

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FS+ K I ++KEE+L+VL TSSSES LP ++ K+E  G  +S V +VVPTGYSF
Sbjct: 253 IARLHGFSVWKFIKYIKEELLIVLGTSSSESVLPRIIAKLENLGVQKSTVGLVVPTGYSF 312

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN PL L  Q++LLL+ +++SKGAAGVTGS FI LAAT++ 
Sbjct: 313 NLDGTSIYLTMAAVFIAQATNTPLDLQHQITLLLVLLLTSKGAAGVTGSGFIVLAATLSA 372

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           V  +P+AG+  ILG+DRFMSE R++TN +GN V T+VV +W  ++D  + ++ +  E
Sbjct: 373 VGHVPVAGLAFILGIDRFMSEARALTNLVGNGVATIVVGKWCGEVDEAMLHRRLNNE 429


>gi|299068144|emb|CBJ39361.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Ralstonia solanacearum CMR15]
          Length = 428

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 217/417 (52%), Positives = 315/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGH  P++ VQM+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIVIGVLLGHLEPKLAVQMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FALV+GLI G+I  PG G NVD+ +++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEVVSTFALVLGLIAGHIFNPGSGFNVDVNTIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H+ S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +GE++  +   +++
Sbjct: 121 AAKAHSASTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGALSAMGERAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I+   FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ LV   Y T+  F++ VLGI
Sbjct: 181 ISHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVISLVPLLKLVGTFYLTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+LT QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTLTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  +
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRTKLARVMSGD 417


>gi|158424638|ref|YP_001525930.1| C4-dicarboxylate transport protein [Azorhizobium caulinodans ORS
           571]
 gi|172047998|sp|A8IDZ2|DCTA_AZOC5 RecName: Full=C4-dicarboxylate transport protein
 gi|158331527|dbj|BAF89012.1| C4-dicarboxylate transport protein [Azorhizobium caulinodans ORS
           571]
          Length = 446

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 230/414 (55%), Positives = 318/414 (76%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y+ LY+QVL AI  G+ LGHF P +G QM+PLGD F+K  KM+I PVIFLTV TGIA
Sbjct: 15  RKFYQHLYVQVLAAIAIGILLGHFYPDLGTQMKPLGDAFIKLVKMVIAPVIFLTVVTGIA 74

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M+D+  +G++  KAM  F  FS  AL+IGLI+ N+ +PG GM++   SL+ +++A   +
Sbjct: 75  GMRDLAKVGRVAGKAMIYFLTFSTLALIIGLIIANVVQPGAGMHIAPASLDPKAVASYAA 134

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H  S IGF+ ++IPDT +SAL SG+ILQ L  ++LFGI+L+ VG++ + +   L   +
Sbjct: 135 KAHDASIIGFLMNIIPDTPISALGSGDILQVLFFSVLFGIALAGVGDRGEPVMNVLVSAS 194

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V I+M+ AP+GAFGAM+FTIG+YG+ S++NL FL+   Y TS  F++ VLG++A
Sbjct: 195 QAMFRLVHILMKAAPIGAFGAMAFTIGRYGIGSVANLAFLILTFYITSFLFVVVVLGLVA 254

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSI  L+ ++KEE+LLVL TSSSE+ALP L++KME AGC +S+V +V+PTGYSFNL
Sbjct: 255 RYNGFSIFALLRYIKEELLLVLGTSSSEAALPSLIEKMERAGCRKSVVGLVIPTGYSFNL 314

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLA LFI+QAT++ LSL DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++VP
Sbjct: 315 DGTNIYMTLAALFIAQATDIHLSLGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVVP 374

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AGM LILG+DRFMSECR++TNFIGNAV T+VV+RWE +LD       +  
Sbjct: 375 TVPLAGMALILGIDRFMSECRAITNFIGNAVATIVVARWEGELDKDKLAAALSG 428


>gi|260550908|ref|ZP_05825114.1| aerobic C4-dicarboxylate transporter [Acinetobacter sp. RUH2624]
 gi|260406035|gb|EEW99521.1| aerobic C4-dicarboxylate transporter [Acinetobacter sp. RUH2624]
          Length = 451

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 203/430 (47%), Positives = 301/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G Q++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGVLVGHFSPSTTQIVNGVEHHIPGLGEQLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           N+D  +L+T  I  ++ S  ++S + F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NIDPATLDTSGIQKYVTSGESQSTVDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I    F +V+++M++APLGAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKLIDQIAHVFFNIVNMIMKLAPLGAFGAMAFTIGKYGVGSLVQLGQLILC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  VLG ++R   FSI+K++  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYITCLLFIFLVLGTISRLSGFSILKMVRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DKDKLNDALN 430


>gi|325527613|gb|EGD04918.1| C4-dicarboxylate transporter DctA [Burkholderia sp. TJI49]
          Length = 429

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 214/417 (51%), Positives = 310/417 (74%), Gaps = 1/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P+YK+LY+QV+ AI  G+ LGH+ P +  +M+PLGD F+K  KM+I P+IF TV T
Sbjct: 1   MKKKPIYKVLYVQVIFAIVVGVILGHYYPSLATEMKPLGDGFIKLIKMVIGPIIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F + S FAL++GL   +I +PG+G N+D  +L+ +++A 
Sbjct: 61  GIAGMEDMKKVGRVGGKALLYFEIVSTFALLLGLAATHILRPGVGFNIDPATLDGKAVAS 120

Query: 130 IKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++
Sbjct: 121 YAAKAHGQSTVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFID 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG
Sbjct: 181 GLTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYS
Sbjct: 241 AIARFTGFSIIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLA 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 361 VVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLRQALKG 417


>gi|330877103|gb|EGH11252.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 450

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 198/415 (47%), Positives = 296/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVLVLGS 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+ KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|293609570|ref|ZP_06691872.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828022|gb|EFF86385.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 452

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 203/430 (47%), Positives = 301/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G +++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGILVGHFSPSSTQIVNGVEQHIPGLGEKLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S I F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NVDPTTLDTSGIQKYVSSGESQSTIDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K ++++    F +V++VM++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKFIDQVAHVFFNIVNMVMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYITCLLFIFLILGTISRISGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DKDKLNDALN 430


>gi|320327609|gb|EFW83621.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330876300|gb|EGH10449.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 450

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 200/415 (48%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T A F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFVVLVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|83720161|ref|YP_440957.1| C4-dicarboxylate transporter DctA [Burkholderia thailandensis E264]
 gi|83653986|gb|ABC38049.1| C4-dicarboxylate transport protein [Burkholderia thailandensis
           E264]
          Length = 444

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 217/418 (51%), Positives = 308/418 (73%), Gaps = 1/418 (0%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
             ++ P YK+LY+QV+ AI  G+ LGH  P + V M+PLGD F+K  KM+I P+IF TV 
Sbjct: 15  TIVKKPFYKVLYVQVIFAIVVGVLLGHLYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVV 74

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
           TGIA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +LN + +A
Sbjct: 75  TGIAGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLNGKEVA 134

Query: 129 HIKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   +
Sbjct: 135 SYAAKAHGQSTVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFI 194

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VL
Sbjct: 195 DGITRVLFGIVHIVTKLAPVGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVL 254

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +ARF  FSI++ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGY
Sbjct: 255 GAIARFTGFSIVRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGY 314

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+
Sbjct: 315 SFNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATL 374

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
            +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    +  +  
Sbjct: 375 AVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLHAALSG 432


>gi|121592445|ref|YP_984341.1| sodium:dicarboxylate symporter [Acidovorax sp. JS42]
 gi|171769303|sp|A1W1Z0|DCTA_ACISJ RecName: Full=C4-dicarboxylate transport protein
 gi|120604525|gb|ABM40265.1| sodium:dicarboxylate symporter [Acidovorax sp. JS42]
          Length = 450

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 239/418 (57%), Positives = 313/418 (74%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            +R P Y+ LY QV+ AI  G+ LGHF P+ G  M+P GD F+K  KM+I PVIFLT+ T
Sbjct: 12  SVRLPFYRQLYFQVVFAIIIGVLLGHFQPEYGAAMKPFGDAFIKLIKMIIAPVIFLTIVT 71

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-A 128
           GIA M  +  +G++F KAM  F  FS  ALV+GL+V N+ +PG GM++++  L+  ++  
Sbjct: 72  GIASMSHLSAVGRVFGKAMAYFLTFSTLALVVGLVVANVMQPGTGMHINVAELDQTAVKG 131

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           ++  SH  +  GF  D+IP T +S     NILQ L+VA+LFG+SL++VG+    I   L+
Sbjct: 132 YVSKSHEMTLTGFALDIIPKTLISPFVGDNILQVLLVAVLFGVSLAMVGDAGKPILDFLD 191

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +  PVF++V+IVM+ AP+GAFGAM+FTIGK+GL S+ NL  LV   Y TSA F+L VLG
Sbjct: 192 GLTKPVFKLVNIVMKAAPIGAFGAMAFTIGKFGLGSLVNLAELVLTFYITSAVFVLVVLG 251

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +VVPTGYS
Sbjct: 252 AVARACGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCAKSVVGLVVPTGYS 311

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+TLA LFI+QAT+  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ 
Sbjct: 312 FNLDGTNIYMTLAALFIAQATDTHLTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLA 371

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD    ++ +  E
Sbjct: 372 VVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDADRLHRVLDGE 429


>gi|76809133|ref|YP_332054.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 1710b]
 gi|76578586|gb|ABA48061.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei
           1710b]
          Length = 444

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 217/418 (51%), Positives = 307/418 (73%), Gaps = 1/418 (0%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
             ++ P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV 
Sbjct: 15  TTVKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVV 74

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
           TGIA M+DMK +G++  KA+  F + S  ALV+GL   +I +PG+G N+D  +LN + +A
Sbjct: 75  TGIAGMQDMKKVGRVGGKALLYFEIVSTCALVLGLAATHILRPGVGFNIDPATLNGKEVA 134

Query: 129 HIKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   +
Sbjct: 135 SYAAKAHGQSSVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFI 194

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VL
Sbjct: 195 DGITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVL 254

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGY
Sbjct: 255 GAIARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGY 314

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+
Sbjct: 315 SFNLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATL 374

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
            +VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  
Sbjct: 375 AVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLRAALSG 432


>gi|330986731|gb|EGH84834.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 450

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 200/415 (48%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T A F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFVVLVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|222107127|ref|YP_002547918.1| C4-dicarboxylate transport protein [Agrobacterium vitis S4]
 gi|254767172|sp|B9K2V4|DCTA_AGRVS RecName: Full=C4-dicarboxylate transport protein
 gi|221738306|gb|ACM39202.1| C4-dicarboxylate transport protein [Agrobacterium vitis S4]
          Length = 444

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 322/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY QV+VAI  G+ LGHF PQ G  ++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 13  KLPFYRHLYFQVIVAIIGGILLGHFYPQTGEALKPLGDAFIKLVKMVIAPVIFLTVATGI 72

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+K +G++  KAM  F  FS  ALV+G++V NI +PG GM+++  +L+ +++A + 
Sbjct: 73  AGMSDLKKVGRVAGKAMIYFLCFSTLALVVGMLVSNILQPGAGMHINPATLDGKAVASYA 132

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H  +  GF+ ++IPDT + A   G+ILQ L  ++LFG++L++VG+    +   L+ +
Sbjct: 133 QQAHDSTITGFLMNIIPDTIVGAFAKGDILQVLFFSVLFGLALAMVGDLGKPVTNFLQAL 192

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL FL+   Y TS  F+L VLG +
Sbjct: 193 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGIGSIANLAFLIGTFYLTSLLFVLVVLGGV 252

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME AGC RS+V +V+PTGYSFN
Sbjct: 253 ARYNGFSILALIRYIKEELLLVLGTSSSEAALPGLMAKMERAGCKRSVVGLVIPTGYSFN 312

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT++ LSL DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 313 LDGTNIYMTLAALFIAQATDIQLSLGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 372

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TNFIGNAV TVVV+RWE +LD   F   +  E
Sbjct: 373 PSVPVAGMALILGIDRFMSECRALTNFIGNAVATVVVARWENELDQTQFRAAMAGE 428


>gi|301384489|ref|ZP_07232907.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060523|ref|ZP_07252064.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. tomato
           K40]
 gi|302134650|ref|ZP_07260640.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|331016775|gb|EGH96831.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 450

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 199/415 (47%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P+ G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPETGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVLVLGS 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAQKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|302384111|ref|YP_003819934.1| sodium:dicarboxylate symporter [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194739|gb|ADL02311.1| sodium:dicarboxylate symporter [Brevundimonas subvibrioides ATCC
           15264]
          Length = 452

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 229/416 (55%), Positives = 314/416 (75%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++   Y+ LY+QVL AI  G  +GHF P  G  ++PLGD F+K  KM+I PVIFLT+ TG
Sbjct: 13  VKRAWYRHLYVQVLGAILLGGLIGHFFPAFGESLKPLGDGFIKLVKMVIAPVIFLTIVTG 72

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+D+  +G++  KA   F VFS  AL++GL VGN+ +PG G+N+D  SL+  ++A  
Sbjct: 73  IAGMRDLGRVGRVAAKAFGYFLVFSTLALIVGLEVGNLVQPGRGLNIDPASLDPAAVAQY 132

Query: 131 -KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
             ++H  + IGF+  +IPDT +SA ++GNILQ L V++LFGI+L+ VG+    +   LE 
Sbjct: 133 STAAHETTIIGFLLGVIPDTFVSAFSTGNILQVLFVSVLFGIALAGVGDAGKPVLTFLEA 192

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   F++V+IVM+ AP+GAFGA +FTIG YG+++++NLI LV   Y T+A F++GVLG+
Sbjct: 193 VSSAFFKLVAIVMKAAPIGAFGAFAFTIGAYGIATVANLIALVATFYLTAAIFVIGVLGL 252

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +     FSI KLI +LKEE+LLVL TSSSE+ALP L++KME AG  +S+V +VVPTGYSF
Sbjct: 253 VGVANGFSIFKLIRYLKEELLLVLGTSSSEAALPSLLQKMERAGASKSVVGLVVPTGYSF 312

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QA N+ LSL DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+ +
Sbjct: 313 NLDGTNIYMTMAALFIAQALNIDLSLQDQILLLLVAMLSSKGAAGITGAGFITLAATLAV 372

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VPS+PIAGM LILG+DRFMSECR++TNFIGNAV T+VV+RWE +LD     + +  
Sbjct: 373 VPSVPIAGMALILGIDRFMSECRALTNFIGNAVATLVVARWEGELDRDALREALDG 428


>gi|320323413|gb|EFW79501.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 450

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 200/415 (48%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     + + ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLEFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T A F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFVVLVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|330966569|gb|EGH66829.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 450

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 198/415 (47%), Positives = 296/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVLVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+ KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|320334023|ref|YP_004170734.1| C4-dicarboxylate transport protein [Deinococcus maricopensis DSM
           21211]
 gi|319755312|gb|ADV67069.1| C4-dicarboxylate transport protein [Deinococcus maricopensis DSM
           21211]
          Length = 437

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 214/414 (51%), Positives = 302/414 (72%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           P L++ LY+QVL+AI  G+ LGHF P++G  ++PLGD F+K  KMLI+P+IF TV +GIA
Sbjct: 2   PRLFRSLYVQVLIAIALGILLGHFAPKLGEGLKPLGDGFIKLIKMLISPIIFATVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI-K 131
            M+D K IG++  KA+  F V +  AL+IGL+V N+ +PG GMN+D  SL+T  I    +
Sbjct: 62  HMRDTKKIGRVGGKALIYFEVVTTAALLIGLLVVNVLQPGRGMNIDPASLDTSGITKYTE 121

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           ++  +S   F+  +IPDT +SA TSG++LQ L+VA+LFG +L+ +GE  + + + ++ IN
Sbjct: 122 AAGEQSVADFVLHVIPDTFVSAFTSGDLLQVLLVAILFGFALTRLGELGERLLRGIDAIN 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VF ++  VMR+AP+GAFGAM+FTIGKYG+ S+  L  L+   Y T   FI+ VLG +A
Sbjct: 182 TAVFTVLGFVMRLAPIGAFGAMAFTIGKYGVGSLQQLAALMIAFYLTCVLFIVVVLGSIA 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   F++ + I ++KEE+LLVL TSSSESALP L+ K+E+AG  R +V +VVP GYSFNL
Sbjct: 242 RAAGFNLFRFIRYIKEELLLVLGTSSSESALPRLITKLEDAGAARPVVGLVVPAGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+A +FI+QATN PL+L+ QL L+LI +++SKGAAGVTGS FITLAAT+  V 
Sbjct: 302 DGTSIYLTMAAVFIAQATNTPLTLSHQLGLILILLLTSKGAAGVTGSGFITLAATLAAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++P+AG+ LILG+DRFMSE R++TNFIGN V  +V++R E  LD       +  
Sbjct: 362 TVPVAGLALILGIDRFMSEARALTNFIGNGVAALVIARSEGALDDARLQAALSG 415


>gi|70731813|ref|YP_261555.1| C4-dicarboxylate transporter DctA [Pseudomonas fluorescens Pf-5]
 gi|68346112|gb|AAY93718.1| C4-dicarboxylate transport protein [Pseudomonas fluorescens Pf-5]
          Length = 452

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 202/421 (47%), Positives = 299/421 (71%), Gaps = 1/421 (0%)

Query: 5   VQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIF 64
            ++    R PLYK LY QV+VAI  G+ LGHF PQ GV ++PLGD F+K  KM+I P+IF
Sbjct: 6   RKLAMTTRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIF 65

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            TV +GIA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GM++D  +L+ 
Sbjct: 66  CTVVSGIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMHIDASTLDA 125

Query: 125 ESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTI 183
             +A ++ + + +S +GF+ ++IP T + A  +G+ILQ L+ +++FG +L  +G     +
Sbjct: 126 SKVAAYVTAGNDQSIVGFILNIIPATIVGAFANGDILQVLMFSVVFGFALHRLGAYGKPV 185

Query: 184 RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFI 243
              ++     +F +++++M++APLGA GAM+FTIG YG+ S+  L  L+ C Y T   F+
Sbjct: 186 LDFIDRFAHVMFNIINMIMKLAPLGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFV 245

Query: 244 LGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVV 303
           L VLG + R   FS+IKLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+
Sbjct: 246 LVVLGAICRAHGFSVIKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVI 305

Query: 304 PTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITL 363
           PTGYSFNLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ ++SSKGAAGVTGS FI L
Sbjct: 306 PTGYSFNLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVL 365

Query: 364 AATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           AAT++ V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K+LD       +
Sbjct: 366 AATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDKLQSEL 425

Query: 424 G 424
            
Sbjct: 426 A 426


>gi|300692697|ref|YP_003753692.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Ralstonia solanacearum PSI07]
 gi|299079757|emb|CBJ52433.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Ralstonia solanacearum PSI07]
          Length = 428

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 214/416 (51%), Positives = 312/416 (75%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGH+ P++ VQM+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIVIGVLLGHYSPKLAVQMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FALVIGLI G+I  PG G NVD+ +++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEVVSTFALVIGLIAGHIFNPGSGFNVDVNTIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + + S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +G+++  +   +++
Sbjct: 121 AAKAQSSSTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGALSAMGDRAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I    FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y T+  F++ VLGI
Sbjct: 181 IAHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVVSLVPLLKLIGTFYLTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+ T QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRTKLARVMSG 416


>gi|260554447|ref|ZP_05826668.1| aerobic C4-dicarboxylate transporter [Acinetobacter baumannii ATCC
           19606]
 gi|260410989|gb|EEX04286.1| aerobic C4-dicarboxylate transporter [Acinetobacter baumannii ATCC
           19606]
          Length = 452

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 301/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G Q++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGVLVGHFSPSTTQIVNGVEQHIPGLGEQLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S I F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NVDPATLDTSGIQKYVTSGESQSTIDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I    F +V+++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKLIDQIAHVFFNIVNMIMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYITCLLFIFFILGTISRISGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DKDKLNDALN 430


>gi|241767415|ref|ZP_04765117.1| sodium:dicarboxylate symporter [Acidovorax delafieldii 2AN]
 gi|241361821|gb|EER58080.1| sodium:dicarboxylate symporter [Acidovorax delafieldii 2AN]
          Length = 450

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 204/418 (48%), Positives = 294/418 (70%), Gaps = 1/418 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
               + PLY+ LY+QVL A+ +G+ LGHF P +G QM+PLGD F+K  KM+I P+IF TV
Sbjct: 6   SAPKKLPLYRSLYVQVLTAVVAGVLLGHFYPALGEQMKPLGDGFIKLIKMIIAPIIFCTV 65

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
             GIA M+DMK +G+    A+  F V S  ALVIGL+  N+ +PG GMNVD  +L+T+++
Sbjct: 66  VVGIAGMEDMKKVGKTGGLALLYFEVVSTVALVIGLLCVNVLQPGAGMNVDASTLDTKAL 125

Query: 128 -AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
            A+       S   F+ ++IP T + A   G ILQ L+VA++FG +L   G +   +   
Sbjct: 126 NAYTGPGKMASTTEFLMNIIPTTVIDAFAKGEILQVLLVAVMFGFALHRFGGRGTLVFDV 185

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
           +E+ +  +F +V  +M++AP+GAFGAMSFTIGKYG+ ++ +L  L+   Y T   FI  V
Sbjct: 186 IEKTSHVLFTIVGYIMKVAPIGAFGAMSFTIGKYGVGTLLSLGKLMGVFYLTCLLFIFVV 245

Query: 247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTG 306
           LG +ARF  FSI K I ++KEE+L+VL TSSSES LP +M+KME  G  +S V +V+PTG
Sbjct: 246 LGTIARFHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMEKMELLGAKKSTVGLVIPTG 305

Query: 307 YSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAAT 366
           YSFNLDG++IY+T+A +FI+QATN P++L  +++LL + +++SKGAAG+TGS FI LAAT
Sbjct: 306 YSFNLDGTSIYLTMAAVFIAQATNTPMTLMQEVTLLAVLLLTSKGAAGITGSGFIVLAAT 365

Query: 367 ITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           ++ V ++P+AG+ LILG+DRFMSE R++TN IGN V T+VV++W  +LD    +K++ 
Sbjct: 366 LSAVGTVPVAGLALILGIDRFMSEARALTNLIGNGVATLVVAKWTDELDTAQLDKHLN 423


>gi|213158680|ref|YP_002319978.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB0057]
 gi|213057840|gb|ACJ42742.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB0057]
          Length = 452

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 301/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G Q++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGVLVGHFSPSTTQIVNGVEQHIPGLGEQLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S I F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NVDPATLDTSGIQKYVTSGESQSSIDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I    F +V+++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKLIDQIAHVFFNIVNMIMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYITCLLFIFLILGTISRISGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DKDKLNDALN 430


>gi|169795334|ref|YP_001713127.1| C4-dicarboxylate transporter DctA [Acinetobacter baumannii AYE]
 gi|184158798|ref|YP_001847137.1| C4-dicarboxylate transporter DctA [Acinetobacter baumannii ACICU]
 gi|215482868|ref|YP_002325071.1| Aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           AB307-0294]
 gi|239502894|ref|ZP_04662204.1| C4-dicarboxylate transporter DctA [Acinetobacter baumannii AB900]
 gi|332850445|ref|ZP_08432765.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013150]
 gi|332871895|ref|ZP_08440307.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013113]
 gi|332875168|ref|ZP_08443001.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6014059]
 gi|169148261|emb|CAM86126.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           AYE]
 gi|183210392|gb|ACC57790.1| Na+/H+-dicarboxylate symporter [Acinetobacter baumannii ACICU]
 gi|193077828|gb|ABO12703.2| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           ATCC 17978]
 gi|213987484|gb|ACJ57783.1| Aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           AB307-0294]
 gi|322507389|gb|ADX02843.1| C4-dicarboxylate transport protein [Acinetobacter baumannii 1656-2]
 gi|323518713|gb|ADX93094.1| C4-dicarboxylate transporter DctA [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332730716|gb|EGJ62027.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013150]
 gi|332731109|gb|EGJ62410.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013113]
 gi|332736612|gb|EGJ67606.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6014059]
          Length = 452

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 301/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G Q++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGVLVGHFSPSTTQIVNGVEQHIPGLGEQLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S I F+  +IPDT + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NVDPATLDTSGIQKYVTSGESQSTIDFLMHIIPDTVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I    F +V+++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKLIDQIAHVFFNIVNMIMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYITCLLFIFLILGTISRISGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DKDKLNDALN 430


>gi|197119593|ref|YP_002140020.1| sodium/C4-dicarboxylate symporter, DctA [Geobacter bemidjiensis
           Bem]
 gi|254767686|sp|B5E9Q0|DCTA_GEOBB RecName: Full=C4-dicarboxylate transport protein
 gi|197088953|gb|ACH40224.1| sodium/C4-dicarboxylate symporter, DctA [Geobacter bemidjiensis
           Bem]
          Length = 439

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 210/416 (50%), Positives = 297/416 (71%), Gaps = 2/416 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y+ LY QVL AI  G+A+G+++P  G  M+PLGD F+K  KM+ITP+IF TV TGIA
Sbjct: 4   KKFYQHLYFQVLTAISIGVAVGYYMPDTGTAMKPLGDGFIKMIKMIITPIIFCTVVTGIA 63

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M DMK +G++  KA+  F   S  AL IGL+V N+ +PG+GMN D+  L+T+ +A   +
Sbjct: 64  GMDDMKKVGRVGGKALLYFEAVSTLALAIGLMVINVIQPGVGMNADVTKLDTKGLATYTA 123

Query: 133 SHAKS--FIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + AKS  F  F   +IP++ + A   G ILQ L  A+LFG++LS +GEK   + + ++++
Sbjct: 124 TAAKSHSFADFALGIIPNSVVDAFAKGEILQVLFFAILFGLALSAMGEKGKPVYRMIDDV 183

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
               F +V+I+M+ AP+GAFGAM+FTIGK+GL S++ L  L+   Y T   FI  VLG +
Sbjct: 184 AHAFFGVVNIIMKFAPIGAFGAMAFTIGKFGLGSLTKLGMLMGSFYLTCLLFIFVVLGTI 243

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            + C F+I K I ++KEE+L+VL TSSSESALP LM K+E  GC +S+V +V+PTGYSFN
Sbjct: 244 GKLCGFNIFKFISYIKEELLIVLGTSSSESALPRLMAKLENLGCSKSVVGLVIPTGYSFN 303

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +F++QATN PL LT  L++L + M++SKGAAGVTGS F+TLAAT   +
Sbjct: 304 LDGTSIYLTMAAVFVAQATNTPLDLTQTLTILGVLMLTSKGAAGVTGSGFVTLAATFAAI 363

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           P++P+AG+ LILG+DRFMSE R++TN +GN V TVVVSRWE +L+    ++ +  E
Sbjct: 364 PTIPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSRWENELNATRMSQVLNKE 419


>gi|289627101|ref|ZP_06460055.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289648112|ref|ZP_06479455.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298487953|ref|ZP_07005992.1| Aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157504|gb|EFH98585.1| Aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866034|gb|EGH00743.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 450

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 200/414 (48%), Positives = 297/414 (71%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T A F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFVVLVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+ KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       +
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSEL 416


>gi|21232775|ref|NP_638692.1| C4-dicarboxylate transporter DctA [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767153|ref|YP_241915.1| C4-dicarboxylate transporter DctA [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188990247|ref|YP_001902257.1| C4-dicarboxylate transporter DctA [Xanthomonas campestris pv.
           campestris str. B100]
 gi|24211634|sp|Q8P5J5|DCTA_XANCP RecName: Full=C4-dicarboxylate transport protein
 gi|81306863|sp|Q4UYH8|DCTA_XANC8 RecName: Full=C4-dicarboxylate transport protein
 gi|226723856|sp|B0RP10|DCTA_XANCB RecName: Full=C4-dicarboxylate transport protein
 gi|21114595|gb|AAM42616.1| C4-dicarboxylate transport protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572485|gb|AAY47895.1| C4-dicarboxylate transport protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732007|emb|CAP50195.1| C4-dicarboxylate symporter [Xanthomonas campestris pv. campestris]
          Length = 448

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 238/413 (57%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F K+M  F  FS  AL++G++V ++ +PG GMN++   L+  ++  +++ 
Sbjct: 75  MTHLKTVGRVFAKSMTYFLFFSTLALIVGMVVAHVVQPGAGMNINPAELDQSAVNTYVQK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  S +GF+ D+IP T +SA   GNILQ L VA+LFGI+L+LVGE+   +   LE +  
Sbjct: 135 SHELSLVGFLMDIIPATLISAFVDGNILQVLFVAVLFGIALALVGERGRPVLSFLEALTA 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVFR+V ++M+ AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS FF+L +LGI+ R
Sbjct: 195 PVFRLVHMLMKAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLFFVLVILGIVCR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
            C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +VVPTGYSFNLD
Sbjct: 255 LCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATNV L+L  Q++LL +AM+SSKGAAGVTG+ FITLAAT+++VP 
Sbjct: 315 GTNIYMTLAALFIAQATNVDLTLGQQITLLAVAMLSSKGAAGVTGAGFITLAATLSVVPD 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD    +  +  
Sbjct: 375 VPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDQLSLALDG 427


>gi|119387488|ref|YP_918522.1| sodium:dicarboxylate symporter [Paracoccus denitrificans PD1222]
 gi|171704482|sp|A1BBD2|DCTA_PARDP RecName: Full=C4-dicarboxylate transport protein
 gi|119378063|gb|ABL72826.1| sodium:dicarboxylate symporter [Paracoccus denitrificans PD1222]
          Length = 455

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 243/415 (58%), Positives = 306/415 (73%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P Y+ LY QVL AI +G  +GHF P+ G  ++PLGD F+K  KM+I PVIFLT+ TG+A
Sbjct: 15  RPFYRHLYFQVLCAIVAGALIGHFYPETGEALKPLGDAFIKLVKMIIAPVIFLTIVTGLA 74

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  +K +G +  KA   F  FS  ALV+GLI  N+ +PG GMN+D  SL+   +A   S
Sbjct: 75  GMGTLKGVGSVVGKAFGYFLTFSTLALVVGLITANVIRPGAGMNIDPASLDASKVADYAS 134

Query: 133 -SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H  S  GF+ D+IP T  SA   GNILQ L VA+LFGI L L+G+K   +    E I+
Sbjct: 135 KAHESSLTGFVMDIIPSTITSAFVDGNILQVLFVAILFGIGLILIGDKGKPVVALFEAIS 194

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFRMV I+M+ AP+GAFGA +FTIGKYG++S+ NL  LV   Y TSA F++ VLG + 
Sbjct: 195 HAVFRMVDILMKAAPIGAFGAFAFTIGKYGIASVVNLATLVGTFYLTSALFVIVVLGTVC 254

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
               FSI +LI +LK E+LLVL TSSSESALP LM+KME+AGC RS+V +VVPTGYSFNL
Sbjct: 255 MLNGFSIFRLISYLKAEILLVLGTSSSESALPSLMEKMEKAGCKRSVVGLVVPTGYSFNL 314

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLA LFI+QATN  L+L  Q+ LLL+AM+SSKGAAGVTG+ FITLAAT+++VP
Sbjct: 315 DGTNIYMTLAALFIAQATNTDLTLQQQILLLLVAMLSSKGAAGVTGAGFITLAATLSVVP 374

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD + F++ +G E
Sbjct: 375 TVPVAGMALILGVDRFMSECRSITNFIGNAVATVVVSRWEGALDREQFDRVLGGE 429


>gi|167579671|ref|ZP_02372545.1| C4-dicarboxylate transporter DctA [Burkholderia thailandensis
           TXDOH]
          Length = 428

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 217/416 (52%), Positives = 308/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH  P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVLLGHLYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +LN + +A  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLNGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++ 
Sbjct: 121 AAKAHGQSTVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGKVVTDFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 ITRVLFGIVHIVTKLAPVGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSI++ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSF
Sbjct: 241 IARFTGFSIVRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    +  +  
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLHAALSG 416


>gi|322830842|ref|YP_004210869.1| sodium:dicarboxylate symporter [Rahnella sp. Y9602]
 gi|321166043|gb|ADW71742.1| sodium:dicarboxylate symporter [Rahnella sp. Y9602]
          Length = 427

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 207/417 (49%), Positives = 301/417 (72%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L++ LY QVL+AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKSLFRSLYFQVLLAITVGVLLGHFYPEIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ NI +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTLALIIGLVIVNIVQPGAGMNVDPAALDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + ++  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAQSQGIIPFLLDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGHKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG+
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLILCFYLTCILFVVVVLGL 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSI K + ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARFTGFSIFKFVNYIKEELLIVLGTSSSESALPRMLDKMERLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++L+++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIWHQITLIVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       +  +
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCDQLDEGQLKATLNGQ 417


>gi|167617749|ref|ZP_02386380.1| C4-dicarboxylate transporter DctA [Burkholderia thailandensis Bt4]
 gi|257140389|ref|ZP_05588651.1| C4-dicarboxylate transporter DctA [Burkholderia thailandensis E264]
 gi|172046088|sp|Q2T1J2|DCTA_BURTA RecName: Full=C4-dicarboxylate transport protein
          Length = 428

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 217/416 (52%), Positives = 308/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH  P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVLLGHLYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +LN + +A  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLNGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++ 
Sbjct: 121 AAKAHGQSTVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 ITRVLFGIVHIVTKLAPVGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSI++ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSF
Sbjct: 241 IARFTGFSIVRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    +  +  
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLHAALSG 416


>gi|83746892|ref|ZP_00943939.1| C4-dicarboxylate transport protein [Ralstonia solanacearum UW551]
 gi|207727769|ref|YP_002256163.1| c4-dicarboxylate transport protein 1 [Ralstonia solanacearum MolK2]
 gi|207742173|ref|YP_002258565.1| c4-dicarboxylate transport protein 1 [Ralstonia solanacearum
           IPO1609]
 gi|83726477|gb|EAP73608.1| C4-dicarboxylate transport protein [Ralstonia solanacearum UW551]
 gi|206591010|emb|CAQ56622.1| c4-dicarboxylate transport protein 1 [Ralstonia solanacearum MolK2]
 gi|206593561|emb|CAQ60488.1| c4-dicarboxylate transport protein 1 [Ralstonia solanacearum
           IPO1609]
          Length = 428

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGHF P++ + M+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIAIGVILGHFEPKLAINMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FALVIGL+ G+I  PG G NVD+ S++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEVVSTFALVIGLVAGHIFNPGSGFNVDVNSIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + + S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +GE++  +   +++
Sbjct: 121 AAKAQSASTVEFLLNIIPSTIVDAFAKGDILQILLIALLFGSALSALGERAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y T+  F++ VLGI
Sbjct: 181 IAKVLFRIVHVITRVAPIGAFGAMAFTIGKYGVVSLVPLLKLIGTFYLTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+ T QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  E
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRTKLARVMAGE 417


>gi|187478709|ref|YP_786733.1| aerobic c4-dicarboxylate transport protein [Bordetella avium 197N]
 gi|123514563|sp|Q2KYU4|DCTA_BORA1 RecName: Full=C4-dicarboxylate transport protein
 gi|115423295|emb|CAJ49828.1| aerobic c4-dicarboxylate transport protein [Bordetella avium 197N]
          Length = 445

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 233/416 (56%), Positives = 323/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   Y+ILY+QVLVAI  G+ LG+F P +G  M+PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 14  KHKFYQILYVQVLVAIVIGVLLGYFKPDLGEAMKPLGDGFIKLVKMIIAPVIFLTVTTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+K +G++  KAM  F VFS  AL+IG++V +I +PG G+++D  SL+ +S+A ++
Sbjct: 74  AAMSDLKKVGRVAGKAMVYFLVFSTLALIIGMVVSHIVQPGAGLHIDPASLDQKSVAGYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H  +  GF+ ++IP T LS    G+ILQ L VA+LFG+SL++VG ++  I      +
Sbjct: 134 TKAHDSTITGFLLNIIPATMLSPFVGGDILQVLFVAVLFGLSLAMVGPRAQPITDFFNAL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           + PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI NL  LV   YATS  F++ VLG++
Sbjct: 194 SAPVFKLVAILMKAAPIGAFGAMAFTIGKYGIKSIVNLAMLVGTFYATSVLFVVVVLGMV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSIIKL+ +++EE+LLVL TSSSE+ALP LM+KME AGC +S+V +VVPTGYSFN
Sbjct: 254 ARYNGFSIIKLVRYIREELLLVLGTSSSEAALPTLMEKMERAGCSKSVVGLVVPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA ++PLSL DQ+ LLL+AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACDIPLSLGDQILLLLVAMLSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           P++P+AGM LILGVDRFMSECR++TN +GNA  ++VV+RWE +LD    +  +  +
Sbjct: 374 PTVPVAGMALILGVDRFMSECRALTNLVGNATASIVVARWEGELDKTALHVALNSD 429


>gi|183598133|ref|ZP_02959626.1| hypothetical protein PROSTU_01499 [Providencia stuartii ATCC 25827]
 gi|188020293|gb|EDU58333.1| hypothetical protein PROSTU_01499 [Providencia stuartii ATCC 25827]
          Length = 449

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 237/414 (57%), Positives = 327/414 (78%), Gaps = 1/414 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +   I+ PLYKILY+QV+VAI  G+ALGHF P IG  ++PLGD F+K  KM+I PVIFLT
Sbjct: 1   MQNIIKQPLYKILYVQVIVAILFGIALGHFFPDIGESLKPLGDAFIKIVKMIIAPVIFLT 60

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V TGIA M +MK +G +  KAM  F  FS  AL+IGLIV NI +PG G+N+D  +L++  
Sbjct: 61  VVTGIAGMSNMKAVGSVAGKAMLYFITFSTIALIIGLIVANIIRPGAGLNIDPATLDSSK 120

Query: 127 IA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           +A +++ +H  S +GF+ ++IPDT +S L +GNILQ L +A++FG++L+  G+  + I K
Sbjct: 121 VAGYVEKAHESSIVGFLMNIIPDTVISPLVNGNILQVLFIAVIFGLALAATGKHGEPIVK 180

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            L+  + PVF+MV+++M++AP+GAFGAM+FTIGKYG+SSI NL+ L+   Y TS  F+L 
Sbjct: 181 LLQNFSEPVFKMVAMLMKLAPIGAFGAMAFTIGKYGISSIGNLMMLIMTFYITSLLFVLI 240

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +A++  FSII+LI ++K+E+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PT
Sbjct: 241 VLGAVAKYNGFSIIQLIKYIKDELWLVLGTSSSEAALPSLMRKMEHAGCEKSVVGLVIPT 300

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+T+A LFI+QATN+ L++ +Q+SLLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 301 GYSFNLDGTNIYMTMAALFIAQATNIDLTIWEQISLLLVAMISSKGAAGVTGAGFITLAA 360

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           T+ +VPS+P+AGM LILG+DRFMSECR++TN +GNA   +VV+RWEK+LD +  
Sbjct: 361 TLMVVPSIPVAGMALILGIDRFMSECRALTNLVGNACACIVVARWEKELDTEKL 414


>gi|255321060|ref|ZP_05362230.1| aerobic C4-dicarboxylate transport protein [Acinetobacter
           radioresistens SK82]
 gi|262379558|ref|ZP_06072714.1| aerobic C4-dicarboxylate transporter [Acinetobacter radioresistens
           SH164]
 gi|255301884|gb|EET81131.1| aerobic C4-dicarboxylate transport protein [Acinetobacter
           radioresistens SK82]
 gi|262299015|gb|EEY86928.1| aerobic C4-dicarboxylate transporter [Acinetobacter radioresistens
           SH164]
          Length = 447

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 205/430 (47%), Positives = 305/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GH+ P               +G Q++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGVLVGHYFPSTTVLMNGVEQQVPGLGEQLKPLGDGFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLLVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S + F+  +IP+T + A  +G ILQ L+ A+LFG +L 
Sbjct: 121 NVDPATLDTAGIQKYVASGESQSTVDFLLHIIPETVVGAFANGEILQVLLFAILFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I+   F +V+++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGKPVLKFIDQISHVFFNIVNMIMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLILC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  VLG +AR   FSI+K+I  ++EE+L+VL TSSSES LP ++KK+E AGC
Sbjct: 241 FYITCLLFIFIVLGTIARISGFSILKMIRLIREELLIVLGTSSSESVLPRMLKKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +T Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDVTHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W  +L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGQL 420

Query: 415 DPKLFNKYIG 424
           D    N+ + 
Sbjct: 421 DKDKLNEALA 430


>gi|172046787|sp|Q4K878|DCTA_PSEF5 RecName: Full=C4-dicarboxylate transport protein
          Length = 443

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 202/415 (48%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY QV+VAI  G+ LGHF PQ GV ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GM++D  +L+   +A +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMHIDASTLDASKVAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + + + +S +GF+ ++IP T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGNDQSIVGFILNIIPATIVGAFANGDILQVLMFSVVFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGA GAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFVLVVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+IKLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVIKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K+LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDKLQSELA 417


>gi|307301501|ref|ZP_07581261.1| sodium:dicarboxylate symporter [Sinorhizobium meliloti BL225C]
 gi|307316769|ref|ZP_07596211.1| sodium:dicarboxylate symporter [Sinorhizobium meliloti AK83]
 gi|152163|gb|AAA26252.1| C4-dicarboxylate carrier A (put.); putative [Sinorhizobium
           meliloti]
 gi|152169|gb|AAA63509.1| membrane-associated dicarboxylate transport protein [Sinorhizobium
           meliloti]
 gi|306897391|gb|EFN28135.1| sodium:dicarboxylate symporter [Sinorhizobium meliloti AK83]
 gi|306903558|gb|EFN34146.1| sodium:dicarboxylate symporter [Sinorhizobium meliloti BL225C]
          Length = 453

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 235/416 (56%), Positives = 328/416 (78%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLY+ LY+QVL AI +G+ LGHF P IG +++PLGD F++  KM+I PVIFLTV+TGI
Sbjct: 24  KTPLYRHLYVQVLAAIAAGILLGHFYPDIGTELKPLGDAFIRLVKMIIAPVIFLTVATGI 83

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+  +G++  KAM  F  FS  ALV+GL+V N+ +PG GM++D  SL+ +++A + 
Sbjct: 84  AGMTDLAKVGRVAGKAMIYFLAFSTLALVVGLVVANVVQPGAGMHIDPASLDAKAVATYA 143

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L+ +
Sbjct: 144 EKAHEQSITGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKKAEPVVDFLQAL 203

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 204 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGIASIANLAMLIGTFYLTSFLFVFIVLGAV 263

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 264 ARYNGFSILSLIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 323

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+ PLS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 324 LDGTNIYMTLAALFIAQATDTPLSYGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 383

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TNF+GNAV T+VV++WE +LD    +  +G E
Sbjct: 384 PSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVAKWEGELDQAQLSAALGGE 439


>gi|258651237|ref|YP_003200393.1| sodium:dicarboxylate symporter [Nakamurella multipartita DSM 44233]
 gi|258554462|gb|ACV77404.1| sodium:dicarboxylate symporter [Nakamurella multipartita DSM 44233]
          Length = 465

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 168/425 (39%), Positives = 275/425 (64%), Gaps = 5/425 (1%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
                R P Y+ L++Q+LVAI +G+ +G + P++G  ++PL D F+K  KMLI P+IF T
Sbjct: 12  TPPKTRKPWYRSLFLQLLVAIVAGILVGWWWPELGASLKPLADGFIKLIKMLIAPIIFFT 71

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V  GIA + D+K +G+I  KA+  F V + FAL+ GL+VGNI +PG G  V+ ++L T +
Sbjct: 72  VVIGIAHVGDLKAVGRIGVKALIYFEVVTTFALLFGLVVGNIVQPGAGFQVNPETLATGA 131

Query: 127 IAHIKSSHAKSF---IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTI 183
            A  K +   S    + F+ ++IP + +SA     +LQ L  A+LFG++++   ++S T+
Sbjct: 132 DAIAKKTGDGSLPHTVEFLLNIIPTSIMSAFAENALLQVLFFAVLFGLAMAKFSQRSKTL 191

Query: 184 RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFI 243
              +++ +   F ++  +M++APLGAFGAM++ IG+YG++S+ +   L+ C Y  +  FI
Sbjct: 192 YSVIDQASHIFFAIIGWIMKLAPLGAFGAMAYIIGQYGIASLGSYGKLIACCYLAAVLFI 251

Query: 244 LGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVV 303
           + + GI+      ++ KLI+++K+E+ L L T+S+E  LP +M K+  AGC R++  +VV
Sbjct: 252 VVLGGIVKVLAGVNLWKLIVYIKDELFLALGTASTEVVLPRIMVKLTNAGCDRAVTGLVV 311

Query: 304 PTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITL 363
           PTGYSFNLDG+ +Y+++  LF+SQA  V LSL +Q++ +L+ M++SKG AGV GS+F+ L
Sbjct: 312 PTGYSFNLDGATLYLSICVLFLSQALGVELSLGEQITAVLVLMLTSKGMAGVPGSSFLDL 371

Query: 364 AATITLV--PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNK 421
           +AT+  +   ++P+A + L+LG DR M   R   N +GN V + VV+ WE +LD +    
Sbjct: 372 SATVAAIGHGAIPVAAVALLLGADRIMDSMRVSVNLLGNCVASFVVANWEGRLDKERMRA 431

Query: 422 YIGIE 426
            +  E
Sbjct: 432 VLAGE 436


>gi|148555792|ref|YP_001263374.1| sodium:dicarboxylate symporter [Sphingomonas wittichii RW1]
 gi|172048259|sp|A5VAC0|DCTA_SPHWW RecName: Full=C4-dicarboxylate transport protein
 gi|148500982|gb|ABQ69236.1| sodium:dicarboxylate symporter [Sphingomonas wittichii RW1]
          Length = 425

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 243/415 (58%), Positives = 319/415 (76%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           IRPP ++ LY QVL+AI  G+ LG   P +G Q++PLGD F+K  KM+I PVIFLTV TG
Sbjct: 11  IRPPFWRSLYAQVLLAIVLGVLLGWLAPDVGAQLKPLGDAFIKLVKMIIAPVIFLTVVTG 70

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA +  +  +G++  KA   F   S  AL++GL V N+ +PG GM++ +  L++  IA +
Sbjct: 71  IAGLSHLGDLGRVALKAFGYFLAVSTLALIVGLFVANVVQPGAGMHIAVADLDSSHIADY 130

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            K++H +S +GF+  +IPDT LSAL  G ILQ L VA+LFGI+LSLVGE++  +   LE 
Sbjct: 131 AKAAHDQSLVGFLMAIIPDTLLSALAQGEILQVLFVAILFGIALSLVGERAQPVTDLLER 190

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +   VFR+V I+M+ AP+GAFGAM+FTIGK+GL S++NL  LV C Y TS  F+L VLGI
Sbjct: 191 LVAVVFRLVGILMKAAPIGAFGAMAFTIGKFGLGSLANLGGLVLCFYLTSIGFVLVVLGI 250

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI++LI +LK+E+LLVL TSSSESALP LM KME+AGC + IV +VVPTGYSF
Sbjct: 251 IARIAGFSILRLIAYLKDELLLVLGTSSSESALPNLMAKMEQAGCAKPIVGLVVPTGYSF 310

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLA LFI+QA +V LSL +Q+SLLL+AM+SSKGAAGVTG+ F+TLAAT+++
Sbjct: 311 NLDGTNIYMTLAALFIAQACDVDLSLGEQISLLLVAMLSSKGAAGVTGAGFVTLAATLSI 370

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           VPS+P+AGM LILG+DRFMSECRS+TNF+GNAV TVVV+RWE +LD +     +G
Sbjct: 371 VPSVPVAGMALILGIDRFMSECRSLTNFVGNAVATVVVARWEGQLDREKLKAALG 425


>gi|116253166|ref|YP_769004.1| C4-dicarboxylate transporter DctA [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|167012306|sp|Q1MDR5|DCTA_RHIL3 RecName: Full=C4-dicarboxylate transport protein
 gi|115257814|emb|CAK08912.1| putative C4-dicarboxylate transport protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 444

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 236/416 (56%), Positives = 320/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y  LY+QVL AI +G+ LGHF P+ G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  KKPFYTHLYVQVLAAIAAGILLGHFYPEFGTQLKPLGDAFIKLVKMIIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M D++ +G++  KAM  F  FS  AL+IGLIV N+ +PG GMN+D  SL+  ++A   
Sbjct: 75  AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLIVANVVQPGAGMNIDPASLDPAAVAGYA 134

Query: 132 SS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           +  H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEKS+ +   L  +
Sbjct: 135 AKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKSEPVVNFLNAL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +
Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLIGTFYITSLLFVLVVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGIQLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD       +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTAQLAAALGGQ 430


>gi|171061007|ref|YP_001793356.1| C4-dicarboxylate transporter DctA [Leptothrix cholodnii SP-6]
 gi|226723841|sp|B1Y0B2|DCTA_LEPCP RecName: Full=C4-dicarboxylate transport protein
 gi|170778452|gb|ACB36591.1| sodium:dicarboxylate symporter [Leptothrix cholodnii SP-6]
          Length = 447

 Score =  289 bits (740), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 201/414 (48%), Positives = 286/414 (69%), Gaps = 1/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+ AI  G+ LGH+ P+ G  M+PLGD F+K  KM+I P+IF TV  GIA 
Sbjct: 9   PFYRSLYFQVITAIVIGVLLGHYWPETGTAMKPLGDGFIKLIKMIIAPIIFCTVVVGIAG 68

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-S 132
           M+DMK +G+    A+  F V S  AL++GL++ N+ +PG+GM+VD  +L+T+ IA     
Sbjct: 69  MEDMKRVGKTGGLALLYFEVVSTLALLLGLLIVNLVQPGVGMHVDPATLDTKGIAAYTAP 128

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
              ++   F+  +IP T + A   G +LQ L+ +++FG +L   G +   +   +E+ + 
Sbjct: 129 GKMQTTTEFLLAVIPTTVVDAFAKGEMLQVLLFSVMFGFALHQFGGRGTLVFDFIEKTSH 188

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +F +V  +M++AP+GAFGAM+FTIGKYGL S+  L  L+   YAT   FI GVLG++A+
Sbjct: 189 VLFAIVGFIMKVAPIGAFGAMAFTIGKYGLGSLIPLAKLMGTFYATCLVFIFGVLGLIAK 248

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FSI K I ++KEE+L+VL TSSSES LP +M K+E  G  +S V +VVPTGYSFNLD
Sbjct: 249 AHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENLGVRKSTVGLVVPTGYSFNLD 308

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+T+A +FI+QAT+ P++LT QL+LL + +++SKGAAGVTGS FI LAAT++ V  
Sbjct: 309 GTSIYLTMAAVFIAQATDTPMTLTQQLTLLAVLLLTSKGAAGVTGSGFIVLAATLSAVGG 368

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+AG+ LILG+DRFMSE R++TN IGN V TVVV +W   LD K    ++  E
Sbjct: 369 VPVAGLALILGIDRFMSEARALTNLIGNGVATVVVGKWTGDLDEKQMRYHLDRE 422


>gi|50085335|ref|YP_046845.1| C4-dicarboxylate transporter DctA [Acinetobacter sp. ADP1]
 gi|81392824|sp|Q6FA90|DCTA_ACIAD RecName: Full=C4-dicarboxylate transport protein
 gi|49531311|emb|CAG69023.1| aerobic C4-dicarboxylate transport protein [Acinetobacter sp. ADP1]
          Length = 448

 Score =  289 bits (740), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 206/430 (47%), Positives = 303/430 (70%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV+VAI +G+ +GHF P               +G Q++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIVAIIAGILVGHFYPSTTHVVDGVKEHIPGLGEQLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F V S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEVVSTIALLIGLLVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  SL+T  IA ++ S  ++S I F+  +IP+T + A  +G ILQ L+ A++FG +L 
Sbjct: 121 NVDPASLDTSGIAKYVASGQSQSTIEFLMHIIPETVVGAFANGEILQVLLFAIMFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I+   F +V+++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 181 KLGDAGRPVLKFIDQISHVFFNIVNMIMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  VLG ++R C FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 241 FYVTCLLFIFIVLGTISRICGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDVQHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN  GN + T+ V++W   L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLTGNTLATIAVAKWVGAL 420

Query: 415 DPKLFNKYIG 424
           D +  ++ + 
Sbjct: 421 DKEKLDEALN 430


>gi|237798954|ref|ZP_04587415.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021808|gb|EGI01865.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 450

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 203/415 (48%), Positives = 296/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEVVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVFVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|308172314|ref|YP_003919019.1| C4-dicarboxylate transport protein [Bacillus amyloliquefaciens DSM
           7]
 gi|307605178|emb|CBI41549.1| C4-dicarboxylate transport protein [Bacillus amyloliquefaciens DSM
           7]
          Length = 436

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 174/414 (42%), Positives = 271/414 (65%)

Query: 3   ESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
              +  G +   ++K L +QV+ A+  G+ +G   P+ G QM+PLGD F+   KM+I P+
Sbjct: 9   RRSERQGGVGMKIFKNLTVQVITAVIIGVIVGLVWPEAGKQMKPLGDTFINAVKMIIAPI 68

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IFLT+  GIA+M DMK +G++  KA   F V +  AL+IGL+V NI KPG G++      
Sbjct: 69  IFLTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTIALIIGLLVVNIMKPGEGLDYSKLEK 128

Query: 123 NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
              S           +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GE+  +
Sbjct: 129 GDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSVLFGVGLAALGERGKS 188

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           I    ++++   F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F
Sbjct: 189 IIDFFDKLSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMLSVYITMFLF 248

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +   L I+ R   FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V
Sbjct: 249 VFVALNIICRIFGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLV 308

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +PTGYSFNLDG++IY+++AT+F++Q   V L++  Q++++L+ M++SKGAAGVTGS FI 
Sbjct: 309 IPTGYSFNLDGTSIYLSMATVFLAQVFGVDLTIGQQITIILVLMLTSKGAAGVTGSGFIV 368

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDP 416
           LA+T++ +  +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D 
Sbjct: 369 LASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDE 422


>gi|167561376|ref|ZP_02354292.1| C4-dicarboxylate transporter DctA [Burkholderia oklahomensis EO147]
          Length = 428

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 217/416 (52%), Positives = 309/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +L+ + +A  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLSGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +G++   +   ++ 
Sbjct: 121 AAKAHGQSTVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGDRGKVVTDFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 ITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSIVFVLVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSF
Sbjct: 241 IARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD K     +  
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRKKLRAALTG 416


>gi|317483717|ref|ZP_07942664.1| Sodium:dicarboxylate symporter family protein [Bilophila
           wadsworthia 3_1_6]
 gi|316925033|gb|EFV46172.1| Sodium:dicarboxylate symporter family protein [Bilophila
           wadsworthia 3_1_6]
          Length = 442

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 203/414 (49%), Positives = 296/414 (71%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLYK LY QV+ AI  G+ALGHF PQ    M+PLGD F+K  KM+I P+IF TV  G+
Sbjct: 5   KKPLYKSLYFQVICAILLGIALGHFYPQTAQAMKPLGDGFIKLIKMIIAPIIFCTVVLGV 64

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+DMK +G+I  KA+  F   +  AL+IGL+V N  +PG GM+VD  SL+T +IA   
Sbjct: 65  AGMEDMKKLGRIGGKALIYFEAVTTLALIIGLVVVNTLQPGGGMHVDPASLDTTAIAKYT 124

Query: 132 SS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           +S     FI F+ ++IP T + A  +G+ILQ L+++LL G + S +G++   I   + + 
Sbjct: 125 ASAQHNGFIDFLMNIIPGTIVGAFANGDILQVLLISLLCGAAFSALGKRVAGIVGLIRQA 184

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +++I+M++APLGAFGAM+FT+GKYGL ++ +L +L+   Y T   F+  VL I+
Sbjct: 185 SSALFGIINIIMKLAPLGAFGAMAFTVGKYGLGTLGSLGYLMGSFYLTCLLFVFVVLNII 244

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FS++KL+ ++  E+ LVL TSSSESALP LM K+E  G  + IV +VVP+GYSFN
Sbjct: 245 ARLTGFSLVKLLRYIAHELWLVLGTSSSESALPTLMAKLEHMGARKDIVGIVVPSGYSFN 304

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QA  + LSL ++L+LL + +++SKGAAGVTGS F+TLAAT+  +
Sbjct: 305 LDGTSIYLTMAAIFIAQALGIELSLKEELTLLAVLLLASKGAAGVTGSGFVTLAATLATI 364

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P++P+AG+ LILGVDRFMSE R++TN +GN+V T+VV++WE  LD +  +  + 
Sbjct: 365 PTIPVAGIALILGVDRFMSEARALTNLVGNSVATIVVAKWEGALDMQRLHAELD 418


>gi|330960608|gb|EGH60868.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 450

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 200/415 (48%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T   FI+ +LG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYVTCVLFIVFILGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + ++ Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDISHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|307293939|ref|ZP_07573783.1| sodium:dicarboxylate symporter [Sphingobium chlorophenolicum L-1]
 gi|306880090|gb|EFN11307.1| sodium:dicarboxylate symporter [Sphingobium chlorophenolicum L-1]
          Length = 459

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 241/420 (57%), Positives = 321/420 (76%), Gaps = 2/420 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
               R P Y+ LY+QVL+AI +G+A+GHF P+ GV +QPLG+ F+K  KM+I PVIFLT+
Sbjct: 25  QPITRLPFYRQLYVQVLIAIAAGVAIGHFFPETGVALQPLGEAFIKLVKMIIAPVIFLTI 84

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
            TG+A MK++  IG++  KA   F  FS  AL++GLIV N+  PG G+N+D  +L+   +
Sbjct: 85  VTGVAGMKELGAIGRVAAKAFAYFLTFSTLALIVGLIVANVVHPGAGLNIDPATLDVGKV 144

Query: 128 AHIKS-SHAKSFIGFMQDMIPDTALSALTSG-NILQTLIVALLFGISLSLVGEKSDTIRK 185
           A  +  +H ++  GF+ D+IP T +SA+  G NILQ L VA+LFGI+L+++GE++D +  
Sbjct: 145 AQYQQQAHDRTLTGFLLDIIPGTLVSAVADGHNILQVLFVAILFGIALTMIGERADPLMT 204

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            LE  +  +F++VS +M+ APLGAFGAM+FTIGKYG+ +++NL  LV   Y TS  F+L 
Sbjct: 205 VLESASHAIFKLVSFLMKAAPLGAFGAMAFTIGKYGVGALANLAGLVATFYLTSLLFVLV 264

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +AR   F+I+ LI +LK E+LLVL TSSSE+ALP L++KME AGC +S+V +VVPT
Sbjct: 265 VLGTVARLAGFNILHLIRYLKAELLLVLGTSSSEAALPSLIEKMERAGCRKSVVGLVVPT 324

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+TLA LFI+QATNV LSL +Q+ LLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 325 GYSFNLDGTNIYMTLAALFIAQATNVHLSLEEQILLLLVAMLSSKGAAGVTGAGFITLAA 384

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           T+++VPS+P+AGMTLILGVDRFMSECRS+TNFIGNAV TVVVS WEK LD + F   +  
Sbjct: 385 TLSIVPSVPVAGMTLILGVDRFMSECRSLTNFIGNAVATVVVSAWEKGLDRERFAAAMSG 444


>gi|53718064|ref|YP_107050.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei
           K96243]
 gi|126439554|ref|YP_001057509.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 668]
 gi|126452996|ref|YP_001064759.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 1106a]
 gi|134279703|ref|ZP_01766415.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei 305]
 gi|167717884|ref|ZP_02401120.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei DM98]
 gi|167736901|ref|ZP_02409675.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 14]
 gi|167814006|ref|ZP_02445686.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 91]
 gi|167822529|ref|ZP_02454000.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 9]
 gi|167844111|ref|ZP_02469619.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei B7210]
 gi|167892613|ref|ZP_02480015.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 7894]
 gi|167901108|ref|ZP_02488313.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei NCTC
           13177]
 gi|167909329|ref|ZP_02496420.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei 112]
 gi|167917360|ref|ZP_02504451.1| C4-dicarboxylate transporter DctA [Burkholderia pseudomallei
           BCC215]
 gi|217419519|ref|ZP_03451025.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei 576]
 gi|226193692|ref|ZP_03789295.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           Pakistan 9]
 gi|237810661|ref|YP_002895112.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei
           MSHR346]
 gi|242315534|ref|ZP_04814550.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           1106b]
 gi|254259944|ref|ZP_04950998.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           1710a]
 gi|81608126|sp|Q63XW5|DCTA_BURPS RecName: Full=C4-dicarboxylate transport protein
 gi|167012055|sp|A3NQY8|DCTA_BURP0 RecName: Full=C4-dicarboxylate transport protein
 gi|167012056|sp|A3N588|DCTA_BURP6 RecName: Full=C4-dicarboxylate transport protein
 gi|172046641|sp|Q3JWJ9|DCTA_BURP1 RecName: Full=C4-dicarboxylate transport protein
 gi|52208478|emb|CAH34413.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei
           K96243]
 gi|126219047|gb|ABN82553.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           668]
 gi|126226638|gb|ABN90178.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei
           1106a]
 gi|134248903|gb|EBA48985.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei 305]
 gi|217396823|gb|EEC36839.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei 576]
 gi|225934270|gb|EEH30254.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           Pakistan 9]
 gi|237503398|gb|ACQ95716.1| C4-dicarboxylate transport protein [Burkholderia pseudomallei
           MSHR346]
 gi|242138773|gb|EES25175.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           1106b]
 gi|254218633|gb|EET08017.1| C4-dicarboxylate transport protein DctA [Burkholderia pseudomallei
           1710a]
          Length = 428

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 217/416 (52%), Positives = 307/416 (73%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S  ALV+GL   +I +PG+G N+D  +LN + +A  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTCALVLGLAATHILRPGVGFNIDPATLNGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++ 
Sbjct: 121 AAKAHGQSSVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 ITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSF
Sbjct: 241 IARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLRAALSG 416


>gi|261377715|ref|ZP_05982288.1| aerobic C4-dicarboxylate transport protein [Neisseria cinerea ATCC
           14685]
 gi|269145991|gb|EEZ72409.1| aerobic C4-dicarboxylate transport protein [Neisseria cinerea ATCC
           14685]
          Length = 439

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 238/415 (57%), Positives = 316/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           RP  Y  LY QV+VAI  G+ LG+F P  G  ++PLG+ F+K  KM+I PVIFLTV TGI
Sbjct: 15  RPKFYHSLYFQVIVAIIIGIILGNFFPHFGASLKPLGEAFIKLVKMIIAPVIFLTVVTGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M DMK +G++  KAM  F  FS  ALVIGLIV NI +PG G+N+D  +L++E ++ ++
Sbjct: 75  AGMNDMKSVGRVAGKAMLYFLTFSTLALVIGLIVANIVQPGAGLNIDPATLHSEKVSEYV 134

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H  + +GF+ ++IP T +S LT GNILQ L V++LFGISL+ VGEK+  I   L   
Sbjct: 135 EKAHDSTLVGFLMNIIPTTVVSPLTEGNILQVLFVSVLFGISLASVGEKARPITDLLLAA 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++VSI+M+ APLGA GAM+FT+GKYGL SISNLI LV   Y TS  F++ VLG +
Sbjct: 195 TTPMFKVVSILMKAAPLGALGAMAFTVGKYGLHSISNLILLVATFYLTSLLFVVFVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+K+I ++KEE+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PTGYSFN
Sbjct: 255 ARYNGFSILKMIRYIKEEMWLVLGTSSSEAALPTLMQKMEAAGCKKSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QATN  L++T Q++LLL+AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTMAALFIAQATNTDLTITQQITLLLVAMLSSKGAAGVTGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PSLP+ GM LILG+DRFMSECR++TN +GNA   +VV+RWEK LD    +  +  
Sbjct: 375 PSLPVEGMALILGIDRFMSECRALTNLVGNACAAIVVARWEKSLDKDKLDDAMNG 429


>gi|254523562|ref|ZP_05135617.1| C4-dicarboxylate transport protein [Stenotrophomonas sp. SKA14]
 gi|219721153|gb|EED39678.1| C4-dicarboxylate transport protein [Stenotrophomonas sp. SKA14]
          Length = 447

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 235/413 (56%), Positives = 311/413 (75%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P+Y+ LY QV+VAI  G  LGH+ P IG +M+PLGD F+   KM+I PVIFLT+ TGIA 
Sbjct: 15  PIYRQLYFQVIVAIVLGAILGHYEPLIGEKMKPLGDAFINLVKMIIAPVIFLTIVTGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  ++ +G++F KAM  F  FS  AL++G+IV ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLRTVGRVFAKAMAYFLFFSTLALIVGMIVAHVVQPGAGMNINPAELDQTAVHSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  + +GF+ D+IP T LSA   GNILQ L VA+LFGI+L++VGEK   +   LE +  
Sbjct: 135 SHDLTLVGFLMDIIPKTLLSAFVDGNILQVLFVAVLFGIALAMVGEKGKPVLNFLEALVA 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V I+M+ AP+GAFGA++FTIGKYG+ S+ NL +LV   Y T+  F+  +LG++ R
Sbjct: 195 PVFKLVHILMKAAPIGAFGAIAFTIGKYGVGSLINLAWLVGSFYLTAFLFVAVILGLVCR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
            C FS+ KL  +LK E+LLVL TSSSESALP LM+KME AGC +S+V +VVPTGYSFNLD
Sbjct: 255 LCGFSVFKLARYLKAELLLVLGTSSSESALPSLMEKMERAGCSKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP 
Sbjct: 315 GTNIYMTLAALFIAQATNTELTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPE 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       +  
Sbjct: 375 VPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWEGALDRNRLQLALDG 427


>gi|218531232|ref|YP_002422048.1| sodium:dicarboxylate symporter [Methylobacterium chloromethanicum
           CM4]
 gi|240139813|ref|YP_002964290.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Methylobacterium extorquens AM1]
 gi|254562228|ref|YP_003069323.1| citrate and C4-dicarboxylic acids transport protein
           [Methylobacterium extorquens DM4]
 gi|218523535|gb|ACK84120.1| sodium:dicarboxylate symporter [Methylobacterium chloromethanicum
           CM4]
 gi|240009787|gb|ACS41013.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Methylobacterium extorquens AM1]
 gi|254269506|emb|CAX25472.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Methylobacterium extorquens DM4]
          Length = 447

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 222/412 (53%), Positives = 315/412 (76%), Gaps = 1/412 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           LY+ LY QVLVA+  G+ALGHF P++G  M+PLGD F+K  KM+I PVIFLTV +GIA M
Sbjct: 20  LYRTLYFQVLVAVAIGIALGHFYPKLGADMKPLGDAFIKLVKMIIAPVIFLTVVSGIAGM 79

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-SS 133
            +++ +G++  KA+  F  FS  AL++GL+V N+ +PG G+++D  SL+ +++A     +
Sbjct: 80  TNLEKVGRVGGKALIYFITFSTLALIVGLVVANVLQPGHGLHIDPNSLDPKAVATYAGKA 139

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             ++   F+ ++IP TA+ A   G ILQ L  ++LFG  L+ +GE+   +   ++ ++  
Sbjct: 140 KEQNIADFLMNIIPTTAVGAFAGGEILQVLFFSVLFGFGLAFLGERGKPVLDIIKVMSEA 199

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F +V+I+M++AP+GAFGAM+FTIGKYG+SS++NL +LV   Y TSA F+LGVLG +AR+
Sbjct: 200 IFGVVNIIMKVAPIGAFGAMAFTIGKYGISSLANLAYLVGAFYLTSAIFVLGVLGAVARY 259

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
             FSI+KLI ++KEE++LVL TSSSESALP L+ KME+AGC R +V +VVPTGYSFNLDG
Sbjct: 260 NGFSILKLIRYIKEELMLVLGTSSSESALPSLIDKMEKAGCSRPVVGLVVPTGYSFNLDG 319

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           +NIY+T+A LFI+QAT+ P++  +Q+ LLL+AM+SSKGAAGVTGS FITLAAT+ +VPS+
Sbjct: 320 TNIYMTMAALFIAQATDTPITYGEQILLLLVAMLSSKGAAGVTGSGFITLAATLAVVPSV 379

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P+ GM LILG+DRFMSECR++TNFIGNAV  +VV+RWE ++D    +  +G 
Sbjct: 380 PVVGMALILGIDRFMSECRALTNFIGNAVACIVVARWEGEVDEAKLHAALGG 431


>gi|220920180|ref|YP_002495481.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
 gi|219944786|gb|ACL55178.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
          Length = 449

 Score =  288 bits (738), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 226/412 (54%), Positives = 310/412 (75%), Gaps = 1/412 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           LYK LY QVLVA+  G+ LGHF PQ+G +M+PLGD F+K  KM+I PVIFLTV +GIA M
Sbjct: 21  LYKTLYFQVLVAVAIGILLGHFYPQLGAEMKPLGDAFIKLVKMIIAPVIFLTVVSGIAGM 80

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-SS 133
            +++ +G++  KA+  F  FS  AL++GL+V N+ +PG G+++D KSL+ +++A     +
Sbjct: 81  TNLEKVGRVGAKALIYFITFSTLALIVGLVVANVLQPGHGLHIDPKSLDPKAVATYAGKA 140

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             +S + F+  +IP TA+ A   G ILQ L  ++LFG  L+ +G++   +   ++     
Sbjct: 141 KEQSIVEFLMHIIPSTAVGAFAGGEILQVLFFSVLFGFGLAFMGDRGKPVLDLIKVTAEA 200

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F +V I+M++AP+GAFGAM+FTIGKYG+SS++NL +LVF  Y TSA F+L VLG +AR+
Sbjct: 201 IFGVVHIIMKVAPIGAFGAMAFTIGKYGVSSLANLAYLVFAFYLTSAIFVLVVLGPVARY 260

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
             FS+IKL+ ++KEE+LLVL TSSSESALP L+ KME AGC R +V +VVPTGYSFNLDG
Sbjct: 261 NGFSVIKLVRYIKEELLLVLGTSSSESALPTLIDKMERAGCSRPVVGLVVPTGYSFNLDG 320

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           +NIY+T+A LFI+QAT+ PLSL +Q  LLL+AM+SSKGAAGVTGS FITLAAT+ +VPS+
Sbjct: 321 TNIYMTMAALFIAQATDTPLSLGEQALLLLVAMLSSKGAAGVTGSGFITLAATLAVVPSV 380

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P+ GM LILG+DRFMSECR++TNFIGNAV  +VV+RWE ++D       +  
Sbjct: 381 PVVGMALILGIDRFMSECRALTNFIGNAVACIVVARWEGEVDEARLAAALNG 432


>gi|299133756|ref|ZP_07026950.1| sodium:dicarboxylate symporter [Afipia sp. 1NLS2]
 gi|298591592|gb|EFI51793.1| sodium:dicarboxylate symporter [Afipia sp. 1NLS2]
          Length = 443

 Score =  288 bits (738), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 238/416 (57%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY QVL AI +G+ LGHF P +G  M+PLGD F+K  KM+ITPVIFLTV+TGI
Sbjct: 13  KVPFYRHLYFQVLAAIVAGVLLGHFDPGVGAAMKPLGDAFIKLVKMVITPVIFLTVATGI 72

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A + D+K +G++  KAM  F  FS  AL++GLI+ N+ +PG GM++D  +L+ ++ A   
Sbjct: 73  AGVSDLKRVGRVAGKAMLYFLTFSTLALILGLIISNVVQPGAGMHIDPATLDAKAAAAYA 132

Query: 132 SSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           +     S +GF+ D+IP+T + A   G+ILQ L  ++LFGI+L++ GE+   I   L+ +
Sbjct: 133 AKAHDASIVGFLMDIIPNTIVGAFAKGDILQVLFFSVLFGIALAMAGERGKPIVDFLQAL 192

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVFR+V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL FL+   Y TS  F+L VLG +
Sbjct: 193 TNPVFRLVAILMKAAPIGAFGAMAFTIGKYGIGSIANLAFLIGTFYVTSLLFVLVVLGAV 252

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R+  FSI+ LI ++KEE+LLVL TSSSE+ALP LM KME AGC RS+V +V+PTGYSFN
Sbjct: 253 GRYNGFSILALIRYIKEELLLVLGTSSSEAALPALMTKMERAGCDRSVVGLVIPTGYSFN 312

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+  LSL DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 313 LDGTNIYMTLAALFIAQATDTHLSLADQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 372

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+PIAGM LILG+DRFMSECR++TNF+GNAV TVVV+RWEK+LD + F   +  E
Sbjct: 373 PSVPIAGMALILGIDRFMSECRALTNFVGNAVATVVVARWEKELDQEKFAAALAGE 428


>gi|300705314|ref|YP_003746917.1| citrate and c4-dicarboxylic acids transport protein (daacs family)
           [Ralstonia solanacearum CFBP2957]
 gi|299072978|emb|CBJ44335.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Ralstonia solanacearum CFBP2957]
          Length = 428

 Score =  288 bits (738), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YKILY+QVL AI  G+ LGHF P++ + M+PLGD F++  KM+I P+IF TV +G
Sbjct: 1   MKKPFYKILYVQVLAAIAIGVILGHFEPKLAINMKPLGDGFIQLIKMVIGPIIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FALVIGL+ G+I  PG G NVD+ S++ +++A  
Sbjct: 61  IAGMRDMKKVGRVGGKALLYFEVVSTFALVIGLMAGHIFNPGSGFNVDVNSIDAKAVAQY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + + S + F+ ++IP T + A   G+ILQ L++ALLFG +LS +GE++  +   +++
Sbjct: 121 AAKAQSASTVEFLLNIIPSTIVDAFAKGDILQILLIALLFGSALSALGERAQMVTDFIDQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +FR+V ++ R+AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y T+  F++ VLGI
Sbjct: 181 IAKVLFRIVHVITRVAPVGAFGAMAFTIGKYGVVSLVPLLKLIGTFYLTAIIFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI + + ++KEE+L+VL TSSSESALP LM+KME+ GC +S+V +VVPTGYSF
Sbjct: 241 IARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FISQA N+ L+ T QL++L +AM++SKGA+G+TG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTSKGASGITGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AGM LILG+DRFMSECR++TN  GN V  VV+S WE++LD     + +  E
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRTKLARVMAGE 417


>gi|104780536|ref|YP_607034.1| C4-dicarboxylate transporter DctA [Pseudomonas entomophila L48]
 gi|167012304|sp|Q1IDN5|DCTA_PSEE4 RecName: Full=C4-dicarboxylate transport protein
 gi|95109523|emb|CAK14224.1| C4-dicarboxylate transport protein [Pseudomonas entomophila L48]
          Length = 440

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 206/414 (49%), Positives = 302/414 (72%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLYK LY+QVLVAI  G+ LGH+ P+ GV ++PLGD FVK  KM+I P+IF TV +GI
Sbjct: 4   RQPLYKSLYVQVLVAITIGILLGHYYPETGVALKPLGDGFVKLIKMVIAPIIFCTVVSGI 63

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+ MK +G+    A+  F + S  AL+IGL+V N+ +PG GM+VD+ +LN  S+A   
Sbjct: 64  AGMQSMKSVGKTGGYALLYFEIVSTIALIIGLVVVNVVQPGAGMHVDVSTLNASSVAAYA 123

Query: 132 SSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ ++LFG +L  +G     +   ++  
Sbjct: 124 AAGAQQTTVGFLLNVIPNTVVGAFANGDILQVLMFSVLFGFALHRLGSYGKPVLDLIDRF 183

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              +F +++++M++AP+GAFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG +
Sbjct: 184 AHVMFNIINMIMKLAPIGAFGAMAFTIGQYGVGSLVQLGYLMACFYITCILFVLVVLGGI 243

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R   FS+IKLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSFN
Sbjct: 244 CRAHGFSVIKLIRYIREELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSFN 303

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ V
Sbjct: 304 LDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSAV 363

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             LP+AG+ LILG+DRFMSE R++TN IGNAV TVVV++W K+LD       + 
Sbjct: 364 GHLPVAGLALILGIDRFMSEARALTNLIGNAVATVVVAKWVKELDTDQLQAELA 417


>gi|231980|sp|Q01857|DCTA_RHILE RecName: Full=C4-dicarboxylate transport protein
 gi|46178|emb|CAA77618.1| C4-dicarboxylate permease [Rhizobium leguminosarum]
          Length = 444

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 235/416 (56%), Positives = 320/416 (76%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y  LY+QVLVAI +G+ LGHF P++G Q++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  KKPFYSHLYVQVLVAIAAGILLGHFYPELGTQLKPLGDAFIKLVKMIIAPVIFLTVATGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M D++ +G++  KAM  F  FS  AL+IGLIV N+ +PG GMN+D  SL+  ++A   
Sbjct: 75  AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLIVANVVQPGAGMNIDPASLDPAAVATFA 134

Query: 132 SS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           +  H +S +GF+ ++IP T + A   G+ILQ L  ++LFGI+L++VGEK + +   L  +
Sbjct: 135 AKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKGEQVVNFLNSL 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+  VLG +
Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLIGTFYITSLLFVFIVLGAV 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ L+ ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 255 ARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT + LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQATGIHLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD       +G +
Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTVQLAAALGGQ 430


>gi|167568605|ref|ZP_02361479.1| C4-dicarboxylate transporter DctA [Burkholderia oklahomensis C6786]
          Length = 428

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 218/416 (52%), Positives = 309/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +L+ + IA  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLSGKEIASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +G++   +   ++ 
Sbjct: 121 AAKAHGQSTVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGDRGKVVTDFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 ITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSIVFVLVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSF
Sbjct: 241 IARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD K     +  
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRKKLRAALTG 416


>gi|66046936|ref|YP_236777.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           syringae B728a]
 gi|75501095|sp|Q4ZQ33|DCTA_PSEU2 RecName: Full=C4-dicarboxylate transport protein
 gi|63257643|gb|AAY38739.1| Sodium:dicarboxylate symporter [Pseudomonas syringae pv. syringae
           B728a]
 gi|330974378|gb|EGH74444.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 450

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 203/415 (48%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+SS+  L  L+ C Y T A F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFVVFVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|289677050|ref|ZP_06497940.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           syringae FF5]
 gi|330980169|gb|EGH78351.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 450

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 203/414 (49%), Positives = 296/414 (71%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEVVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVFVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       +
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSEL 416


>gi|332185246|ref|ZP_08386995.1| sodium:dicarboxylate symporter family protein [Sphingomonas sp.
           S17]
 gi|332014970|gb|EGI57026.1| sodium:dicarboxylate symporter family protein [Sphingomonas sp.
           S17]
          Length = 440

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 244/414 (58%), Positives = 313/414 (75%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R  ++  LY+QVLVAI  G  +GHF P  G  ++P+GD F+K  KM+I PVIFLTV TGI
Sbjct: 14  RARVWSHLYVQVLVAIALGAIIGHFWPSFGESLKPIGDAFIKLVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M+++  +G++  KA F F   S FALV+GLIV N+ +PG GMN+D  SLN  SIA   
Sbjct: 74  AGMRELGSVGRVAGKAFFYFITVSSFALVVGLIVANVVQPGAGMNIDPASLNAGSIAEYT 133

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H  +  GF+  +IPDT +SA T GNILQ L+VA+LFGIS++LVGE +  +   LE I
Sbjct: 134 AKAHDTTVTGFLLGIIPDTLVSAFTQGNILQVLMVAILFGISMALVGEPARPLLNSLERI 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  VFRMV I+MR AP+GAFGA++FTIGKYG+ S+ NL  LV   Y TS  F++ VLG +
Sbjct: 194 SIVVFRMVGILMRAAPIGAFGAIAFTIGKYGVGSLVNLGALVATFYFTSILFVVVVLGTI 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FS++KLI +LK E+LLVL TSSSE+ALP L++KME+AGC +S+V +VVPTGYSFN
Sbjct: 254 ARANGFSVLKLIRYLKAELLLVLGTSSSEAALPSLLQKMEKAGCEKSVVGLVVPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QA  V LSL  QL+LLL+AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTLAALFIAQACGVDLSLGQQLALLLVAMLSSKGAAGVTGAGFITLAATLSIV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P +P+AGM LILG+DRFMSECRS+TNFIGNAV TVVV+RWE  LD    +  + 
Sbjct: 374 PDVPVAGMALILGIDRFMSECRSLTNFIGNAVATVVVARWEGALDKDALDAALN 427


>gi|288960300|ref|YP_003450640.1| hypothetical protein AZL_a05650 [Azospirillum sp. B510]
 gi|288912608|dbj|BAI74096.1| hypothetical protein AZL_a05650 [Azospirillum sp. B510]
          Length = 426

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 195/409 (47%), Positives = 289/409 (70%), Gaps = 1/409 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P Y  L  QVL AI  G+ LGHF P + V+M+PLGD+F+K  KM+I P++FLTV TG
Sbjct: 1   MRKPFYTNLTFQVLTAISLGILLGHFYPSLAVEMKPLGDLFIKMVKMVIGPIVFLTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           I+ + ++K +G++  KA+  F V + FAL IGL+V N+ +PG GMN+    L  +++  +
Sbjct: 61  ISSIGNLKKVGKVGGKALLYFEVVTTFALGIGLLVVNLVRPGAGMNIHPGQLKADAVQKY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
             ++H   FI F+  ++PD  + A   G++LQ L  A++FG++LS +G+K   +    ++
Sbjct: 121 ATTAHEHGFIDFVVGIVPDNVVGAFVQGDMLQILFFAVVFGVALSAMGQKGKVVEDIFDK 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F ++ I+MR+AP+GAFGAMSFTIGKYG+SS++ L  L+  +Y T A FI  VLG 
Sbjct: 181 IGHALFGVIGILMRVAPVGAFGAMSFTIGKYGVSSLTALGQLMASVYLTMAIFIFVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI   + ++++E+L+VL TSSSES LP +M+KM++ GC + +V +V+PTGYSF
Sbjct: 241 IARIHGFSIWNFVRYIRQELLIVLGTSSSESVLPRMMEKMQKFGCSKHVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+++A +FI+QA NV L++  QL +L+I M++SKGAA VTG  F+TLAAT++ 
Sbjct: 301 NLDGTSIYLSMAAIFIAQAFNVDLTIWQQLYILIILMLTSKGAAAVTGGGFVTLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
              LPI G+ L+LGVDRFMSE R++TN IGN V TVVV++ E + D   
Sbjct: 361 TGVLPIEGLALLLGVDRFMSEARALTNLIGNGVATVVVAKMEGEFDETK 409


>gi|261343531|ref|ZP_05971176.1| aerobic C4-dicarboxylate transport protein [Providencia rustigianii
           DSM 4541]
 gi|282568680|gb|EFB74215.1| aerobic C4-dicarboxylate transport protein [Providencia rustigianii
           DSM 4541]
          Length = 448

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 234/414 (56%), Positives = 325/414 (78%), Gaps = 1/414 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +   I+ PLYKILY+QV+VAI  G+ALGHF P IG  ++PLGD F+K  KM+I PVIFLT
Sbjct: 1   MRNIIKEPLYKILYVQVIVAITLGIALGHFFPDIGESLKPLGDAFIKIVKMIIAPVIFLT 60

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V TGIA M +M+ +G +  KAM  F  FS  AL+IGLIVGN+ +PG G+N+D  +L+   
Sbjct: 61  VVTGIAGMTNMRTVGSVAGKAMLYFITFSTVALIIGLIVGNVIQPGAGLNIDPATLDNSK 120

Query: 127 IA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           +A +++ +H  S +GF  ++IPDT +S L +GNILQ L ++++FG++L+  G+  + I +
Sbjct: 121 VAGYVEKAHESSIVGFFMNIIPDTVISPLVNGNILQVLFISIIFGLALASTGKHGEPIVR 180

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            L+  + PVF+MV+++M++AP+GAFGAM+FTIGKYG+SSI NL+ L+   Y TS  F+L 
Sbjct: 181 LLQNFSEPVFKMVAMLMKLAPIGAFGAMAFTIGKYGISSIGNLMMLIMTFYITSLLFVLV 240

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +A++  FSII LI ++K+E+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PT
Sbjct: 241 VLGAVAKYNGFSIIALIKYIKDELWLVLGTSSSEAALPSLMRKMEHAGCEKSVVGLVIPT 300

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+T+A LFI+QATN+ L++ +Q+SLLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 301 GYSFNLDGTNIYMTMAALFIAQATNIDLTIWEQVSLLLVAMISSKGAAGVTGAGFITLAA 360

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           T+ +VPS+P+AGM LILG+DRFMSECR++TN +GNA   +VV+RWEK+LD +  
Sbjct: 361 TLMVVPSVPVAGMALILGIDRFMSECRALTNLVGNACACIVVARWEKELDTEKL 414


>gi|302188995|ref|ZP_07265668.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv.
           syringae 642]
          Length = 450

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 202/414 (48%), Positives = 297/414 (71%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMN+D+ +L+   IA +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGVGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVFVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       +
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSEL 416


>gi|330941396|gb|EGH44222.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 450

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 202/414 (48%), Positives = 297/414 (71%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMN+D+ +L+   IA +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGVGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+SS+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFVVFVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAEKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       +
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSEL 416


>gi|264680625|ref|YP_003280535.1| sodium:dicarboxylate symporter [Comamonas testosteroni CNB-2]
 gi|262211141|gb|ACY35239.1| sodium:dicarboxylate symporter [Comamonas testosteroni CNB-2]
          Length = 438

 Score =  288 bits (736), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 237/413 (57%), Positives = 309/413 (74%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+ AI  G+ LGHF P  G  M+P GD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVFAIIVGVLLGHFEPAYGEAMKPFGDAFIKLIKMIIAPVIFLTIVTGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +  +G++F KAM  F  FS  ALV+GLIV N+ +PG GM+++   L+  ++  ++  
Sbjct: 75  MTHLSAVGRVFGKAMAYFLTFSTLALVVGLIVANVMQPGAGMHINPADLDQTAVKGYVAK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  +  GF+ D+IP T +S     NILQ L+VA+LFG+SL++VGE    +    E +  
Sbjct: 135 SHEMTLTGFVMDIIPKTLISPFVGDNILQVLLVAVLFGVSLAMVGEAGKPVLNFFEALTK 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V+IVM+ AP+GAFGAM+FTIGK+GL S+ NL  LV   Y TSA F+L +LG +AR
Sbjct: 195 PVFKLVNIVMKFAPIGAFGAMAFTIGKFGLGSLVNLAELVLTFYITSALFVLVILGAVAR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           FC FS++KLI +LK+E+LLVL TSSSESALP LM KME+AGC +S+V +VVPTGYSFNLD
Sbjct: 255 FCGFSVLKLIKYLKDELLLVLGTSSSESALPSLMHKMEKAGCSKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QAT+  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP 
Sbjct: 315 GTNIYMTLAALFIAQATDTHLTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPE 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVS+WE  LD +  +  +  
Sbjct: 375 VPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSKWENALDYEKLDAALAG 427


>gi|220923002|ref|YP_002498304.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
 gi|219947609|gb|ACL58001.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
          Length = 449

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 195/421 (46%), Positives = 291/421 (69%), Gaps = 1/421 (0%)

Query: 6   QVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFL 65
           +     R PLYK LY+QV+  I  G+A+G+  P +GV M+PLGD F+K  KM+I  VIF 
Sbjct: 3   KAAQARRKPLYKSLYVQVVAGIVLGVAVGYVAPTVGVDMKPLGDAFIKMIKMVIGLVIFC 62

Query: 66  TVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTE 125
           TV  GI+ M DMK + ++  KA+  F V S  ALVIG++VGN  +PG+GMN D   L+ +
Sbjct: 63  TVVAGISGMSDMKKMDRLGGKALLYFEVLSTIALVIGVVVGNFVRPGVGMNADPSKLDAD 122

Query: 126 SIAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIR 184
           ++A    ++     + F+ ++IP+T   ALT G IL  + VA+LFG  LS +GE    +R
Sbjct: 123 AVAKYAGAAKEHGTVDFLLNIIPNTVFDALTKGEILPVVFVAVLFGYVLSKLGESGKPLR 182

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
             +   +  +F +++++MR AP GAFGAM++TIGK+GL S+  L+ L+   Y T A F+ 
Sbjct: 183 DLVNAASHWIFGVINVLMRFAPFGAFGAMAYTIGKFGLGSLGQLVGLIGTFYLTGAIFVF 242

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
           GVLG+++ +  FS+ KL+ +LKEE+L+ L  SSS++ALP LM+K+E  GC +S+V +VVP
Sbjct: 243 GVLGVVSMWAGFSLFKLLRYLKEELLITLGASSSDAALPSLMEKLEHLGCSKSVVGLVVP 302

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGY FN DG+ IY+TLA LF++QATN+ L+LT QL++  +++++SKGA+G+TG+ FI L 
Sbjct: 303 TGYIFNADGTCIYMTLAALFVAQATNIDLTLTQQLAIFGVSLLTSKGASGITGAGFIALV 362

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
            T+++VP++P+AGM LILG+DRFMSE R++ N IGNAV  VV+++ E +LD +     + 
Sbjct: 363 GTLSVVPAIPLAGMALILGIDRFMSEGRAIVNIIGNAVAAVVMAKLEGELDIRRMRDVLE 422

Query: 425 I 425
            
Sbjct: 423 G 423


>gi|330949808|gb|EGH50068.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae Cit 7]
          Length = 450

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 203/415 (48%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMN+D+ +L+   IA +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGVGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+SS+  L  L+ C Y T   FI+ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCVLFIVFVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARAHGFSIFKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 417


>gi|212712966|ref|ZP_03321094.1| hypothetical protein PROVALCAL_04064 [Providencia alcalifaciens DSM
           30120]
 gi|212684444|gb|EEB43972.1| hypothetical protein PROVALCAL_04064 [Providencia alcalifaciens DSM
           30120]
          Length = 447

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 235/414 (56%), Positives = 324/414 (78%), Gaps = 1/414 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +   I+ PLYKILY+QV+VAI  G+ALGHF P IG  ++PLGD F+K  KM+I PVIFLT
Sbjct: 1   MRNIIKQPLYKILYVQVIVAITLGIALGHFFPDIGESLKPLGDAFIKIVKMIIAPVIFLT 60

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V TGI+ M +M+ +G +  KAM  F  FS  AL+IGLIV NI +PG G+N+D  +L+   
Sbjct: 61  VVTGISGMTNMRAVGSVAGKAMLYFITFSTVALIIGLIVANIIQPGAGLNIDPATLDNAK 120

Query: 127 IA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           +A +++ +H  S +GF  ++IPDT +S L +GNILQ L ++++FG++L+  G+  + I K
Sbjct: 121 VAGYVEKAHESSIVGFFMNIIPDTVISPLVNGNILQVLFISVIFGLALAATGKHGEPIVK 180

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            L+  + PVF+MV+++M++AP+GAFGAM+FTIGKYG+SSI NL+ L+   Y TS  F+L 
Sbjct: 181 LLQNFSEPVFKMVAMLMKLAPIGAFGAMAFTIGKYGISSIGNLMMLIMTFYITSLLFVLV 240

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +A++  FSII+LI ++K+E+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PT
Sbjct: 241 VLGAVAKYNGFSIIELIKYIKDELWLVLGTSSSEAALPSLMRKMEHAGCEKSVVGLVIPT 300

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+T+A LFI+QATN+ L+L  Q+SLLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 301 GYSFNLDGTNIYMTMAALFIAQATNIELTLWQQISLLLVAMISSKGAAGVTGAGFITLAA 360

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           T+ +VPS+P+AGM LILG+DRFMSECR++TN +GNA   +VV+RWEK+LD +  
Sbjct: 361 TLMVVPSIPVAGMALILGIDRFMSECRALTNLVGNACACIVVARWEKELDTEKL 414


>gi|299532811|ref|ZP_07046198.1| sodium:dicarboxylate symporter [Comamonas testosteroni S44]
 gi|298719035|gb|EFI60005.1| sodium:dicarboxylate symporter [Comamonas testosteroni S44]
          Length = 438

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 238/413 (57%), Positives = 309/413 (74%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+ AI  G+ LGHF P  G  M+P GD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVFAIIVGVLLGHFEPAYGEAMKPFGDAFIKLIKMIIAPVIFLTIVTGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +  +G++F KAM  F  FS  ALV+GLIV N+ +PG GM+++   L+  ++  ++  
Sbjct: 75  MTHLSAVGRVFGKAMAYFLTFSTLALVVGLIVANVMQPGAGMHINPADLDQTAVKGYVAK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  +  GF+ D+IP T +S     NILQ L+VA+LFG+SL++VGE    +    E +  
Sbjct: 135 SHEMTLTGFVMDIIPKTLISPFVGDNILQVLLVAVLFGVSLAMVGEAGKPVLNFFEALTK 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V+IVM+ AP+GAFGAM+FTIGK+GL S+ NL  LV   Y TSA F+L +LG +AR
Sbjct: 195 PVFKLVNIVMKFAPIGAFGAMAFTIGKFGLGSLVNLAELVLTFYITSALFVLVILGAVAR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           FC FS+IKLI +LK+E+LLVL TSSSESALP LM KME+AGC +S+V +VVPTGYSFNLD
Sbjct: 255 FCGFSVIKLIKYLKDELLLVLGTSSSESALPSLMHKMEKAGCSKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QAT+  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP 
Sbjct: 315 GTNIYMTLAALFIAQATDTHLTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPE 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVS+WE  LD +  +  +  
Sbjct: 375 VPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSKWENALDYEKLDAALAG 427


>gi|228916216|ref|ZP_04079786.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228843414|gb|EEM88492.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 435

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 178/422 (42%), Positives = 279/422 (66%), Gaps = 1/422 (0%)

Query: 3   ESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
           E  +  G ++  + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+
Sbjct: 6   EKRKNKGVLKMRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPI 65

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IFLT+  GIA M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++      
Sbjct: 66  IFLTIVLGIASMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK- 124

Query: 123 NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
             +   +++S     ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    
Sbjct: 125 GGDVSQYVQSGQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQP 184

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +    E ++   F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F
Sbjct: 185 VIDFFERLSKVFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALF 244

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +  VL  + +  +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V
Sbjct: 245 VFIVLNFICKLYKFSLWKYLSHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLV 304

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +PTGYSFNLDG+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI 
Sbjct: 305 IPTGYSFNLDGTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIV 364

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LA+T++ +  +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K 
Sbjct: 365 LASTLSAMNVIPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKV 424

Query: 423 IG 424
           + 
Sbjct: 425 LE 426


>gi|169795483|ref|YP_001713276.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AYE]
 gi|184158716|ref|YP_001847055.1| Na+/H+-dicarboxylate symporter [Acinetobacter baumannii ACICU]
 gi|213158578|ref|YP_002319876.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB0057]
 gi|215482968|ref|YP_002325173.1| C4-dicarboxylate transport protein [Acinetobacter baumannii
           AB307-0294]
 gi|301513241|ref|ZP_07238478.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB058]
 gi|301597800|ref|ZP_07242808.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB059]
 gi|332855198|ref|ZP_08435749.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013150]
 gi|332866917|ref|ZP_08437258.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013113]
 gi|332873709|ref|ZP_08441652.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6014059]
 gi|169148410|emb|CAM86275.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AYE]
 gi|183210310|gb|ACC57708.1| Na+/H+-dicarboxylate symporter [Acinetobacter baumannii ACICU]
 gi|193077754|gb|ABO12623.2| membrane-associated dicarboxylate transport protein [Acinetobacter
           baumannii ATCC 17978]
 gi|213057738|gb|ACJ42640.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB0057]
 gi|213988977|gb|ACJ59276.1| C4-dicarboxylate transport protein [Acinetobacter baumannii
           AB307-0294]
 gi|322507473|gb|ADX02927.1| C4-dicarboxylate transport protein [Acinetobacter baumannii 1656-2]
 gi|323518629|gb|ADX93010.1| Na+/H+-dicarboxylate symporter [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332727575|gb|EGJ58997.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013150]
 gi|332734340|gb|EGJ65466.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6013113]
 gi|332738097|gb|EGJ68981.1| aerobic C4-dicarboxylate transport protein [Acinetobacter baumannii
           6014059]
          Length = 432

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 222/413 (53%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGILIGHFYPELGESLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L  + + +++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFLTFSSLALVVGMIVANIIQPGKGLNIDPATLVNDKVNSYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  F+L +LG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFVLIILGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIDLIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+ +Q++LLL+AMVSSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSIGEQVALLLVAMVSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P++P+AGM LILG+DRFMSECR++TN IGNA  T+VV+RW+K LD  + +K +
Sbjct: 374 PAVPVAGMALILGIDRFMSECRALTNLIGNACATIVVARWDKALDKDVLDKAL 426


>gi|26987923|ref|NP_743348.1| C4-dicarboxylate transporter DctA [Pseudomonas putida KT2440]
 gi|38257492|sp|Q88NL9|DCTA_PSEPK RecName: Full=C4-dicarboxylate transport protein
 gi|24982633|gb|AAN66812.1|AE016310_4 C4-dicarboxylate transport protein [Pseudomonas putida KT2440]
 gi|313497545|gb|ADR58911.1| DctA [Pseudomonas putida BIRD-1]
          Length = 440

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 204/415 (49%), Positives = 302/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY+QVLVAI  G+ LGH+ P+ GV ++PLGD FVK  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYVQVLVAITIGILLGHYYPETGVALKPLGDGFVKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ KPG GM++D+ +LN  S+A  
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALIIGLVVVNVVKPGAGMHIDVSTLNASSVAAY 122

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ ++LFG +L  +G     +   ++ 
Sbjct: 123 AAAGAQQTTVGFLLNVIPNTVVGAFANGDILQVLMFSVLFGFALHRLGSYGKPVLDMIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGQYGVGSLVQLGYLMACFYITCLLFVLVVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+IKLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVIKLIRYIREELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K++D       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKEMDNDKLASELD 417


>gi|330999537|ref|ZP_08323250.1| aerobic C4-dicarboxylate transport protein [Parasutterella
           excrementihominis YIT 11859]
 gi|329574635|gb|EGG56198.1| aerobic C4-dicarboxylate transport protein [Parasutterella
           excrementihominis YIT 11859]
          Length = 457

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 193/415 (46%), Positives = 288/415 (69%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ PLYK+LY+QVL AI  G+ LG F P IG  M+PLGD F+K  KMLI PVIF TV  G
Sbjct: 1   MKKPLYKVLYVQVLAAIVIGVLLGFFFPDIGASMKPLGDGFIKLIKMLIAPVIFCTVVIG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+DMK +G++   A+  F   +  AL +GL + NI +PG GM+VD  +L+  S++ +
Sbjct: 61  IAGMEDMKKVGKVGGLALLYFEAVTTLALFVGLFLVNILQPGAGMHVDPATLDMNSVSMY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
             +   +S + F+  +IP + + A   G+ILQ L  ++ FG +L  +G     + + +++
Sbjct: 121 ATAEKPQSTLDFLFHIIPSSVVGAFAQGDILQVLFFSITFGFALQFLGGSRHPVYELIKK 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F M++ +M++AP+GAFGAM+FTIGKYG+ S+  L  L+   YAT  FF+LG+LG 
Sbjct: 181 GSDILFLMINWIMKVAPIGAFGAMAFTIGKYGIHSLLPLGKLMLVFYATCLFFVLGILGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + RF  FSI++ + ++KEE+L+VL TSSSE+ LP ++ KM++AG  RS+  +V+PTGYSF
Sbjct: 241 ICRFNGFSILRYLAYIKEELLIVLGTSSSEAVLPQMITKMQKAGVSRSVTGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+ IY+T+A +FI+QA ++ ++ T Q +LL + +++SKGAAGV+GS FI LAAT++ 
Sbjct: 301 NLDGTAIYLTMAAVFIAQACDIQMTFTQQATLLTVLLLTSKGAAGVSGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  +P+AG+ LILGVDRFMSE RS+TN IGN +  VVV RW  +L+ +     + 
Sbjct: 361 VGDIPVAGLALILGVDRFMSEARSITNMIGNGIACVVVGRWVGELNKEQLTDTLS 415


>gi|226945382|ref|YP_002800455.1| C4-dicarboxylate transporter DctA [Azotobacter vinelandii DJ]
 gi|226720309|gb|ACO79480.1| C4-dicarboxylate transport protein [Azotobacter vinelandii DJ]
          Length = 442

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 204/414 (49%), Positives = 303/414 (73%), Gaps = 1/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P YK LY+QVL+AI  G+ALGHF P+ G  M+PLGD FVK  KM I P+IF TV +GIA 
Sbjct: 7   PFYKSLYVQVLMAIAIGIALGHFYPETGAAMKPLGDGFVKLIKMAIAPIIFCTVVSGIAG 66

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           M+DMK +G+    A+  F + S  AL+IGL+V N+ +PG+GM+VD+ +L+  S+A + K+
Sbjct: 67  MQDMKAVGKTGGIALLYFEIVSTVALIIGLVVINLVQPGVGMHVDVSALDAGSVAAYAKA 126

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
              +S IGF+ ++IP T + A  +G+ILQ L  +++F  +L  +G+    + + ++ I  
Sbjct: 127 GGEQSTIGFLLNVIPGTVVGAFANGDILQVLFFSVIFAFALQRMGDYGRPVLEFIDRIAH 186

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +F +++++M++AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F+L VLG +AR
Sbjct: 187 VMFGIINMIMKVAPIGAFGAMAFTIGKYGVGSLLQLGQLMLCFYITCILFVLVVLGGIAR 246

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              F+I++ I +++EE+L+VL TSSSES LP ++ KME+ GCH+S+V +V+PTGYSFNLD
Sbjct: 247 ANGFNILRFIRYIREELLIVLGTSSSESVLPRMLNKMEKLGCHKSVVGLVIPTGYSFNLD 306

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+T+A +FI+QAT+ P+ LT QL+LL + +V+SKGAAGVTGS FI LAAT++ V  
Sbjct: 307 GTSIYLTMAAVFIAQATDTPMDLTQQLTLLAVLLVASKGAAGVTGSGFIVLAATLSAVGH 366

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+AG+ LILG+DRFMSE R++TN +GN V +VVV+RW  +LD +   + +  +
Sbjct: 367 VPVAGLALILGIDRFMSEARALTNLVGNGVASVVVARWCGQLDSERMQRELAGQ 420


>gi|53724335|ref|YP_104703.1| C4-dicarboxylate transporter DctA [Burkholderia mallei ATCC 23344]
 gi|67640361|ref|ZP_00439170.1| aerobic C4-dicarboxylate transport protein DctA [Burkholderia
           mallei GB8 horse 4]
 gi|121600402|ref|YP_991555.1| C4-dicarboxylate transporter DctA [Burkholderia mallei SAVP1]
 gi|124386144|ref|YP_001027372.1| C4-dicarboxylate transporter DctA [Burkholderia mallei NCTC 10229]
 gi|126451410|ref|YP_001082336.1| C4-dicarboxylate transporter DctA [Burkholderia mallei NCTC 10247]
 gi|167003202|ref|ZP_02268992.1| aerobic C4-dicarboxylate transport protein DctA [Burkholderia
           mallei PRL-20]
 gi|81603798|sp|Q62F24|DCTA_BURMA RecName: Full=C4-dicarboxylate transport protein
 gi|167012052|sp|A3MQ00|DCTA_BURM7 RecName: Full=C4-dicarboxylate transport protein
 gi|167012053|sp|A2S603|DCTA_BURM9 RecName: Full=C4-dicarboxylate transport protein
 gi|167012054|sp|A1V002|DCTA_BURMS RecName: Full=C4-dicarboxylate transport protein
 gi|52427758|gb|AAU48351.1| C4-dicarboxylate transport protein [Burkholderia mallei ATCC 23344]
 gi|121229212|gb|ABM51730.1| C4-dicarboxylate transport protein [Burkholderia mallei SAVP1]
 gi|124294164|gb|ABN03433.1| aerobic C4-dicarboxylate transport protein DctA [Burkholderia
           mallei NCTC 10229]
 gi|126244280|gb|ABO07373.1| aerobic C4-dicarboxylate transport protein DctA [Burkholderia
           mallei NCTC 10247]
 gi|238521061|gb|EEP84515.1| aerobic C4-dicarboxylate transport protein DctA [Burkholderia
           mallei GB8 horse 4]
 gi|243061199|gb|EES43385.1| aerobic C4-dicarboxylate transport protein DctA [Burkholderia
           mallei PRL-20]
          Length = 428

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 216/416 (51%), Positives = 306/416 (73%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S  ALV+GL   +I +PG+G N+D  +LN + +A  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTCALVLGLAATHILRPGVGFNIDPATLNGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++ 
Sbjct: 121 AAKAHGQSSVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 ITRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGY F
Sbjct: 241 IARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYLF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLRAALSG 416


>gi|300311930|ref|YP_003776022.1| C4-dicarboxylate transport transmembrane protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074715|gb|ADJ64114.1| C4-dicarboxylate transport transmembrane protein [Herbaspirillum
           seropedicae SmR1]
          Length = 441

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 210/416 (50%), Positives = 291/416 (69%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +PPLYK LY QVLVAI  G+ LGHF P  G  M+PLGD FVK  KM+I PVIF TV  GI
Sbjct: 5   KPPLYKSLYFQVLVAIVIGILLGHFYPSTGEAMKPLGDGFVKLIKMIIAPVIFCTVVIGI 64

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M+DMK +G+    A+  F V S  AL+IGL++ N  +PG+GMNVD  SL+T+SIA + 
Sbjct: 65  AGMEDMKKVGKTGGLALLYFEVVSTVALIIGLLLVNFLQPGVGMNVDPASLDTKSIAAYT 124

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                 S   F+  +IP + + A   G++LQ L+VA+LFG +L   G +   +   +E+I
Sbjct: 125 APGKMGSVTDFVLGIIPTSMVDAFAKGDVLQVLLVAVLFGFALHKFGGRGTLVFDFIEKI 184

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F +V  +M++AP+GAFGAMSFTIGKYG+ S+ +L  L+   Y T   FI  VLGI+
Sbjct: 185 SHVLFSVVGAIMKVAPIGAFGAMSFTIGKYGVGSLFSLAKLMGTFYLTCLLFIFVVLGII 244

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R   FSI K + ++KEE+L+VL TSSSES LP ++ KME AG  +++V +V+PTGYSFN
Sbjct: 245 TRLHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMLAKMENAGAKKTVVGLVIPTGYSFN 304

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+ IY+T+A +FI+QATN P++   +L+LL + +++SKGAAG+TGS FI LAAT++ V
Sbjct: 305 LDGTAIYLTMAAVFIAQATNTPMTFVQELTLLGVLLLTSKGAAGITGSGFIVLAATLSAV 364

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             +P+AG+ LILG+DRFMSE R++TN IGN V T+VV++W  +LD +   K +  E
Sbjct: 365 GHVPVAGLALILGIDRFMSEARALTNTIGNGVATLVVAKWSGELDSERLTKVLNNE 420


>gi|15807509|ref|NP_296245.1| C4-dicarboxylate transport protein [Deinococcus radiodurans R1]
 gi|6460349|gb|AAF12066.1|AE002082_2 C4-dicarboxylate transport protein [Deinococcus radiodurans R1]
          Length = 463

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 212/419 (50%), Positives = 301/419 (71%), Gaps = 1/419 (0%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
           G++ P +++ LY+QV++AI  G+ +G   P+ G  ++PLGDIFVK  KM+I P+IF TV 
Sbjct: 18  GEVMPKIFRSLYVQVIIAIVLGILVGALFPKFGEALKPLGDIFVKLIKMVIAPIIFATVV 77

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
           +G+A M+D + +G++  KA+  F V S  AL+IG++V N+ +PG GMNVD  +L+T  + 
Sbjct: 78  SGVAHMRDTRKVGRVGGKALIYFEVVSTLALIIGMVVMNVLRPGAGMNVDPATLDTAGLT 137

Query: 129 HIKSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
               +  + +    +  +IPDT +SA T G +L  L+VALLFG +L  +G+  D I   +
Sbjct: 138 KYTEAAGEMTVWDHILKIIPDTLVSAFTGGELLPVLLVALLFGFALMRLGKLGDQILYGI 197

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + +N  VF ++  +MR+AP+GAFGAM+FT+GKYGL S+++L +L+   Y T   FI  VL
Sbjct: 198 DALNQVVFVILGFIMRLAPIGAFGAMAFTVGKYGLKSLTSLGYLMGSFYLTCLLFIFVVL 257

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G++AR   FSI KLI +++EE+L+VL TSSSESALP LM K+E AG  +S+V +VVPTGY
Sbjct: 258 GLIARAAGFSIFKLIRYIREELLIVLGTSSSESALPRLMMKLEHAGAEKSVVGLVVPTGY 317

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG++IY+T+A LFI+QATN PL L +QLSLL + +++SKGAAGVTGS FITLAAT+
Sbjct: 318 SFNLDGTSIYLTMAALFIAQATNTPLGLGEQLSLLAVLLLTSKGAAGVTGSGFITLAATL 377

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             V  +P+AGM LILG+DRFMSE R++TNFIGNAV T+VV+R E  +D     + +  E
Sbjct: 378 GAVGHVPVAGMALILGIDRFMSEARALTNFIGNAVATLVVARSENAVDMNRLTRALNGE 436


>gi|16265271|ref|NP_438063.1| C4-dicarboxylate transporter DctA [Sinorhizobium meliloti 1021]
 gi|118394|sp|P20672|DCTA_RHIME RecName: Full=C4-dicarboxylate transport protein
 gi|152164|gb|AAA26253.1| C4-dicarboxylate carrier A' (put.); putative [Sinorhizobium
           meliloti]
 gi|152168|gb|AAA63508.1| membrane-associated dicarboxylate transport protein [Sinorhizobium
           meliloti]
 gi|455348|gb|AAA26248.1| dctA protein [Sinorhizobium meliloti]
 gi|15141411|emb|CAC49923.1| C4-dicarboxylate transport protein [Sinorhizobium meliloti 1021]
          Length = 441

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 235/416 (56%), Positives = 328/416 (78%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLY+ LY+QVL AI +G+ LGHF P IG +++PLGD F++  KM+I PVIFLTV+TGI
Sbjct: 12  KTPLYRHLYVQVLAAIAAGILLGHFYPDIGTELKPLGDAFIRLVKMIIAPVIFLTVATGI 71

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+  +G++  KAM  F  FS  ALV+GL+V N+ +PG GM++D  SL+ +++A + 
Sbjct: 72  AGMTDLAKVGRVAGKAMIYFLAFSTLALVVGLVVANVVQPGAGMHIDPASLDAKAVATYA 131

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L+ +
Sbjct: 132 EKAHEQSITGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKKAEPVVDFLQAL 191

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 192 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGIASIANLAMLIGTFYLTSFLFVFIVLGAV 251

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 252 ARYNGFSILSLIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 311

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+ PLS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 312 LDGTNIYMTLAALFIAQATDTPLSYGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 371

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TNF+GNAV T+VV++WE +LD    +  +G E
Sbjct: 372 PSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVAKWEGELDQAQLSAALGGE 427


>gi|163852476|ref|YP_001640519.1| sodium:dicarboxylate symporter [Methylobacterium extorquens PA1]
 gi|163664081|gb|ABY31448.1| sodium:dicarboxylate symporter [Methylobacterium extorquens PA1]
          Length = 447

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 222/412 (53%), Positives = 315/412 (76%), Gaps = 1/412 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           LY+ LY QVLVA+  G+ALGHF P++G  M+PLGD F+K  KM+I PVIFLTV +GIA M
Sbjct: 20  LYRTLYFQVLVAVAIGIALGHFCPKLGADMKPLGDAFIKLVKMIIAPVIFLTVVSGIAGM 79

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-SS 133
            +++ +G++  KA+  F  FS  AL++GL+V N+ +PG G+++D  SL+ +++A     +
Sbjct: 80  TNLEKVGRVGGKALIYFITFSTLALIVGLVVANVLQPGHGLHIDPNSLDPKAVATYAGKA 139

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             ++   F+ ++IP TA+ A   G ILQ L  ++LFG  L+ +GE+   +   ++ ++  
Sbjct: 140 KEQNIADFLMNIIPTTAVGAFAGGEILQVLFFSVLFGFGLAFLGERGKPVLDIIKVMSEA 199

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F +V+I+M++AP+GAFGAM+FTIGKYG+SS++NL +LV   Y TSA F+LGVLG +AR+
Sbjct: 200 IFGVVNIIMKVAPIGAFGAMAFTIGKYGISSLANLAYLVGAFYLTSAIFVLGVLGAVARY 259

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
             FSI+KLI ++KEE++LVL TSSSESALP L+ KME+AGC R +V +VVPTGYSFNLDG
Sbjct: 260 NGFSILKLIRYIKEELMLVLGTSSSESALPSLIDKMEKAGCSRPVVGLVVPTGYSFNLDG 319

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           +NIY+T+A LFI+QAT+ P++  +Q+ LLL+AM+SSKGAAGVTGS FITLAAT+ +VPS+
Sbjct: 320 TNIYMTMAALFIAQATDTPITYGEQILLLLVAMLSSKGAAGVTGSGFITLAATLAVVPSV 379

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P+ GM LILG+DRFMSECR++TNFIGNAV  +VV+RWE ++D    +  +G 
Sbjct: 380 PVVGMALILGIDRFMSECRALTNFIGNAVACIVVARWEGEVDEAKLHAALGG 431


>gi|310816291|ref|YP_003964255.1| sodium:dicarboxylate symporter [Ketogulonicigenium vulgare Y25]
 gi|308755026|gb|ADO42955.1| sodium:dicarboxylate symporter [Ketogulonicigenium vulgare Y25]
          Length = 454

 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 235/426 (55%), Positives = 313/426 (73%), Gaps = 1/426 (0%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           + ++    G    P Y+ LY QV+VAI  G  +GH  P  G  ++PLGD F+K  KM+I 
Sbjct: 2   LSDTASTAGHGPRPFYRHLYFQVIVAIVLGALIGHLWPTFGASLKPLGDGFIKLVKMIIA 61

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           PVIF+T+ TG+A M+D++ +G +  KA   F VFS  AL++GLIV N+ +PG GMN+D  
Sbjct: 62  PVIFITIVTGLAGMRDLRGVGSVAGKAFGYFLVFSTLALIVGLIVANVVRPGAGMNIDPA 121

Query: 121 SLNTESIAHIKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
           +L+  S+A+  S +H  +  GF+ D+IP+T + A T GNI+Q L VA+LFG+ + LVGE+
Sbjct: 122 TLDGSSVANYASQAHDSTLTGFLLDIIPNTMVGAFTQGNIIQVLFVAILFGVGIILVGER 181

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
           +  +   LE     VFR+V I+M+ AP+GAFGA +FTIG YG+ ++ NL  LV   Y T+
Sbjct: 182 AKPVVTLLEAAGQVVFRIVDILMKAAPVGAFGAFAFTIGAYGIGTVVNLAALVGTFYLTA 241

Query: 240 AFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIV 299
           A F++ +LG +     FSI +LI +LK E+LLVL TSSSESALP LM+KME+AGC R +V
Sbjct: 242 AVFVIVILGTVCAVNGFSIFRLISYLKAEILLVLGTSSSESALPSLMEKMEKAGCARPVV 301

Query: 300 SMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSA 359
            +VVPTGYSFNLDG+NIY+TLA LFI+QATN+ LSL DQ+ LLL+AM+SSKGAAGVTG+ 
Sbjct: 302 GLVVPTGYSFNLDGTNIYMTLAALFIAQATNIDLSLGDQIMLLLVAMLSSKGAAGVTGAG 361

Query: 360 FITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           FITLAAT+++VPS+PIAGM +ILGVDRFMSECRS+TNFIGNAV TVVVSRWE +LD +  
Sbjct: 362 FITLAATLSIVPSVPIAGMAIILGVDRFMSECRSITNFIGNAVATVVVSRWEGQLDTQRL 421

Query: 420 NKYIGI 425
           +  +G 
Sbjct: 422 HAVLGG 427


>gi|229087939|ref|ZP_04220050.1| C4-dicarboxylate transport protein [Bacillus cereus Rock3-44]
 gi|228695407|gb|EEL48281.1| C4-dicarboxylate transport protein [Bacillus cereus Rock3-44]
          Length = 429

 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 273/412 (66%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L  QVL AI  G+ +G   P +G +M+P+GD F+   KM+I P+IFLT+  GIA
Sbjct: 4   KRLFKNLTFQVLTAIVLGVLVGLMWPSVGKEMKPIGDTFINAVKMVIAPIIFLTIVLGIA 63

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V + FAL++GLIV N+ KPG G+N +  +    S      
Sbjct: 64  KMGDMKKVGKVGGKAFIYFEVVTTFALIVGLIVVNVMKPGSGLNFNELAKGDVSKYTQGG 123

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
               ++I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK  T+   L++++ 
Sbjct: 124 GQGINWIDFVTHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKTVIDFLDKLSH 183

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++  VM+ AP+GAFGAM++TIG +GL+S+  L  L+  +Y T   F+  VL I+ +
Sbjct: 184 VFFNIIGYVMKAAPIGAFGAMAYTIGHFGLASLVPLGKLMMSVYITMFLFVFVVLNIICK 243

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+++E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 244 IYGFSLWNYLKFIRDEILIVLGTSSSESVLPRMMNKMERYGCSKSVVGLVIPTGYSFNLD 303

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++A +F++Q   V L++  Q++++L+ M++SKGAAGVTGS FI LA+T+  +  
Sbjct: 304 GTSIYLSMAVVFLAQVFGVDLTIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLAALKV 363

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + T+VV++ E + D     + + 
Sbjct: 364 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIVVAKSENEFDETKHAEAVS 415


>gi|221070066|ref|ZP_03546171.1| sodium:dicarboxylate symporter [Comamonas testosteroni KF-1]
 gi|220715089|gb|EED70457.1| sodium:dicarboxylate symporter [Comamonas testosteroni KF-1]
          Length = 438

 Score =  287 bits (734), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 238/413 (57%), Positives = 309/413 (74%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+ AI  G+ LGHF P  G  M+P GD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVFAIIVGVLLGHFEPAYGEAMKPFGDAFIKLIKMIIAPVIFLTIVTGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +  +G++F KAM  F  FS  ALV+GLIV N+ +PG GM+++   L+  ++  ++  
Sbjct: 75  MTHLSAVGRVFGKAMAYFLTFSTLALVVGLIVANVMQPGAGMHINPADLDQTAVKGYVAK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  +  GF+ D+IP T +S     NILQ L+VA+LFG+SL++VGE    +    E +  
Sbjct: 135 SHEMTLTGFVMDIIPKTLISPFVGDNILQVLLVAVLFGVSLAMVGEAGKPVLNFFEALTK 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V+IVM+ AP+GAFGAM+FTIGK+GL S+ NL  LV   Y TSA F+L +LG +AR
Sbjct: 195 PVFKLVNIVMKFAPIGAFGAMAFTIGKFGLGSLVNLAELVLTFYITSALFVLVILGAVAR 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           FC FS+IKLI +LK+E+LLVL TSSSESALP LM KME+AGC +S+V +VVPTGYSFNLD
Sbjct: 255 FCGFSVIKLIKYLKDELLLVLGTSSSESALPSLMHKMEKAGCSKSVVGLVVPTGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QAT+  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP 
Sbjct: 315 GTNIYMTLAALFIAQATDTHLTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPE 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVS+WE  LD +  +  +  
Sbjct: 375 VPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSKWENALDHEKLDAALAG 427


>gi|260554544|ref|ZP_05826765.1| membrane-associated dicarboxylate transporter [Acinetobacter
           baumannii ATCC 19606]
 gi|260411086|gb|EEX04383.1| membrane-associated dicarboxylate transporter [Acinetobacter
           baumannii ATCC 19606]
          Length = 432

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 221/413 (53%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGILIGHFYPELGESLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L  + + +++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFLTFSSLALVVGMIVANIIQPGKGLNIDPATLVNDKVNSYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  F+L +LG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFVLIILGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIDLIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+ +Q++LLL+AMVSSKGAAGVTG+ FITL+AT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSIGEQVALLLVAMVSSKGAAGVTGAGFITLSATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P++P+AGM LILG+DRFMSECR++TN IGNA  T+VV+RW+K LD  + +K +
Sbjct: 374 PAVPVAGMALILGIDRFMSECRALTNLIGNACATIVVARWDKALDKDVLDKAL 426


>gi|228928638|ref|ZP_04091674.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228934860|ref|ZP_04097691.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|229123103|ref|ZP_04252310.1| C4-dicarboxylate transport protein [Bacillus cereus 95/8201]
 gi|228660397|gb|EEL16030.1| C4-dicarboxylate transport protein [Bacillus cereus 95/8201]
 gi|228824760|gb|EEM70561.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830957|gb|EEM76558.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 435

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 178/422 (42%), Positives = 279/422 (66%), Gaps = 1/422 (0%)

Query: 3   ESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
           E  +  G ++  + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+
Sbjct: 6   EKRKNKGVLKMRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPI 65

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IFLT+  GIA M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++      
Sbjct: 66  IFLTIVLGIASMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK- 124

Query: 123 NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
             +   +++S     ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    
Sbjct: 125 GGDVSQYVQSGQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQP 184

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +    E ++   F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F
Sbjct: 185 VIDFFERLSKVFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALF 244

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +  VL  + +  +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V
Sbjct: 245 VFIVLNFICKLYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLV 304

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +PTGYSFNLDG+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI 
Sbjct: 305 IPTGYSFNLDGTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIV 364

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LA+T++ +  +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K 
Sbjct: 365 LASTLSAMNVIPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKV 424

Query: 423 IG 424
           + 
Sbjct: 425 LE 426


>gi|299769479|ref|YP_003731505.1| C4-dicarboxylate transport protein [Acinetobacter sp. DR1]
 gi|298699567|gb|ADI90132.1| C4-dicarboxylate transport protein [Acinetobacter sp. DR1]
          Length = 432

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 221/413 (53%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGILIGHFYPELGESLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L  + +  ++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFLTFSSLALVVGMIVANIIQPGKGLNIDPATLVNDKVNTYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  F++ +LG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFVVVILGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIHLIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+++Q++LLL+AMVSSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSISEQIALLLVAMVSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P++P+AGM LILG+DRFMSECR++TN +GNA  T+VV+RW+K LD  L +K +
Sbjct: 374 PAVPVAGMALILGIDRFMSECRALTNLVGNACATIVVARWDKALDKDLLDKAL 426


>gi|289662542|ref|ZP_06484123.1| C4-dicarboxylate transporter DctA [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 457

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 237/423 (56%), Positives = 311/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GLIV ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMAYFLFFSTLALVVGLIVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG++ R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGVVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLKLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|262279584|ref|ZP_06057369.1| C4-dicarboxylate transporter [Acinetobacter calcoaceticus RUH2202]
 gi|262259935|gb|EEY78668.1| C4-dicarboxylate transporter [Acinetobacter calcoaceticus RUH2202]
          Length = 432

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 223/413 (53%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGILIGHFYPELGESLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L  + +  ++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFLTFSSLALVVGMIVANIIQPGKGLNIDPATLVNDKVNTYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  FIL +LG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFILVILGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIHLIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+++Q++LLL+AMVSSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSISEQIALLLVAMVSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P++P+AGM LILG+DRFMSECR++TN +GNA  T+VV+RW+K LD  L +K +
Sbjct: 374 PAVPVAGMALILGIDRFMSECRALTNLVGNACATIVVARWDKALDKDLLDKAL 426


>gi|226357081|ref|YP_002786821.1| Na+/H+-dicarboxylate symporter [Deinococcus deserti VCD115]
 gi|259645140|sp|C1CYN7|DCTA_DEIDV RecName: Full=C4-dicarboxylate transport protein
 gi|226319071|gb|ACO47067.1| putative Na+/H+-dicarboxylate symporter; putative membrane protein
           [Deinococcus deserti VCD115]
          Length = 442

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 215/415 (51%), Positives = 305/415 (73%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           P +++ LY+QVL+AI  G+  G   P +G  ++PLGD F+K  KM+I P+IF TV +GIA
Sbjct: 2   PKIFRSLYVQVLIAIALGILTGFLFPSLGESLKPLGDGFIKLIKMIIAPIIFATVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK- 131
            M+D K +G++  KA+  F + + FALVIGL++ NI  PG GMN+D  SL+T  I+    
Sbjct: 62  HMRDTKKVGRVGGKALLYFELVTTFALVIGLVIVNILGPGRGMNIDPASLDTSGISKYTD 121

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           ++  ++   F+  +IPDT +SA T G++LQ L+VA+LFG +L  +G+  DTI K ++ +N
Sbjct: 122 AAGEQTVADFILHIIPDTLISAFTQGDLLQVLLVAVLFGFALLRLGKVGDTILKGIDTVN 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +F ++  VMR+AP+GAFGAM+FTIGKYG+ S++ L +L+   YAT A FI GVLG++A
Sbjct: 182 QVIFVILGFVMRLAPIGAFGAMAFTIGKYGVGSLAQLGYLMITFYATCALFIFGVLGLIA 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FSI+KLI ++KEE+LLVL TSSSESALP LM K+E AG  +S+V +VVP+GYSFNL
Sbjct: 242 RMSGFSILKLIRYIKEELLLVLGTSSSESALPRLMVKLEHAGAEKSVVGLVVPSGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+A +FI+QATN  LSL  QL LL + +++SKGAAGVTGS FITLAAT++ V 
Sbjct: 302 DGTSIYLTMAAMFIAQATNTELSLGQQLGLLGVLLLTSKGAAGVTGSGFITLAATLSAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ LILG+DRFMSE R++TNFIGNAV  +V+++ E+ +D     + +  E
Sbjct: 362 DVPVAGLALILGIDRFMSEARALTNFIGNAVAALVIAKSERAVDVDRLTRALNGE 416


>gi|289667806|ref|ZP_06488881.1| C4-dicarboxylate transporter DctA [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 457

 Score =  287 bits (733), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 236/423 (55%), Positives = 310/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+  GIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVNGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GLIV ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMAYFLFFSTLALVVGLIVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG++ R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGVVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLKLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|293609482|ref|ZP_06691784.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827934|gb|EFF86297.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122745|gb|ADY82268.1| C4-dicarboxylate transporter DctA [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 432

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 221/413 (53%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGILIGHFYPELGESLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L  + +  ++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFLTFSSLALVVGMIVANIIQPGKGLNIDPATLVNDKVNTYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  F++ +LG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFVIVILGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIHLIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+++Q++LLL+AMVSSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSISEQIALLLVAMVSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P++P+AGM LILG+DRFMSECR++TN +GNA  T+VV+RW+K LD  L +K +
Sbjct: 374 PAVPVAGMALILGIDRFMSECRALTNLVGNACATIVVARWDKALDKDLLDKAL 426


>gi|73539983|ref|YP_294503.1| C4-dicarboxylate transporter DctA [Ralstonia eutropha JMP134]
 gi|123625991|sp|Q476M4|DCTA_RALEJ RecName: Full=C4-dicarboxylate transport protein
 gi|72117396|gb|AAZ59659.1| Sodium:dicarboxylate symporter [Ralstonia eutropha JMP134]
          Length = 431

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 217/414 (52%), Positives = 313/414 (75%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P YKILY+QVL AIF G+ LGHF P  GV M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MRKPFYKILYVQVLFAIFVGILLGHFWPDTGVAMKPLGDGFIKLIKMIIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH- 129
           IA M DMK +G++  KA+  F + S FAL+IGL   ++ KPG+G N+D  +L+T++I   
Sbjct: 61  IAGMSDMKKVGRVGGKALLYFEIVSTFALLIGLGAAHLLKPGVGFNIDPATLDTKAIEQY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +  +H +S + F+  +IPDT  SA ++G+ILQ L+V+L FG +L+ +GE++  + + +E+
Sbjct: 121 VSKAHGQSTVEFLMHIIPDTIFSAFSNGDILQILLVSLFFGAALAAIGERARIVVQLIEQ 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   F +V ++ ++AP+GAFGAM+FTIGKYGL S+  L+ L+   Y T+  F++ VLG 
Sbjct: 181 VSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLVPLLKLIGTFYFTAIVFVVFVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I++ I ++KEE+L+VL TSSSE+ALP LM+K+E+ GC +S+V +VVPTGYSF
Sbjct: 241 IARATGFNILRFISYIKEELLIVLGTSSSEAALPHLMEKLEKLGCSKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A +FI+QAT + L+L  QL++L +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVIFIAQATGIELTLLQQLTILGVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           VP++P+AGM LILG+DRFMSECR++TN IGN V TVVVS WE +LD     + +
Sbjct: 361 VPTIPVAGMVLILGIDRFMSECRALTNIIGNGVATVVVSAWEHELDRAQLKRTL 414


>gi|239501415|ref|ZP_04660725.1| C4-dicarboxylate transport protein [Acinetobacter baumannii AB900]
          Length = 432

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 222/413 (53%), Positives = 314/413 (76%), Gaps = 1/413 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGILIGHFYPELGESLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L  + + +++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFLTFSSLALVVGMIVANIIQPGKGLNIDPATLVNDKVNSYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  F+L +LG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFVLIILGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIDLIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+ +Q++LLL+AMVSSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSIGEQVALLLVAMVSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P++P+AGM LILG+DRFMSECR++TN IGNA  T+VV+RW+K LD  + +K +
Sbjct: 374 PAVPVAGMALILGIDRFMSECRALTNLIGNACATIVVARWDKALDKDVLDKAL 426


>gi|227820414|ref|YP_002824385.1| C4-dicarboxylate transporter DctA [Sinorhizobium fredii NGR234]
 gi|227339413|gb|ACP23632.1| DctA2, C4-dicarboxylate transport protein [Sinorhizobium fredii
           NGR234]
          Length = 442

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 233/416 (56%), Positives = 326/416 (78%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY+QVL AI +G+ LGHF P++G +++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 12  KTPFYRHLYVQVLAAIAAGILLGHFYPELGTELKPLGDAFIKLVKMIIAPVIFLTVATGI 71

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M D+  +G++  KAM  F  FS  ALV+GLIV N+ +PG GM++D  SL+ +++A   
Sbjct: 72  AGMTDLAKVGRVAGKAMLYFLTFSTLALVVGLIVANVVQPGAGMHIDPASLDAKAVASYA 131

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L+ +
Sbjct: 132 AKAHEQSITGFLMNIIPTTLIGAFAEGDILQVLFISVLFGISLAMVGKKAEPVVDFLQAL 191

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 192 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGVASIANLAMLIGTFYLTSFLFVFVVLGAV 251

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 252 ARYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 311

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+ PLS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+++V
Sbjct: 312 LDGTNIYMTLAALFIAQATDTPLSYGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 371

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+P+AGM LILG+DRFMSECR++TNF+GNAV T+VV++WE +LD    +  +  +
Sbjct: 372 PSVPVAGMALILGIDRFMSECRALTNFVGNAVATLVVAKWEGELDQAQLSVALAGD 427


>gi|89900233|ref|YP_522704.1| C4-dicarboxylate transporter DctA [Rhodoferax ferrireducens T118]
 gi|122479554|sp|Q21YI0|DCTA_RHOFD RecName: Full=C4-dicarboxylate transport protein
 gi|89344970|gb|ABD69173.1| sodium:dicarboxylate symporter [Rhodoferax ferrireducens T118]
          Length = 448

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 202/418 (48%), Positives = 292/418 (69%), Gaps = 1/418 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
               R PLYK LY QV+ A+  G+ LGHF PQ+G QM+PLGD F+K  KM+I P+IF TV
Sbjct: 3   KTSARKPLYKSLYAQVIFAVTIGVLLGHFYPQLGTQMKPLGDGFIKLIKMIIAPIIFCTV 62

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
             GIA M+DMK +G+    A+  F V S  ALV+GL+V N+ +PG GM+VD  SL+T+ I
Sbjct: 63  VVGIAGMEDMKKVGKTGGLALLYFEVMSTLALVVGLLVVNVLQPGTGMHVDPMSLDTKGI 122

Query: 128 AHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
           A        +  + F+ ++IP + + A   G ILQ L+ ++LFG +L   G +   +   
Sbjct: 123 AAYTAPGKMQGSVDFLLNVIPSSVVDAFAKGEILQVLLFSVLFGFALHKFGGRGTMVFDF 182

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
           +E+ +  +F +V I+M++AP+GAFGAM+FTIGKYGL S+ +L  L+   Y T   F+ GV
Sbjct: 183 IEKFSHVLFDIVGIIMKVAPIGAFGAMAFTIGKYGLGSLFSLGKLMGAFYLTCLIFVFGV 242

Query: 247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTG 306
           LGI++R   FS+ K + ++KEE+L+VL TSSSES LP +M+KME  G  +S+V +V+PTG
Sbjct: 243 LGIVSRLNGFSVFKFVRYIKEELLIVLGTSSSESVLPRMMEKMENLGARKSVVGLVIPTG 302

Query: 307 YSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAAT 366
           YSFNLDG++IY+T+A +FI+QAT+ P++L  Q++LL + +++SKGAAGVTGS FI LAAT
Sbjct: 303 YSFNLDGTSIYLTMAAVFIAQATDTPMTLMQQVTLLAVLLLTSKGAAGVTGSGFIVLAAT 362

Query: 367 ITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           ++ V  +P+AG+ LILG+DRFMSE R++TN +GN V T+VV++W   LD    ++ + 
Sbjct: 363 LSAVGGVPVAGLALILGIDRFMSEARALTNLVGNGVATLVVAKWTGDLDMTRLHQGLD 420


>gi|254420603|ref|ZP_05034327.1| transporter, DAACS family [Brevundimonas sp. BAL3]
 gi|196186780|gb|EDX81756.1| transporter, DAACS family [Brevundimonas sp. BAL3]
          Length = 440

 Score =  286 bits (732), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 223/416 (53%), Positives = 311/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P Y+ LY QVL AI +G  +GHF P  G  ++PLGD F+K  KM+I PVIFLT+ TG
Sbjct: 1   MRRPFYRHLYFQVLTAIVAGAIIGHFWPSFGESLKPLGDAFIKLVKMIIAPVIFLTIVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M D+  +G++  KA   F  FS  AL++GLI+ N+ +PG G+N+D  +L+  ++A  
Sbjct: 61  IAGMSDLGRVGRVAAKAFAYFLTFSTLALIVGLIIANLVQPGRGLNIDPATLDVGAVAKY 120

Query: 131 -KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H  +  GF+  +IPDT +SA + GNILQ L V++LFG++L+LVG+    +   LE 
Sbjct: 121 SEQAHETTITGFLMGIIPDTMVSAFSEGNILQVLFVSVLFGLALALVGDVGKPVLSFLES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I+   F++V+I+M+ AP+GAFGA +FTIGKYG+ SI+NL  LV   Y T+  F++G+LG+
Sbjct: 181 ISHAFFKLVAILMKAAPIGAFGAFAFTIGKYGIGSIANLAALVATFYLTAVIFVVGILGL 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A    F+I+KLI +LKEE+LLVL TSSSE+ALP L+ KME AG  +S+V +VVPTGYSF
Sbjct: 241 VAWANGFNILKLIRYLKEELLLVLGTSSSEAALPSLLNKMERAGASKSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QA N+ L+L  Q+ LLL+AM+SSKGAAG+TG+ FITLAAT+++
Sbjct: 301 NLDGTNIYMTMAALFIAQALNIELTLQQQILLLLVAMLSSKGAAGITGAGFITLAATLSV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP++P+AGM LILG+DRFMSECR++TNFIGNAV T+VV+RWE +LD    +  +  
Sbjct: 361 VPTVPVAGMALILGIDRFMSECRALTNFIGNAVATIVVARWEGELDRDALHAALNG 416


>gi|82779561|ref|YP_405910.1| C4-dicarboxylate transporter DctA [Shigella dysenteriae Sd197]
 gi|123560881|sp|Q327T6|DCTA_SHIDS RecName: Full=C4-dicarboxylate transport protein
 gi|81243709|gb|ABB64419.1| uptake of C4-dicarboxylic acids [Shigella dysenteriae Sd197]
          Length = 428

 Score =  286 bits (732), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++  +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVEVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|325272762|ref|ZP_08139109.1| C4-dicarboxylate transporter DctA [Pseudomonas sp. TJI-51]
 gi|324102102|gb|EGB99601.1| C4-dicarboxylate transporter DctA [Pseudomonas sp. TJI-51]
          Length = 440

 Score =  286 bits (732), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 205/415 (49%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY+QVLVAI  G+ LGHF P+ GV ++P GD FVK  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYVQVLVAITIGILLGHFYPETGVALKPFGDGFVKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ KPG GM++D+ +LN  S+A  
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALIIGLIVVNVVKPGAGMHIDVSTLNASSVAAY 122

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ ++LFG +L  +G     +   ++ 
Sbjct: 123 AAAGAQQTTVGFLLNVIPNTVVGAFANGDILQVLMFSVLFGFALHRLGSYGKPLLDMIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPLGAFGAMAFTIGQYGVGSLVQLGYLMACFYITCLLFVLVVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K++D       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKEMDNDKLASELA 417


>gi|148546461|ref|YP_001266563.1| C4-dicarboxylate transporter DctA [Pseudomonas putida F1]
 gi|167012305|sp|A5VZR9|DCTA_PSEP1 RecName: Full=C4-dicarboxylate transport protein
 gi|148510519|gb|ABQ77379.1| sodium:dicarboxylate symporter [Pseudomonas putida F1]
          Length = 440

 Score =  286 bits (732), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 204/415 (49%), Positives = 302/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY+QVLVAI  G+ LGH+ P+ GV ++PLGD FVK  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYVQVLVAITIGILLGHYYPETGVALKPLGDGFVKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ KPG GM++D+ +LN  S+A  
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALIIGLVVVNVVKPGAGMHIDVSTLNASSVAAY 122

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ ++LFG +L  +G     +   ++ 
Sbjct: 123 AAAGAQQTTVGFLLNVIPNTVVGAFANGDILQVLMFSVLFGFALHRLGSYGKPVLDMIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGQYGVGSLVQLGYLMACFYITCLLFVLVVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+IKLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVIKLIRYIREELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K++D       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKEMDNDKLASELA 417


>gi|238761235|ref|ZP_04622212.1| C4-dicarboxylate transport protein [Yersinia kristensenii ATCC
           33638]
 gi|238761488|ref|ZP_04622464.1| C4-dicarboxylate transport protein [Yersinia kristensenii ATCC
           33638]
 gi|238700462|gb|EEP93203.1| C4-dicarboxylate transport protein [Yersinia kristensenii ATCC
           33638]
 gi|238700715|gb|EEP93455.1| C4-dicarboxylate transport protein [Yersinia kristensenii ATCC
           33638]
          Length = 479

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 49  MKASIFKSLYFQVLTAITLGVLLGHFYPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 108

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 109 IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 168

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 169 AEQASQQGIVPFLLDIIPSSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQIIFNVIES 228

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++MR+APLGAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 229 FARVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCVLFVVVVLGS 288

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 289 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPCMLDKMEKAGCKKSVVGLVIPTGYSF 348

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 349 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 408

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 409 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQAVLS 463


>gi|167035221|ref|YP_001670452.1| C4-dicarboxylate transporter DctA [Pseudomonas putida GB-1]
 gi|189082865|sp|B0KTL9|DCTA_PSEPG RecName: Full=C4-dicarboxylate transport protein
 gi|166861709|gb|ABZ00117.1| sodium:dicarboxylate symporter [Pseudomonas putida GB-1]
          Length = 440

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 201/415 (48%), Positives = 302/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY+QV++AI  G+ LGH+ P+ GV ++PLGD FVK  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYVQVIIAITIGILLGHYYPETGVALKPLGDGFVKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ KPG GM++D+ +LN  S+A  
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALIIGLVVVNVVKPGAGMHIDVSTLNASSVAAY 122

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ ++LFG +L  +G     +   ++ 
Sbjct: 123 AAAGAQQTTVGFLLNVIPNTVVGAFANGDILQVLMFSVLFGFALHRLGSYGKPLLDMIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGQYGVGSLVQLGYLMACFYITCLLFVLVVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K++D       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKEMDNDKLASELA 417


>gi|226305315|ref|YP_002765273.1| C4-dicarboxylate transport protein [Rhodococcus erythropolis PR4]
 gi|226184430|dbj|BAH32534.1| C4-dicarboxylate transport protein [Rhodococcus erythropolis PR4]
          Length = 468

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 161/421 (38%), Positives = 264/421 (62%), Gaps = 6/421 (1%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +PP Y+ L++Q++ AI  G+ +G   P+ G  ++PL D F+K  KMLI P+IF TV  GI
Sbjct: 18  KPPWYRSLFVQLIAAIVIGVLIGWLWPEFGANLKPLADGFIKLIKMLIAPIIFCTVVIGI 77

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL---NTESIA 128
           A + D+K +G+I  KA+  F V + FAL+ GL++GN+ KPG G N+D ++L        A
Sbjct: 78  AHVGDLKAVGRIGVKALIYFEVVTTFALLFGLLIGNLMKPGAGFNIDPETLANGADAVAA 137

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT-IRKCL 187
              S      + F+ ++IP + +SA     +LQ L  A+LFG++L+  GE     + + +
Sbjct: 138 KTGSGELPHTVEFLLNIIPVSIVSAFAENALLQVLFFAVLFGLALAKAGESGPPIVFELV 197

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + ++   F ++  +MR+APLGA GAM++ +G+YG++S+ +   L+   Y  +  FIL + 
Sbjct: 198 DRLSHLFFTIIGWIMRLAPLGALGAMAYIVGQYGIASLGSYGKLIAACYLAAVLFILILA 257

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
            I+  F   ++ K + ++K+E+ L L T+S+E  LP +M K+  AGC R+   +VVPTGY
Sbjct: 258 AIVRYFAGVNLWKFVKYIKDELFLALGTASTEVVLPRIMVKLTNAGCSRTTTGLVVPTGY 317

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+ +Y+++  LF++QA  V L+L +Q++ +L+ M++SKG AGV GS+F+ L+AT+
Sbjct: 318 SFNLDGATLYLSICMLFLAQALGVDLTLGEQITAVLVLMLTSKGMAGVPGSSFLALSATV 377

Query: 368 TLV--PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
             +   ++P+A + L+LG DR M   R   N +GN V T VV+ WE +LD +   + +  
Sbjct: 378 AAIGHGAIPVAAVALLLGADRIMDSMRVSVNLLGNCVATFVVANWEGQLDKERMRRVLDG 437

Query: 426 E 426
           E
Sbjct: 438 E 438


>gi|319653505|ref|ZP_08007604.1| DAACS family dicarboxylate/amino acid:cation symporter [Bacillus
           sp. 2_A_57_CT2]
 gi|317394704|gb|EFV75443.1| DAACS family dicarboxylate/amino acid:cation symporter [Bacillus
           sp. 2_A_57_CT2]
          Length = 429

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 181/415 (43%), Positives = 275/415 (66%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             +  +YK L  QVL AIF G+ +G   P++G +M+P+GD F+   KM+I P+IFLT+  
Sbjct: 1   MKKQRIYKNLTFQVLTAIFIGVMVGLIWPEVGKEMKPVGDTFINAVKMVIAPIIFLTIVL 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA+M DMK +G++  KA   F V +  AL+IGLIV N+ KPG G+N +       S   
Sbjct: 61  GIAKMGDMKKVGKVGGKAFIYFEVVTTLALMIGLIVVNVIKPGAGLNFNELEKGDVSQYT 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
                  ++I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK   + + L++
Sbjct: 121 ANGGEGINWIEFVTHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKIVIEFLDK 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   F+++  VM+ APLGAFGAM++TIG +GL+S+  L  L+  +Y T   FI  VL I
Sbjct: 181 LSLVFFKIIGYVMKAAPLGAFGAMAYTIGHFGLASLVPLGKLMISVYVTMFLFIFVVLNI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + +   FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSF
Sbjct: 241 ICKMYGFSLWNYLKFIKDEILIVLGTSSSESVLPRMMDKMERIGCSKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+++A +F++Q   V L++  Q+++LL+ M++SKGAAGVTGS FI LA+T+  
Sbjct: 301 NLDGTSIYLSMAVVFLAQVFGVDLTIGQQVTILLVLMLTSKGAAGVTGSGFIVLASTLAA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +  +P+ G+ L+LGVDRFMSE R++ N IGN + T+VV++ E + D     K I 
Sbjct: 361 LQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATMVVAKSENEFDENKAKKAIS 415


>gi|238902617|ref|YP_002928413.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli BW2952]
 gi|259645141|sp|C4ZW75|DCTA_ECOBW RecName: Full=C4-dicarboxylate transport protein
 gi|238860099|gb|ACR62097.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli BW2952]
          Length = 428

 Score =  286 bits (731), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTIAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|291482854|dbj|BAI83929.1| C4-dicarboxylate transporter [Bacillus subtilis subsp. natto
           BEST195]
          Length = 421

 Score =  286 bits (731), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 172/413 (41%), Positives = 268/413 (64%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L +QV+ A+  G+ +G   P +G +M+PLGD F+   KM+I P+IF T+  GIA
Sbjct: 1   MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V +  AL+IGL V NI KPG G++         S      
Sbjct: 61  KMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNG 120

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK  ++    ++++ 
Sbjct: 121 GQGIDWIEFVTHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKVSH 180

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F+   L I+ +
Sbjct: 181 VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNIICK 240

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 241 LYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 300

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++AT+F++Q   V LS+  Q++++L+ M++SKGAAGVTGS FI LA+T++ +  
Sbjct: 301 GTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQV 360

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D     + +  
Sbjct: 361 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAKSVEAVEG 413


>gi|215488805|ref|YP_002331236.1| C4-dicarboxylate transporter DctA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|254767176|sp|B7UL81|DCTA_ECO27 RecName: Full=C4-dicarboxylate transport protein
 gi|215266877|emb|CAS11318.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli O127:H6 str. E2348/69]
          Length = 428

 Score =  285 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPTTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|296160388|ref|ZP_06843205.1| sodium:dicarboxylate symporter [Burkholderia sp. Ch1-1]
 gi|295889369|gb|EFG69170.1| sodium:dicarboxylate symporter [Burkholderia sp. Ch1-1]
          Length = 426

 Score =  285 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 216/417 (51%), Positives = 311/417 (74%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P++K+LY+QV+ AI  G+ALGHF P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPIHKVLYVQVIAAIIVGIALGHFYPDLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GLI  ++ KPG+G N+D  +L+ +++A  
Sbjct: 61  IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGVGFNIDPATLDGKAVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IPDT +SA   G ILQ L++ALLFG  L+  GEK   +   ++ 
Sbjct: 121 AAKAHGQSSVEFLMHIIPDTLVSAFAQGEILQILLIALLFGAVLATAGEKGKVVTSFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F +V I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ L+   Y TS  F++ VLGI
Sbjct: 181 LSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSVVFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I++ + ++KEE+L+VL TSSSE+ALP LM K+E  GC RS+V +VVPTGYSF
Sbjct: 241 IARAVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLERLGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  L+ T QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    N  +  +
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRSKLNAALRGD 417


>gi|16131400|ref|NP_417985.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli str. K-12 substr. MG1655]
 gi|26250162|ref|NP_756202.1| C4-dicarboxylate transporter DctA [Escherichia coli CFT073]
 gi|74314218|ref|YP_312637.1| C4-dicarboxylate transporter DctA [Shigella sonnei Ss046]
 gi|82545892|ref|YP_409839.1| C4-dicarboxylate transporter DctA [Shigella boydii Sb227]
 gi|89110485|ref|AP_004265.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli str. K-12 substr. W3110]
 gi|91213034|ref|YP_543020.1| C4-dicarboxylate transporter DctA [Escherichia coli UTI89]
 gi|110643775|ref|YP_671505.1| C4-dicarboxylate transporter DctA [Escherichia coli 536]
 gi|110807376|ref|YP_690896.1| C4-dicarboxylate transporter DctA [Shigella flexneri 5 str. 8401]
 gi|117625811|ref|YP_859134.1| C4-dicarboxylate transporter DctA [Escherichia coli APEC O1]
 gi|157156520|ref|YP_001464998.1| C4-dicarboxylate transporter DctA [Escherichia coli E24377A]
 gi|157163007|ref|YP_001460325.1| C4-dicarboxylate transporter DctA [Escherichia coli HS]
 gi|170018243|ref|YP_001723197.1| C4-dicarboxylate transporter DctA [Escherichia coli ATCC 8739]
 gi|170682606|ref|YP_001745802.1| C4-dicarboxylate transporter DctA [Escherichia coli SMS-3-5]
 gi|187731486|ref|YP_001882218.1| C4-dicarboxylate transporter DctA [Shigella boydii CDC 3083-94]
 gi|188492864|ref|ZP_03000134.1| aerobic C4-dicarboxylate transport protein [Escherichia coli 53638]
 gi|191165247|ref|ZP_03027090.1| aerobic C4-dicarboxylate transport protein [Escherichia coli B7A]
 gi|191170555|ref|ZP_03032108.1| aerobic C4-dicarboxylate transport protein [Escherichia coli F11]
 gi|193061681|ref|ZP_03042778.1| aerobic C4-dicarboxylate transport protein [Escherichia coli E22]
 gi|193068511|ref|ZP_03049473.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           E110019]
 gi|194428653|ref|ZP_03061190.1| aerobic C4-dicarboxylate transport protein [Escherichia coli B171]
 gi|194431105|ref|ZP_03063398.1| aerobic C4-dicarboxylate transport protein [Shigella dysenteriae
           1012]
 gi|194435941|ref|ZP_03068044.1| aerobic C4-dicarboxylate transport protein [Escherichia coli 101-1]
 gi|209920988|ref|YP_002295072.1| C4-dicarboxylate transporter DctA [Escherichia coli SE11]
 gi|218550802|ref|YP_002384593.1| C4-dicarboxylate transporter DctA [Escherichia fergusonii ATCC
           35469]
 gi|218556079|ref|YP_002388992.1| C4-dicarboxylate transporter DctA [Escherichia coli IAI1]
 gi|218560604|ref|YP_002393517.1| C4-dicarboxylate transporter DctA [Escherichia coli S88]
 gi|218691812|ref|YP_002400024.1| C4-dicarboxylate transporter DctA [Escherichia coli ED1a]
 gi|218697238|ref|YP_002404905.1| C4-dicarboxylate transporter DctA [Escherichia coli 55989]
 gi|218702293|ref|YP_002409922.1| C4-dicarboxylate transporter DctA [Escherichia coli IAI39]
 gi|218707162|ref|YP_002414681.1| C4-dicarboxylate transporter DctA [Escherichia coli UMN026]
 gi|227883689|ref|ZP_04001494.1| C4-dicarboxylate transporter DctA [Escherichia coli 83972]
 gi|237703298|ref|ZP_04533779.1| aerobic C4-dicarboxylate transporter [Escherichia sp. 3_2_53FAA]
 gi|254038707|ref|ZP_04872763.1| aerobic C4-dicarboxylate transporter [Escherichia sp. 1_1_43]
 gi|256020875|ref|ZP_05434740.1| C4-dicarboxylate transporter DctA [Shigella sp. D9]
 gi|256025747|ref|ZP_05439612.1| C4-dicarboxylate transporter DctA [Escherichia sp. 4_1_40B]
 gi|260846317|ref|YP_003224095.1| C4-dicarboxylic acid, orotate and citrate transporter DctA
           [Escherichia coli O103:H2 str. 12009]
 gi|260857632|ref|YP_003231523.1| C4-dicarboxylic acid, orotate and citrate transporter DctA
           [Escherichia coli O26:H11 str. 11368]
 gi|260870254|ref|YP_003236656.1| C4-dicarboxylic acid, orotate and citrate transporter DctA
           [Escherichia coli O111:H- str. 11128]
 gi|291284900|ref|YP_003501718.1| C4-dicarboxylate transport protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|293407151|ref|ZP_06651075.1| C4-dicarboxylate transporter DctA [Escherichia coli FVEC1412]
 gi|293412959|ref|ZP_06655627.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293416973|ref|ZP_06659610.1| C4-dicarboxylate transporter [Escherichia coli B185]
 gi|293453833|ref|ZP_06664252.1| C4-dicarboxylate transporter [Escherichia coli B088]
 gi|298382900|ref|ZP_06992495.1| C4-dicarboxylate transporter [Escherichia coli FVEC1302]
 gi|300815256|ref|ZP_07095481.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           107-1]
 gi|300822076|ref|ZP_07102219.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           119-7]
 gi|300897295|ref|ZP_07115731.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           198-1]
 gi|300907576|ref|ZP_07125212.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           84-1]
 gi|300922353|ref|ZP_07138475.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           182-1]
 gi|300927977|ref|ZP_07143534.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           187-1]
 gi|300950865|ref|ZP_07164747.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           116-1]
 gi|300955011|ref|ZP_07167421.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           175-1]
 gi|300971348|ref|ZP_07171417.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           45-1]
 gi|300976748|ref|ZP_07173567.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           200-1]
 gi|301025863|ref|ZP_07189351.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           69-1]
 gi|301046597|ref|ZP_07193737.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           185-1]
 gi|301306691|ref|ZP_07212748.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           124-1]
 gi|301326677|ref|ZP_07220001.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           78-1]
 gi|301646048|ref|ZP_07245953.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           146-1]
 gi|306816120|ref|ZP_07450258.1| C4-dicarboxylate transporter DctA [Escherichia coli NC101]
 gi|307140217|ref|ZP_07499573.1| C4-dicarboxylate transporter DctA [Escherichia coli H736]
 gi|307314344|ref|ZP_07593951.1| sodium:dicarboxylate symporter [Escherichia coli W]
 gi|309796166|ref|ZP_07690577.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           145-7]
 gi|331644237|ref|ZP_08345366.1| aerobic C4-dicarboxylate transport protein [Escherichia coli H736]
 gi|331649349|ref|ZP_08350435.1| aerobic C4-dicarboxylate transport protein [Escherichia coli M605]
 gi|331655154|ref|ZP_08356153.1| aerobic C4-dicarboxylate transport protein [Escherichia coli M718]
 gi|331659836|ref|ZP_08360774.1| aerobic C4-dicarboxylate transport protein [Escherichia coli TA206]
 gi|331665149|ref|ZP_08366050.1| aerobic C4-dicarboxylate transport protein [Escherichia coli TA143]
 gi|331670360|ref|ZP_08371199.1| aerobic C4-dicarboxylate transport protein [Escherichia coli TA271]
 gi|331679605|ref|ZP_08380275.1| aerobic C4-dicarboxylate transport protein [Escherichia coli H591]
 gi|331685184|ref|ZP_08385770.1| aerobic C4-dicarboxylate transport protein [Escherichia coli H299]
 gi|332282089|ref|ZP_08394502.1| aerobic C4-dicarboxylate transporter [Shigella sp. D9]
 gi|67462316|sp|P0A830|DCTA_ECOLI RecName: Full=Aerobic C4-dicarboxylate transport protein
 gi|67462317|sp|P0A831|DCTA_ECOL6 RecName: Full=Aerobic C4-dicarboxylate transport protein
 gi|122421981|sp|Q1R575|DCTA_ECOUT RecName: Full=C4-dicarboxylate transport protein
 gi|123146574|sp|Q0SZC4|DCTA_SHIF8 RecName: Full=C4-dicarboxylate transport protein
 gi|123343497|sp|Q0TBS5|DCTA_ECOL5 RecName: Full=C4-dicarboxylate transport protein
 gi|123558376|sp|Q31V97|DCTA_SHIBS RecName: Full=C4-dicarboxylate transport protein
 gi|123615774|sp|Q3YVR0|DCTA_SHISS RecName: Full=C4-dicarboxylate transport protein
 gi|167012298|sp|A7ZT69|DCTA_ECO24 RecName: Full=C4-dicarboxylate transport protein
 gi|167012299|sp|A8A5Y8|DCTA_ECOHS RecName: Full=C4-dicarboxylate transport protein
 gi|167012300|sp|A1AH70|DCTA_ECOK1 RecName: Full=C4-dicarboxylate transport protein
 gi|189082863|sp|B1J0A5|DCTA_ECOLC RecName: Full=C4-dicarboxylate transport protein
 gi|226723831|sp|B7MEN1|DCTA_ECO45 RecName: Full=C4-dicarboxylate transport protein
 gi|226723833|sp|B7NNG2|DCTA_ECO7I RecName: Full=C4-dicarboxylate transport protein
 gi|226723834|sp|B7M3E0|DCTA_ECO8A RecName: Full=C4-dicarboxylate transport protein
 gi|226723835|sp|B7NEH6|DCTA_ECOLU RecName: Full=C4-dicarboxylate transport protein
 gi|226723836|sp|B6I394|DCTA_ECOSE RecName: Full=C4-dicarboxylate transport protein
 gi|226723837|sp|B1LJ76|DCTA_ECOSM RecName: Full=C4-dicarboxylate transport protein
 gi|226723839|sp|B7LT01|DCTA_ESCF3 RecName: Full=C4-dicarboxylate transport protein
 gi|226723853|sp|B2U4J7|DCTA_SHIB3 RecName: Full=C4-dicarboxylate transport protein
 gi|254767566|sp|B7L612|DCTA_ECO55 RecName: Full=C4-dicarboxylate transport protein
 gi|254767685|sp|B7N1W8|DCTA_ECO81 RecName: Full=C4-dicarboxylate transport protein
 gi|26110591|gb|AAN82776.1|AE016768_194 Aerobic C4-dicarboxylate transport protein [Escherichia coli
           CFT073]
 gi|466666|gb|AAB18505.1| CG site No. 872 [Escherichia coli str. K-12 substr. MG1655]
 gi|1789947|gb|AAC76553.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli str. K-12 substr. MG1655]
 gi|73857695|gb|AAZ90402.1| uptake of C4-dicarboxylic acids [Shigella sonnei Ss046]
 gi|81247303|gb|ABB68011.1| uptake of C4-dicarboxylic acids [Shigella boydii Sb227]
 gi|85676516|dbj|BAE77766.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli str. K12 substr. W3110]
 gi|91074608|gb|ABE09489.1| DctA [Escherichia coli UTI89]
 gi|110345367|gb|ABG71604.1| aerobic C4-dicarboxylate transport protein [Escherichia coli 536]
 gi|110616924|gb|ABF05591.1| uptake of C4-dicarboxylic acids [Shigella flexneri 5 str. 8401]
 gi|115514935|gb|ABJ03010.1| C4-dicarboxylate transport protein [Escherichia coli APEC O1]
 gi|157068687|gb|ABV07942.1| aerobic C4-dicarboxylate transport protein [Escherichia coli HS]
 gi|157078550|gb|ABV18258.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           E24377A]
 gi|169753171|gb|ACA75870.1| sodium:dicarboxylate symporter [Escherichia coli ATCC 8739]
 gi|170520324|gb|ACB18502.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           SMS-3-5]
 gi|187428478|gb|ACD07752.1| aerobic C4-dicarboxylate transport protein [Shigella boydii CDC
           3083-94]
 gi|188488063|gb|EDU63166.1| aerobic C4-dicarboxylate transport protein [Escherichia coli 53638]
 gi|190904649|gb|EDV64355.1| aerobic C4-dicarboxylate transport protein [Escherichia coli B7A]
 gi|190909363|gb|EDV68949.1| aerobic C4-dicarboxylate transport protein [Escherichia coli F11]
 gi|192932471|gb|EDV85068.1| aerobic C4-dicarboxylate transport protein [Escherichia coli E22]
 gi|192958162|gb|EDV88603.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           E110019]
 gi|194413236|gb|EDX29521.1| aerobic C4-dicarboxylate transport protein [Escherichia coli B171]
 gi|194420560|gb|EDX36636.1| aerobic C4-dicarboxylate transport protein [Shigella dysenteriae
           1012]
 gi|194425484|gb|EDX41468.1| aerobic C4-dicarboxylate transport protein [Escherichia coli 101-1]
 gi|209755438|gb|ACI76031.1| uptake of C4-dicarboxylic acids [Escherichia coli]
 gi|209755444|gb|ACI76034.1| uptake of C4-dicarboxylic acids [Escherichia coli]
 gi|209914247|dbj|BAG79321.1| C4-dicarboxylate transport protein [Escherichia coli SE11]
 gi|218353970|emb|CAV00434.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli 55989]
 gi|218358343|emb|CAQ90990.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           fergusonii ATCC 35469]
 gi|218362847|emb|CAR00477.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli IAI1]
 gi|218367373|emb|CAR05152.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli S88]
 gi|218372279|emb|CAR20142.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli IAI39]
 gi|218429376|emb|CAR10338.2| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli ED1a]
 gi|218434259|emb|CAR15177.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli UMN026]
 gi|222035238|emb|CAP77983.1| aerobic C4-dicarboxylate transport protein [Escherichia coli LF82]
 gi|226839213|gb|EEH71236.1| aerobic C4-dicarboxylate transporter [Escherichia sp. 1_1_43]
 gi|226902562|gb|EEH88821.1| aerobic C4-dicarboxylate transporter [Escherichia sp. 3_2_53FAA]
 gi|227839269|gb|EEJ49735.1| C4-dicarboxylate transporter DctA [Escherichia coli 83972]
 gi|257756281|dbj|BAI27783.1| C4-dicarboxylic acid, orotate and citrate transporter DctA
           [Escherichia coli O26:H11 str. 11368]
 gi|257761464|dbj|BAI32961.1| C4-dicarboxylic acid, orotate and citrate transporter DctA
           [Escherichia coli O103:H2 str. 12009]
 gi|257766610|dbj|BAI38105.1| C4-dicarboxylic acid, orotate and citrate transporter DctA
           [Escherichia coli O111:H- str. 11128]
 gi|260447457|gb|ACX37879.1| sodium:dicarboxylate symporter [Escherichia coli DH1]
 gi|281180566|dbj|BAI56896.1| C4-dicarboxylate transport protein [Escherichia coli SE15]
 gi|284923558|emb|CBG36653.1| C4-dicarboxylate transport protein [Escherichia coli 042]
 gi|290764773|gb|ADD58734.1| C4-dicarboxylate transport protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|291321959|gb|EFE61390.1| C4-dicarboxylate transporter [Escherichia coli B088]
 gi|291425962|gb|EFE98996.1| C4-dicarboxylate transporter DctA [Escherichia coli FVEC1412]
 gi|291431549|gb|EFF04534.1| C4-dicarboxylate transporter [Escherichia coli B185]
 gi|291468606|gb|EFF11099.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490523|gb|ADE89279.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           IHE3034]
 gi|298276736|gb|EFI18254.1| C4-dicarboxylate transporter [Escherichia coli FVEC1302]
 gi|300301435|gb|EFJ57820.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           185-1]
 gi|300308485|gb|EFJ63005.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           200-1]
 gi|300318053|gb|EFJ67837.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           175-1]
 gi|300358943|gb|EFJ74813.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           198-1]
 gi|300395792|gb|EFJ79330.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           69-1]
 gi|300400693|gb|EFJ84231.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           84-1]
 gi|300411272|gb|EFJ94810.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           45-1]
 gi|300421293|gb|EFK04604.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           182-1]
 gi|300449841|gb|EFK13461.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           116-1]
 gi|300463984|gb|EFK27477.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           187-1]
 gi|300525439|gb|EFK46508.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           119-7]
 gi|300532148|gb|EFK53210.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           107-1]
 gi|300838084|gb|EFK65844.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           124-1]
 gi|300846652|gb|EFK74412.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           78-1]
 gi|301075719|gb|EFK90525.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           146-1]
 gi|305850516|gb|EFM50973.1| C4-dicarboxylate transporter DctA [Escherichia coli NC101]
 gi|306906059|gb|EFN36579.1| sodium:dicarboxylate symporter [Escherichia coli W]
 gi|307555631|gb|ADN48406.1| citrate and C4-dicarboxylic acids transport protein [Escherichia
           coli ABU 83972]
 gi|307628607|gb|ADN72911.1| C4-dicarboxylate transporter DctA [Escherichia coli UM146]
 gi|308120227|gb|EFO57489.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           145-7]
 gi|309703934|emb|CBJ03275.1| C4-dicarboxylate transport protein [Escherichia coli ETEC H10407]
 gi|312948087|gb|ADR28914.1| C4-dicarboxylate transporter DctA [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315062807|gb|ADT77134.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli W]
 gi|315138104|dbj|BAJ45263.1| C4-dicarboxylate transport protein [Escherichia coli DH1]
 gi|315254053|gb|EFU34021.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           85-1]
 gi|315286201|gb|EFU45637.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           110-3]
 gi|315295427|gb|EFU54757.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           153-1]
 gi|315295813|gb|EFU55130.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           16-3]
 gi|320173078|gb|EFW48297.1| Aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Shigella dysenteriae CDC 74-1112]
 gi|320639844|gb|EFX09438.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H7 str.
           G5101]
 gi|320645344|gb|EFX14360.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H- str.
           493-89]
 gi|320650655|gb|EFX19121.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H- str. H
           2687]
 gi|320655849|gb|EFX23772.1| C4-dicarboxylate transporter DctA [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661631|gb|EFX29046.1| C4-dicarboxylate transporter DctA [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666654|gb|EFX33637.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323160576|gb|EFZ46517.1| C4-dicarboxylate transport protein [Escherichia coli E128010]
 gi|323182680|gb|EFZ68082.1| C4-dicarboxylate transport protein [Escherichia coli 1357]
 gi|323376605|gb|ADX48873.1| sodium:dicarboxylate symporter [Escherichia coli KO11]
 gi|323934690|gb|EGB31080.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           E1520]
 gi|323939492|gb|EGB35701.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           E482]
 gi|323944501|gb|EGB40573.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           H120]
 gi|323949769|gb|EGB45653.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           H252]
 gi|323954930|gb|EGB50710.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           H263]
 gi|323959459|gb|EGB55116.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           H489]
 gi|323966047|gb|EGB61487.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           M863]
 gi|323975063|gb|EGB70172.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           TW10509]
 gi|324007318|gb|EGB76537.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           57-2]
 gi|324014179|gb|EGB83398.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           60-1]
 gi|324021169|gb|EGB90388.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           117-3]
 gi|324111857|gb|EGC05837.1| Sodium:dicarboxylate symporter family protein [Escherichia
           fergusonii B253]
 gi|324116601|gb|EGC10518.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           E1167]
 gi|325499084|gb|EGC96943.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           fergusonii ECD227]
 gi|331036531|gb|EGI08757.1| aerobic C4-dicarboxylate transport protein [Escherichia coli H736]
 gi|331041847|gb|EGI13991.1| aerobic C4-dicarboxylate transport protein [Escherichia coli M605]
 gi|331047169|gb|EGI19247.1| aerobic C4-dicarboxylate transport protein [Escherichia coli M718]
 gi|331053051|gb|EGI25084.1| aerobic C4-dicarboxylate transport protein [Escherichia coli TA206]
 gi|331057659|gb|EGI29645.1| aerobic C4-dicarboxylate transport protein [Escherichia coli TA143]
 gi|331062422|gb|EGI34342.1| aerobic C4-dicarboxylate transport protein [Escherichia coli TA271]
 gi|331072777|gb|EGI44102.1| aerobic C4-dicarboxylate transport protein [Escherichia coli H591]
 gi|331077555|gb|EGI48767.1| aerobic C4-dicarboxylate transport protein [Escherichia coli H299]
 gi|332089480|gb|EGI94584.1| C4-dicarboxylate transport protein [Shigella boydii 3594-74]
 gi|332104441|gb|EGJ07787.1| aerobic C4-dicarboxylate transporter [Shigella sp. D9]
          Length = 428

 Score =  285 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|294625371|ref|ZP_06704005.1| C4-dicarboxylate transport protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666580|ref|ZP_06731820.1| C4-dicarboxylate transport protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600324|gb|EFF44427.1| C4-dicarboxylate transport protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292603655|gb|EFF47066.1| C4-dicarboxylate transport protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 457

 Score =  285 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 237/423 (56%), Positives = 312/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GLIV ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMAYFLFFSTLALVVGLIVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG+++R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGLVSRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLKLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|311071116|ref|YP_003976039.1| C4-dicarboxylate transporter DctA [Bacillus atrophaeus 1942]
 gi|310871633|gb|ADP35108.1| C4-dicarboxylate transporter DctA [Bacillus atrophaeus 1942]
          Length = 424

 Score =  285 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 175/405 (43%), Positives = 266/405 (65%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
            L+K L +QV+ A+  G+ +G   P +G +M+PLGD F+   KM+I P+IF T+  GIA+
Sbjct: 5   KLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIAK 64

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSS 133
           M DMK +G++  KA   F V +  AL+IGL V NI KPG G++         S       
Sbjct: 65  MGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGEGLDYSKLEKGDVSQYTANGG 124

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
               +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK  ++    ++I+  
Sbjct: 125 QGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKISHV 184

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
            F+++  +MR APLGAFGAM++TIG +GL SI  L  L+  +Y T   F+  VL I+ + 
Sbjct: 185 FFKIIGYIMRAAPLGAFGAMAYTIGHFGLDSIKPLASLMLSVYITMFLFVFVVLNIICKI 244

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
             FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLDG
Sbjct: 245 FGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLDG 304

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           ++IY+++AT+F++Q   V LS+  Q++++L+ M++SKGAAGVTGS FI LA+T+  +  +
Sbjct: 305 TSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLAALQVI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
           P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D   
Sbjct: 365 PLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAK 409


>gi|167835279|ref|ZP_02462162.1| C4-dicarboxylate transporter DctA [Burkholderia thailandensis
           MSMB43]
          Length = 428

 Score =  285 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 217/411 (52%), Positives = 308/411 (74%), Gaps = 1/411 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P YK+LY+QV+ AI  G+ LGH+ P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPFYKVLYVQVIFAIVVGVILGHYYPSLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   +I +PG+G N+D  +LN + +A  
Sbjct: 61  IAGMQDMKKVGRVGGKALLYFEIVSTFALVLGLAATHILRPGVGFNIDPATLNGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   + + ++ 
Sbjct: 121 AAKAHGQSTVDFLMHIIPNTMIDAFAQGEILQILLIALLFGSVLAHLGERGRVVTEFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +   +F +V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG 
Sbjct: 181 VTRVLFGIVHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSII+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSF
Sbjct: 241 IARFTGFSIIRFVGYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFN 420
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAKLR 411


>gi|296116753|ref|ZP_06835360.1| C4-dicarboxylate transport protein [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976675|gb|EFG83446.1| C4-dicarboxylate transport protein [Gluconacetobacter hansenii ATCC
           23769]
          Length = 445

 Score =  285 bits (730), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 227/419 (54%), Positives = 312/419 (74%), Gaps = 1/419 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
               R  L++ LY QV+VA+ +G+A+GHF P  G  ++PLGD F++  KM+I PVIFLTV
Sbjct: 8   TAPKRRSLFRSLYFQVIVAVVAGIAVGHFWPHAGTALRPLGDGFIRLVKMIIPPVIFLTV 67

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
            TG+A + D+   G++  KAM  F  FS  ALV+G++V NI +PG G++ DL +L+T+S+
Sbjct: 68  VTGVAGLSDLGKAGRLAGKAMVYFLTFSTLALVVGMLVANIVRPGAGVHADLSTLDTQSV 127

Query: 128 AH-IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
           A  +  + A SF GFM ++IPDT LSA  SG+ILQ L++A+LF ISLS +G +   +   
Sbjct: 128 AAFVARAQAHSFSGFMLNIIPDTVLSAFVSGDILQVLLIAILFSISLSHMGARGHAVLSL 187

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
            +++   VF +V +VM  AP+GAFGAM+FTIG++G+ S+ +L FLV   YATSA FI+ V
Sbjct: 188 FKQLTELVFGVVRLVMLAAPVGAFGAMAFTIGRFGIGSVLDLAFLVATFYATSALFIIVV 247

Query: 247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTG 306
           LG++AR+  F I+ L+ +L+EE+L+VL TSSSESALP LM KME AGC  S+V +VVP G
Sbjct: 248 LGLVARYNGFRILPLLAYLREELLIVLGTSSSESALPTLMTKMENAGCAPSVVGLVVPMG 307

Query: 307 YSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAAT 366
           YSFNLDG+NIY++L+ LFI+QAT V L L  Q+SLLL+AM+SSKGAAGVTG+ F+TLAAT
Sbjct: 308 YSFNLDGTNIYMSLSALFIAQATGVHLDLGQQVSLLLVAMISSKGAAGVTGAGFVTLAAT 367

Query: 367 ITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           + +VP +P++GM LILG+DRFMSECRS+TN IGNAV T+V++RWE +LD K  +  +  
Sbjct: 368 LAVVPDVPVSGMALILGIDRFMSECRSLTNIIGNAVATLVLARWENELDTKRLHAALSG 426


>gi|229185820|ref|ZP_04312994.1| C4-dicarboxylate transport protein [Bacillus cereus BGSC 6E1]
 gi|228597657|gb|EEK55303.1| C4-dicarboxylate transport protein [Bacillus cereus BGSC 6E1]
          Length = 431

 Score =  285 bits (730), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 177/422 (41%), Positives = 279/422 (66%), Gaps = 1/422 (0%)

Query: 3   ESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
           E ++  G  +  + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+
Sbjct: 2   EEMKNRGVSKMRIIKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPI 61

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IFLT+  GIA M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++      
Sbjct: 62  IFLTIVLGIASMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK- 120

Query: 123 NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
             +   +++S     ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    
Sbjct: 121 GGDVSQYVQSGQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQP 180

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +    E ++   F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F
Sbjct: 181 VIDFFERLSKVFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALF 240

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +  VL  + +  +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V
Sbjct: 241 VFIVLNFICKLYKFSLWKYLSHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLV 300

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +PTGYSFNLDG+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI 
Sbjct: 301 IPTGYSFNLDGTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIV 360

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LA+T++ +  +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + 
Sbjct: 361 LASTLSAMNVIPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMRV 420

Query: 423 IG 424
           + 
Sbjct: 421 LE 422


>gi|260549431|ref|ZP_05823650.1| membrane-associated dicarboxylate transporter [Acinetobacter sp.
           RUH2624]
 gi|260407540|gb|EEX01014.1| membrane-associated dicarboxylate transporter [Acinetobacter sp.
           RUH2624]
          Length = 432

 Score =  285 bits (730), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 226/414 (54%), Positives = 316/414 (76%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ +GHF P++G  ++PLGD F+K  KM+I PVIFLTV TGI
Sbjct: 14  KQKFHQILYVQVIFAIILGVLIGHFYPELGQSLKPLGDAFIKIVKMIIAPVIFLTVVTGI 73

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +M  +G++  KAM  F  FS  ALV+G+IV NI +PG G+N+D  +L ++ +  ++
Sbjct: 74  ASMTNMSRVGRVTGKAMLYFITFSSLALVVGMIVANIIQPGKGLNIDPATLVSDKVNTYV 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +HA +   F  ++IP T +S L  G ILQ L VA+LFGISL+ +G+++  I   L  +
Sbjct: 134 EKAHATNITDFFMNIIPQTLVSPLAGGEILQVLFVAVLFGISLAALGDRARPITDFLNNL 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             PVF +V ++M++AP+GAFGAM+FTIG YG+ SI NL+ L+   Y T+  F+L VLG +
Sbjct: 194 TAPVFYLVGMLMKLAPIGAFGAMAFTIGAYGIESIGNLLLLIMTFYITAVLFVLIVLGAV 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSII LI ++K+E+ LVL TSSSE+ALP LM KM++AGC +S+V +V+PTGYSFN
Sbjct: 254 ARYNGFSIIALIRYIKDELWLVLGTSSSEAALPSLMDKMQKAGCEKSVVGLVIPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA NV LS+++QL+LLL+AMVSSKGAAGVTG+ FITLAAT+++V
Sbjct: 314 LDGTNIYMTMAALFIAQACNVDLSISEQLALLLVAMVSSKGAAGVTGAGFITLAATLSVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           PS+P+AGM LILG+DRFMSECR++TN IGNA  T+VV+RW+K LD  + +K +G
Sbjct: 374 PSVPVAGMALILGIDRFMSECRALTNLIGNACATIVVARWDKALDKDVLDKALG 427


>gi|312962577|ref|ZP_07777067.1| C4-dicarboxylate transport protein [Pseudomonas fluorescens WH6]
 gi|311283157|gb|EFQ61748.1| C4-dicarboxylate transport protein [Pseudomonas fluorescens WH6]
          Length = 443

 Score =  285 bits (730), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 197/415 (47%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY QV+VAI  G+ LGHF PQ GV ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYFQVIVAIVIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ +PG GM++D+ +L+   +A +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGAGMHIDVATLDASKVAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GA GAM+FTIG YG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCILFVVVVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV T+VV++W K+LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDTDKLQSELA 417


>gi|15804072|ref|NP_290108.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H7 EDL933]
 gi|15833662|ref|NP_312435.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H7 str.
           Sakai]
 gi|168746933|ref|ZP_02771955.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|168753341|ref|ZP_02778348.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|168759612|ref|ZP_02784619.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|168765936|ref|ZP_02790943.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|168772517|ref|ZP_02797524.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|168779672|ref|ZP_02804679.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4076]
 gi|168785394|ref|ZP_02810401.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC869]
 gi|168797359|ref|ZP_02822366.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC508]
 gi|195935056|ref|ZP_03080438.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H7 str.
           EC4024]
 gi|208808853|ref|ZP_03251190.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4206]
 gi|208812319|ref|ZP_03253648.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4045]
 gi|208821503|ref|ZP_03261823.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4042]
 gi|209398499|ref|YP_002273008.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4115]
 gi|217324355|ref|ZP_03440439.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. TW14588]
 gi|254795481|ref|YP_003080318.1| C4-dicarboxylate transporter DctA [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224843|ref|ZP_05939124.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261254260|ref|ZP_05946793.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli O157:H7 str. FRIK966]
 gi|20137786|sp|Q8X5M2|DCTA_ECO57 RecName: Full=Aerobic C4-dicarboxylate transport protein
 gi|226723832|sp|B5YVH5|DCTA_ECO5E RecName: Full=C4-dicarboxylate transport protein
 gi|12518243|gb|AAG58669.1|AE005578_6 uptake of C4-dicarboxylic acids [Escherichia coli O157:H7 str.
           EDL933]
 gi|13363882|dbj|BAB37831.1| uptake of C4-dicarboxylic acids [Escherichia coli O157:H7 str.
           Sakai]
 gi|187771526|gb|EDU35370.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4196]
 gi|188018313|gb|EDU56435.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4113]
 gi|189002303|gb|EDU71289.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4076]
 gi|189359209|gb|EDU77628.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4401]
 gi|189364655|gb|EDU83074.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4486]
 gi|189369818|gb|EDU88234.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4501]
 gi|189374468|gb|EDU92884.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC869]
 gi|189380170|gb|EDU98586.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC508]
 gi|208728654|gb|EDZ78255.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4206]
 gi|208733596|gb|EDZ82283.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4045]
 gi|208741626|gb|EDZ89308.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4042]
 gi|209159899|gb|ACI37332.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. EC4115]
 gi|209755440|gb|ACI76032.1| uptake of C4-dicarboxylic acids [Escherichia coli]
 gi|209755442|gb|ACI76033.1| uptake of C4-dicarboxylic acids [Escherichia coli]
 gi|209755446|gb|ACI76035.1| uptake of C4-dicarboxylic acids [Escherichia coli]
 gi|217320576|gb|EEC29000.1| aerobic C4-dicarboxylate transport protein [Escherichia coli
           O157:H7 str. TW14588]
 gi|254594881|gb|ACT74242.1| C4-dicarboxylic acid, orotate and citrate transporter [Escherichia
           coli O157:H7 str. TW14359]
          Length = 428

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDALN 415


>gi|291326460|ref|ZP_06124608.2| aerobic C4-dicarboxylate transport protein [Providencia rettgeri
           DSM 1131]
 gi|291314300|gb|EFE54753.1| aerobic C4-dicarboxylate transport protein [Providencia rettgeri
           DSM 1131]
          Length = 448

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 234/411 (56%), Positives = 325/411 (79%), Gaps = 1/411 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            I+ P+YKILY+QV+VAI  G+ALGHF P IG  ++PLGD F+K  KM+I PVIFLTV T
Sbjct: 1   MIKQPIYKILYVQVIVAIVLGIALGHFFPDIGESLKPLGDAFIKIVKMIIAPVIFLTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GI+ M +MK +G +  KAM  F  FS  AL+IGLI+ NI +PG G+N+D  +L++  +A 
Sbjct: 61  GISGMSNMKAVGSVAGKAMLYFITFSTIALIIGLIIANIIRPGSGLNIDPATLDSTKVAT 120

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           +++ +H  S +GF+ ++IPDT +S L +GNILQ L +A++FG++L+  G+  + I K L+
Sbjct: 121 YVEKAHESSIVGFLMNIIPDTVISPLVNGNILQVLFIAVIFGLALAATGKHGEPIVKLLQ 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
             + PVF+MV+++M++AP+GAFGAM+FTIGKYG+SSI NL+ L+   Y TS  F+L VLG
Sbjct: 181 NFSEPVFKMVAMLMKLAPIGAFGAMAFTIGKYGISSIGNLMMLIMTFYITSVLFVLLVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +A++  FSII LI ++K+E+ LVL TSSSE+ALP LM+KME AGC +S+V +V+PTGYS
Sbjct: 241 AVAKYNGFSIIALIKYIKDELWLVLGTSSSEAALPSLMRKMEHAGCEKSVVGLVIPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+A LFI+QATN+ L++ +Q+SLLL+AM+SSKGAAGVTG+ FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTMAALFIAQATNIELTIWEQISLLLVAMISSKGAAGVTGAGFITLAATLM 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           +VPS+P+AGM LILG+DRFMSECR++TN +GNA   +VV+RWEK+LD +  
Sbjct: 361 VVPSIPVAGMALILGIDRFMSECRALTNLVGNACACIVVARWEKELDTEKL 411


>gi|321314120|ref|YP_004206407.1| C4-dicarboxylate transporter DctA [Bacillus subtilis BSn5]
 gi|320020394|gb|ADV95380.1| C4-dicarboxylate transporter DctA [Bacillus subtilis BSn5]
          Length = 421

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 171/413 (41%), Positives = 268/413 (64%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L +QV+ A+  G+ +G   P +G +M+PLGD F+   KM+I P+IF T+  GIA
Sbjct: 1   MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F + +  AL+IGL V NI KPG G++         S      
Sbjct: 61  KMGDMKKVGKVGGKAFIYFEIVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNG 120

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK  ++    ++++ 
Sbjct: 121 GQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKVSH 180

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F+   L I+ +
Sbjct: 181 VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNIICK 240

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 241 LYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 300

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++AT+F++Q   V LS+  Q++++L+ M++SKGAAGVTGS FI LA+T++ +  
Sbjct: 301 GTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQV 360

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D     + +  
Sbjct: 361 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAKSVEAVEG 413


>gi|296332813|ref|ZP_06875273.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305673159|ref|YP_003864831.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296150093|gb|EFG90982.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305411403|gb|ADM36522.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 421

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 172/413 (41%), Positives = 268/413 (64%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L +QV+ A+  G+ +G   P +G +M+PLGD F+   KM+I P+IF T+  GIA
Sbjct: 1   MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V +  AL+IGL V NI KPG G++         S      
Sbjct: 61  KMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNG 120

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK  ++    ++I+ 
Sbjct: 121 GQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKISH 180

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F+   L ++ +
Sbjct: 181 VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNLICK 240

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 241 LYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 300

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++AT+F++Q   V LS+  Q++++L+ M++SKGAAGVTGS FI LA+T++ +  
Sbjct: 301 GTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQV 360

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D     + +  
Sbjct: 361 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAKSIEAVEG 413


>gi|222082531|ref|YP_002541896.1| C4-dicarboxylate transporter protein [Agrobacterium radiobacter
           K84]
 gi|221727210|gb|ACM30299.1| C4-dicarboxylate transporter protein [Agrobacterium radiobacter
           K84]
          Length = 443

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 234/416 (56%), Positives = 320/416 (76%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P Y+ LY+QVL AI +G+ LGH+ PQ+G  +QPLGD F+K  +M+I PVIFLTV+TG
Sbjct: 13  VKLPFYRHLYVQVLTAIAAGILLGHYYPQLGTSLQPLGDAFIKLVRMVIAPVIFLTVTTG 72

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M D+K  G++  KA   F  FS  AL++GLIV N+ +PG GM+++  +L+T++++ +
Sbjct: 73  IAGMSDLKKFGRVVGKAFIYFLTFSTLALIVGLIVSNVVQPGAGMHINPATLDTKAVSNY 132

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +H  S +GF+ ++IPDT + A   G+ILQ L  +++FGI+L  VG++   +   L+ 
Sbjct: 133 AAQAHDASVVGFLMNIIPDTIVGAFAKGDILQVLFFSVVFGIALGAVGDRGRPVVDFLQA 192

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +  P+FRMVSI+M+ AP+GAFGAM+FTIGKYG+ +I+NL FL+   Y TS FF+L VLG 
Sbjct: 193 LTTPIFRMVSILMKFAPIGAFGAMAFTIGKYGIGTIANLAFLIGTFYLTSIFFVLVVLGA 252

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME AGC RS+V +V+PTGYSF
Sbjct: 253 VARYNGFSILALIRYIKEELLLVLGTSSSEAALPGLMNKMERAGCKRSVVGLVIPTGYSF 312

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLA LFI+QAT+  LS  DQ+ LLL+AM+SSKGAAG+TG+ FITLAAT+ +
Sbjct: 313 NLDGTNIYMTLAALFIAQATDTSLSFGDQILLLLVAMLSSKGAAGITGAGFITLAATLAV 372

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VPS+PIAGM LILG+DRFMSECR++TNF+GNAV T+VV+RWE +LD   F   +  
Sbjct: 373 VPSVPIAGMALILGIDRFMSECRALTNFVGNAVATIVVARWENELDQTKFAAAMAG 428


>gi|16077514|ref|NP_388328.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221308267|ref|ZP_03590114.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312589|ref|ZP_03594394.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317513|ref|ZP_03598807.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321789|ref|ZP_03603083.1| C4-dicarboxylate transporter DctA [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|20137770|sp|P96603|DCTA_BACSU RecName: Full=C4-dicarboxylate transport protein; AltName:
           Full=C4-dicarboxylate permease
 gi|1881257|dbj|BAA19284.1| ydbH [Bacillus subtilis]
 gi|2632747|emb|CAB12254.1| C4-dicarboxylate transport protein [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 421

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 172/413 (41%), Positives = 268/413 (64%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L +QV+ A+  G+ +G   P +G +M+PLGD F+   KM+I P+IF T+  GIA
Sbjct: 1   MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V +  AL+IGL V NI KPG G++         S      
Sbjct: 61  KMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNG 120

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK  ++    ++++ 
Sbjct: 121 GQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKVSH 180

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F+   L I+ +
Sbjct: 181 VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNIICK 240

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 241 LYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 300

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++AT+F++Q   V LS+  Q++++L+ M++SKGAAGVTGS FI LA+T++ +  
Sbjct: 301 GTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQV 360

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D     + +  
Sbjct: 361 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAKSIEAVEG 413


>gi|49478283|ref|YP_037668.1| C4-dicarboxylate transporter DctA [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|49329839|gb|AAT60485.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
          Length = 438

 Score =  285 bits (729), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 178/422 (42%), Positives = 279/422 (66%), Gaps = 1/422 (0%)

Query: 3   ESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
           E  +  G ++  + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+
Sbjct: 9   EKRKNKGVLKMRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPI 68

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IFLT+  GIA M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++      
Sbjct: 69  IFLTIVLGIASMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK- 127

Query: 123 NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
             +   +++S     ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    
Sbjct: 128 GGDVSQYVQSGQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQP 187

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +    E ++   F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F
Sbjct: 188 VIDFFERLSKVFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALF 247

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +  VL  + +  +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V
Sbjct: 248 VFIVLNFICKLYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLV 307

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +PTGYSFNLDG+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI 
Sbjct: 308 IPTGYSFNLDGTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIV 367

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LA+T++ +  +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K 
Sbjct: 368 LASTLSAMNVIPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKV 427

Query: 423 IG 424
           + 
Sbjct: 428 LE 429


>gi|226361718|ref|YP_002779496.1| C4-dicarboxylate transport protein [Rhodococcus opacus B4]
 gi|226240203|dbj|BAH50551.1| C4-dicarboxylate transport protein [Rhodococcus opacus B4]
          Length = 477

 Score =  285 bits (729), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 160/427 (37%), Positives = 260/427 (60%), Gaps = 2/427 (0%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           M E        +   Y+ L++QVL+ I  G+A G   P+    + PLG+ F+K  KM++ 
Sbjct: 1   MSEVEIAAKPKKQRWYRSLFVQVLIGIALGIATGILFPEFSHHLAPLGEGFIKLIKMVVA 60

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           P+IFL + TGIA++  MK +G+I  KA+  F   + FAL +GL+VGN+  PG G+N+D  
Sbjct: 61  PLIFLVIVTGIAKVGSMKALGKIGGKALLWFTAATTFALGLGLLVGNLVHPGSGLNIDPA 120

Query: 121 SLNTESI-AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
           +L+T ++    +  H    + F+  +IP +   A    N+LQ L+ ++LFG++L+   E 
Sbjct: 121 TLDTSALDEKTQGGHLPGGVEFVMHIIPTSVFDAFAQNNLLQVLLFSILFGVALASFSES 180

Query: 180 SDTI-RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYAT 238
           +  +    +++    +FR+V  +M +AP+GAFGAM+FT+G YG  S+ +   L+   Y  
Sbjct: 181 APPVLMDVIDQALHVIFRIVGYIMYLAPIGAFGAMAFTVGNYGAGSLKSFGMLILACYGA 240

Query: 239 SAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSI 298
           +  FI+ +  ++      +  K I + +EE +L L T SSE+ +P ++KK++ AGC R++
Sbjct: 241 ALVFIVVLSIVVKLITGVNAWKFIKYCREEFMLALGTGSSEAVMPRIIKKLDNAGCDRAV 300

Query: 299 VSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGS 358
           V +V+PTGYSFNLDG+ IY++LA +F++QA  V LS  +Q++++ I ++SSKG AGV GS
Sbjct: 301 VGLVIPTGYSFNLDGAAIYLSLAMMFLAQAVGVDLSFGEQIAIMGILILSSKGMAGVPGS 360

Query: 359 AFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
           AF+ L+AT   + + P+A + L+LG DR M   R  TN +GN + T VV+ WE  LD + 
Sbjct: 361 AFVALSATAAAIGAFPVAAVALLLGADRLMDSMRVFTNLLGNCMATFVVANWEGLLDKEK 420

Query: 419 FNKYIGI 425
               +  
Sbjct: 421 MRAVLDG 427


>gi|160898364|ref|YP_001563946.1| sodium:dicarboxylate symporter [Delftia acidovorans SPH-1]
 gi|226723830|sp|A9BZG1|DCTA_DELAS RecName: Full=C4-dicarboxylate transport protein
 gi|160363948|gb|ABX35561.1| sodium:dicarboxylate symporter [Delftia acidovorans SPH-1]
          Length = 442

 Score =  285 bits (729), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 237/423 (56%), Positives = 310/423 (73%), Gaps = 1/423 (0%)

Query: 5   VQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIF 64
                  R P Y+ LY QV+VAI +G+ LGHF PQ   Q +PLGD F+K  KM+I PVIF
Sbjct: 6   THAASPERLPFYRQLYFQVVVAIVAGVLLGHFEPQYAEQFKPLGDAFIKLVKMIIAPVIF 65

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
           LT+ TGIA M  ++ +G++F KAM  F  FS  ALV+G++V ++ +PG GMN++   L+ 
Sbjct: 66  LTIVTGIAGMTHLRTVGRVFLKAMAYFLFFSTLALVVGMVVAHVVQPGAGMNINPADLDQ 125

Query: 125 ESI-AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTI 183
            ++  ++  SH  +  GF  D+IP T +S     NILQ L VA+LFGISL++VG+    +
Sbjct: 126 AAVKGYVAKSHELTLTGFAMDIIPKTLVSPFVGDNILQVLFVAVLFGISLAMVGDAGKPV 185

Query: 184 RKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFI 243
              LE +  PVF++V I+M+ APLGAFGA++FTIGK+GL S+ NL +LV   Y TS  F+
Sbjct: 186 LNFLEALTAPVFKLVGILMKAAPLGAFGAIAFTIGKFGLGSLVNLAWLVGSFYITSLLFV 245

Query: 244 LGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVV 303
           + VLG +AR C FS++KL  +LK E+LLVL TSSSESALP LM+KME AGC +S+V +VV
Sbjct: 246 VVVLGFVARLCGFSVLKLARYLKAELLLVLGTSSSESALPSLMQKMERAGCGKSVVGLVV 305

Query: 304 PTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITL 363
           PTGYSFNLDG+NIY+TLA LFI+QATN  L+L  +++LLL+AM+SSKGAAGVTG+ FITL
Sbjct: 306 PTGYSFNLDGTNIYMTLAALFIAQATNTHLTLGHEIALLLVAMLSSKGAAGVTGAGFITL 365

Query: 364 AATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           AAT+ +VP +P+AGM LILGVDRFMSECRS+TNF+GNAV TVVVSRWE +LD    N  +
Sbjct: 366 AATLAVVPEVPVAGMALILGVDRFMSECRSLTNFMGNAVATVVVSRWENELDYSKLNAAL 425

Query: 424 GIE 426
             E
Sbjct: 426 DGE 428


>gi|117921800|ref|YP_870992.1| sodium:dicarboxylate symporter [Shewanella sp. ANA-3]
 gi|117614132|gb|ABK49586.1| sodium:dicarboxylate symporter [Shewanella sp. ANA-3]
          Length = 440

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 124/407 (30%), Positives = 227/407 (55%), Gaps = 9/407 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+ V +  G+A+G  + +    ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIFVGMVLGIAVGVSLGEQASYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMEDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG + +PG G+ +       +  A   +    S 
Sbjct: 81  KMGRIGFKSFAFYLCTTAIAISLGLAVGYVVQPGAGVPL------LQHEAVQTAKEVPSV 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++AL SG ILQ ++ A+  GI+L L+G+      K  E +   ++++ 
Sbjct: 135 MQTLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG   I+ R F + +
Sbjct: 195 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            +     +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PLHFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D L+++L A ++S G AGV G+  + L   ++ V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD + +N  +
Sbjct: 374 GVALIAGIDRILDMARTVVNVSGDLVATTVIAKSEDELDVEHYNADM 420


>gi|294012923|ref|YP_003546383.1| dicarboxylate/amino acid:cation (Na+ or H+) symporter [Sphingobium
           japonicum UT26S]
 gi|292676253|dbj|BAI97771.1| dicarboxylate/amino acid:cation (Na+ or H+) symporter [Sphingobium
           japonicum UT26S]
          Length = 444

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 240/421 (57%), Positives = 324/421 (76%), Gaps = 2/421 (0%)

Query: 8   HGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTV 67
              +R P Y+ LY+QVL+AI +G+A+GHF P+ GV +QPLG+ F+K  KM+I PVIFLT+
Sbjct: 10  QPIVRLPFYRQLYVQVLIAIAAGVAIGHFFPETGVALQPLGEAFIKLVKMIIAPVIFLTI 69

Query: 68  STGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI 127
            TG+A MK++  IG++  KA   F  FS  AL++GLIV N+  PG G+N+D  +L+   +
Sbjct: 70  VTGVAGMKELGAIGRVAAKAFAYFLTFSTLALIVGLIVANVVHPGAGLNIDPATLDVGKV 129

Query: 128 AHIKS-SHAKSFIGFMQDMIPDTALSALTSG-NILQTLIVALLFGISLSLVGEKSDTIRK 185
           A  +  +H ++  GF+ D+IP T +SA+  G NILQ L VA+LFGI+L+++GE++D +  
Sbjct: 130 AQYQQQAHDRTLTGFLLDIIPGTLVSAVADGHNILQVLFVAILFGIALTMIGERADPLMT 189

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            LE  +  +F++VS +M+ APLGAFGAM+FTIGKYG+ +++NL  LV   Y TS  F+L 
Sbjct: 190 VLESASHAIFKLVSFLMKAAPLGAFGAMAFTIGKYGVGALANLAGLVATFYLTSILFVLV 249

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG++AR   F+I+ LI +L+ E+LLVL TSSSE+ALP L++KME AGC +S+V +VVPT
Sbjct: 250 VLGLVARLAGFNILHLIRYLRAELLLVLGTSSSEAALPSLIEKMERAGCRKSVVGLVVPT 309

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+TLA LFI+QATNV LSL +Q+ LLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 310 GYSFNLDGTNIYMTLAALFIAQATNVHLSLEEQMLLLLVAMLSSKGAAGVTGAGFITLAA 369

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           T+++VPS+P+AGMTLILGVDRFMSECRS+TNFIGNAV TVVVS WEK LD + F   +  
Sbjct: 370 TLSIVPSVPVAGMTLILGVDRFMSECRSLTNFIGNAVATVVVSAWEKGLDRERFAAAMAG 429

Query: 426 E 426
           +
Sbjct: 430 Q 430


>gi|154684949|ref|YP_001420110.1| C4-dicarboxylate transporter DctA [Bacillus amyloliquefaciens
           FZB42]
 gi|154350800|gb|ABS72879.1| DctP [Bacillus amyloliquefaciens FZB42]
          Length = 418

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 172/406 (42%), Positives = 268/406 (66%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             ++K L +QV+ A+  G+ +G   P+ G QM+PLGD F+   KM+I P+IFLT+  GIA
Sbjct: 1   MKIFKNLTVQVITAVIIGVIVGLVWPEAGKQMKPLGDTFINAVKMIIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V +  AL+IGL+V NI KPG G++         S      
Sbjct: 61  KMGDMKKVGKVGGKAFIYFEVVTTIALIIGLLVVNIMKPGEGLDYSKLEKGDVSQYTQNG 120

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GE+  +I    ++++ 
Sbjct: 121 GQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSVLFGVGLAALGERGKSIIDFFDKLSH 180

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F+   L I+ +
Sbjct: 181 VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMLSVYVTMFLFVFVALNIICK 240

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 241 LFGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 300

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++AT+F++Q   V L++  Q++++L+ M++SKGAAGVTGS FI LA+T++ +  
Sbjct: 301 GTSIYLSMATVFLAQVFGVDLTIGQQVTIILVLMLTSKGAAGVTGSGFIVLASTLSALQV 360

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
           +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D   
Sbjct: 361 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAK 406


>gi|330828707|ref|YP_004391659.1| C4-dicarboxylate transport protein [Aeromonas veronii B565]
 gi|328803843|gb|AEB49042.1| C4-dicarboxylate transport protein [Aeromonas veronii B565]
          Length = 426

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 215/416 (51%), Positives = 300/416 (72%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R  L+  LY QVL+AI  G+ LGH  P++G  M+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MRKKLFSSLYFQVLLAITLGVFLGHVYPELGADMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M+ MK +G+    A+  F V S  AL+IGL V N+ +PG GMNVD  +L+  +I A+
Sbjct: 61  IAGMESMKAVGKTGAIALLYFEVVSTIALIIGLCVVNLLQPGAGMNVDPAALDASAISAY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + ++  I F+ D+IP + + A  SGNILQ L+ A+LFG SL  +GEK   I   ++ 
Sbjct: 121 AEQAKSQGIIAFLLDIIPGSVIGAFASGNILQVLLFAVLFGFSLHHIGEKGQVIFGVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T  FFI  VLG 
Sbjct: 181 FSKVIFGIINMIMRLAPVGAFGAMAFTIGKYGVGSLVQLGQLIACFYLTCLFFIFIVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI++ I +++EE+L+VL TSSSES LP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKASGFSILRFISYIREELLIVLGTSSSESVLPRMLDKMEKLGCQKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN PL L  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAIFIAQATNTPLDLFQQITLLVVLLISSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV+++ K+LD K  +  +G 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLIGNGVATVVVAKYCKQLDEKKMDAVLGG 416


>gi|253771641|ref|YP_003034472.1| C4-dicarboxylate transporter DctA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163450|ref|YP_003046558.1| C4-dicarboxylate transporter DctA [Escherichia coli B str. REL606]
 gi|242379046|emb|CAQ33846.1| DctA dicarboxylate DAACS transporter [Escherichia coli BL21(DE3)]
 gi|253322685|gb|ACT27287.1| sodium:dicarboxylate symporter [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975351|gb|ACT41022.1| C4-dicarboxylate transport protein [Escherichia coli B str. REL606]
 gi|253979507|gb|ACT45177.1| C4-dicarboxylate transport protein [Escherichia coli BL21(DE3)]
 gi|299889226|dbj|BAJ10322.1| aerobic dicarboxylate transpoter [Escherichia coli BL21(DE3)]
          Length = 428

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVFLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|229592119|ref|YP_002874238.1| C4-dicarboxylate transporter DctA [Pseudomonas fluorescens SBW25]
 gi|259645145|sp|C3K0P6|DCTA_PSEFS RecName: Full=C4-dicarboxylate transport protein
 gi|229363985|emb|CAY51526.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Pseudomonas fluorescens SBW25]
          Length = 443

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 198/415 (47%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ LGHF P+ GV ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILLGHFYPETGVALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG GM++D+ +L+   +A +
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTVALLIGLIVVNVVQPGAGMHIDVATLDASKVAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GA GAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCLLFVLVVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS+IKLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVIKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV T+VV++W K+LD       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDTDKLQSELA 417


>gi|24114796|ref|NP_709306.1| C4-dicarboxylate transporter DctA [Shigella flexneri 2a str. 301]
 gi|30065190|ref|NP_839361.1| C4-dicarboxylate transporter DctA [Shigella flexneri 2a str. 2457T]
 gi|81724073|sp|Q83PS4|DCTA_SHIFL RecName: Full=C4-dicarboxylate transport protein
 gi|24054022|gb|AAN45013.1| C4-dicarboxylate transport protein [Shigella flexneri 2a str. 301]
 gi|30043452|gb|AAP19172.1| C4-dicarboxylate transport protein [Shigella flexneri 2a str.
           2457T]
 gi|281602885|gb|ADA75869.1| Aerobic C4-dicarboxylate transport protein [Shigella flexneri
           2002017]
          Length = 428

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GA GAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGALGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|114048749|ref|YP_739299.1| sodium:dicarboxylate symporter [Shewanella sp. MR-7]
 gi|113890191|gb|ABI44242.1| sodium:dicarboxylate symporter [Shewanella sp. MR-7]
          Length = 440

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 124/407 (30%), Positives = 227/407 (55%), Gaps = 9/407 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+ V +  G+A+G  + +    ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIFVGMVLGIAVGVSLGEQASYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMEDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG + +PG G+ +       +  A   +    S 
Sbjct: 81  KMGRIGFKSFAFYLCTTAIAISLGLAVGYVVQPGAGVPL------LQHEAVQTAKEVPSV 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++AL SG ILQ ++ A+  GI+L L+G+      K  E +   ++++ 
Sbjct: 135 MQTLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG   I+ R F + +
Sbjct: 195 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            +     +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PLHFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D L+++L A ++S G AGV G+  + L   ++ V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD + +N  +
Sbjct: 374 GVALIAGIDRILDMARTVVNVSGDLVATTVIAKSEDELDVEHYNADM 420


>gi|296533116|ref|ZP_06895749.1| aerobic C4-dicarboxylate transporter [Roseomonas cervicalis ATCC
           49957]
 gi|296266544|gb|EFH12536.1| aerobic C4-dicarboxylate transporter [Roseomonas cervicalis ATCC
           49957]
          Length = 450

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 225/414 (54%), Positives = 314/414 (75%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y+ LY+QVL AI +G+ LGHF PQ G  M+PLGD F+K  KM+I PVIFLTV TGIA
Sbjct: 15  KRFYQHLYVQVLAAIAAGILLGHFYPQTGADMKPLGDAFIKLVKMVIAPVIFLTVVTGIA 74

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIK 131
            ++D+  +G++  KAM  F VFS  AL+IGL+ GN+ +PG G+N+D  +L+  +++ +  
Sbjct: 75  GVRDLGKVGRVAGKAMLYFLVFSTLALIIGLVTGNVIRPGAGLNIDPATLDAAAVSGYAA 134

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H  +  GF+ ++IP + +SA  SG+ILQ L  ++L GI+L+ VGEK++ + K     +
Sbjct: 135 KAHETTITGFLMNVIPASPVSAFASGDILQVLFFSVLLGIALAAVGEKAEPLMKLFHSAS 194

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +F++V+I+M+ AP+GAFGAM+FTIGKYG+ SI+NL  L+   Y TS  F+L VLG +A
Sbjct: 195 AGMFKLVAILMKAAPVGAFGAMAFTIGKYGIGSIANLAMLIATFYLTSLLFVLVVLGAVA 254

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FSI+ L+ ++KEE+LLVL TSSSE+ALP LM+KME AG  +S+V +VVPTGYSFNL
Sbjct: 255 RYNGFSILALVRYIKEELLLVLGTSSSEAALPTLMEKMERAGAAKSVVGLVVPTGYSFNL 314

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+T+A LFI+QA  + LSL DQL LLL+AM+SSKGAAG+TG+ FITLAAT+++VP
Sbjct: 315 DGTNIYMTMAALFIAQACGIELSLWDQLLLLLVAMLSSKGAAGITGAGFITLAATLSVVP 374

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           S+P+AGM LILG+DRFMSECR++TN +GNAV T+VV+RWE +LD +  +  +  
Sbjct: 375 SVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWEGELDRERLDAAMAG 428


>gi|330985530|gb|EGH83633.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 447

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 197/415 (47%), Positives = 294/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+ G  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPETGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ ++A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ S++   S
Sbjct: 62  RMENMKELGRVGFRALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSSLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IPDT + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPDTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTIGKYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG  IY T+A +FI+QATN PL+LTDQL +L++ M +SKG+AGVTGS FI LAAT+  + 
Sbjct: 302 DGQAIYYTIAAIFIAQATNTPLTLTDQLIVLVVLMFTSKGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++TN IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|170720386|ref|YP_001748074.1| C4-dicarboxylate transporter DctA [Pseudomonas putida W619]
 gi|169758389|gb|ACA71705.1| sodium:dicarboxylate symporter [Pseudomonas putida W619]
          Length = 440

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 202/415 (48%), Positives = 303/415 (73%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY+QV+VAI  G+ LGHF P+ GV ++PLGD FVK  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYVQVIVAITIGILLGHFYPETGVALKPLGDGFVKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M++MK +G+    A+  F + S  AL+IGL+V N+ KPG GM++D+ +LN  S+A  
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALIIGLVVVNVVKPGAGMHIDVSTLNASSVAAY 122

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 AAAGAQQTTVGFLLNIIPNTVVGAFANGDILQVLMFSVIFGFALHRLGSYGKPLLDLIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPVGAFGAMAFTIGQYGVGSLVQLGYLMACFYITCLLFVLVVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K++D       + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKEMDNDKLASELA 417


>gi|300936723|ref|ZP_07151622.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           21-1]
 gi|300458155|gb|EFK21648.1| aerobic C4-dicarboxylate transport protein [Escherichia coli MS
           21-1]
          Length = 428

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN + T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGIATIVVAKWVKELDHKKLDDVLN 415


>gi|257487618|ref|ZP_05641659.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331013101|gb|EGH93157.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 447

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 196/415 (47%), Positives = 294/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+ G  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPETGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ ++A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ +++   S
Sbjct: 62  RMENMKELGRVGFRALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSTLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IPDT + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPDTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTIGKYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG  IY T+A +FI+QATN PL+LTDQL +L++ M +SKG+AGVTGS FI LAAT+  + 
Sbjct: 302 DGQAIYYTIAAIFIAQATNTPLTLTDQLIVLVVLMFTSKGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++TN IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|228994172|ref|ZP_04154072.1| C4-dicarboxylate transport protein [Bacillus pseudomycoides DSM
           12442]
 gi|228765624|gb|EEM14278.1| C4-dicarboxylate transport protein [Bacillus pseudomycoides DSM
           12442]
          Length = 431

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 275/412 (66%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L  QVL AI  G+ +G   P +G +M+P+GD F+   KM+I P+IFLT+  GIA
Sbjct: 8   KRLFKNLTFQVLTAIALGVLVGLMWPNVGKEMKPIGDTFINAVKMVIAPIIFLTIVLGIA 67

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V + FAL++GLIV N+ KPG G+N +  +    S      
Sbjct: 68  KMGDMKKVGKVGGKAFIYFEVVTTFALIVGLIVVNVMKPGSGLNFNELAKGDVSKYTQGG 127

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
               ++I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK +++   L++++ 
Sbjct: 128 GQGINWIDFVTHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGNSVIDFLDKLSH 187

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  VM+ APLGAFGAM++TIG +GL+S+  L  L+  +Y T   F+  VL I+ +
Sbjct: 188 VFFKIIGYVMKAAPLGAFGAMAYTIGHFGLASLVPLGKLMMSVYITMFLFVFVVLNIICK 247

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+++E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 248 IYGFSLWNYLKFIRDEILIVLGTSSSESVLPRMMNKMERYGCSKSVVGLVIPTGYSFNLD 307

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++A +F++Q   V L++  Q++++L+ M++SKGAAGVTGS FI LA+T+  +  
Sbjct: 308 GTSIYLSMAVVFLAQVFGVDLTIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLAALKV 367

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + T+VV++ E + D     + I 
Sbjct: 368 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIVVAKSENEFDEMRHAEAIS 419


>gi|300721885|ref|YP_003711163.1| citrate and C4-dicarboxylic acids transport protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297628380|emb|CBJ88945.1| citrate and C4-dicarboxylic acids transport protein (DAACS family)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 425

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 234/414 (56%), Positives = 324/414 (78%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + PLYKILYIQV+ AI  G+ALGHF P IG  ++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 7   KRPLYKILYIQVIFAILLGIALGHFYPDIGESLKPLGDAFIKIVKMIIAPVIFLTVATGI 66

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M +MK +G +  K+M  F  FS  ALV+GLIV NI +PG G+N+  ++L++  +  ++
Sbjct: 67  AGMNNMKAVGNVIGKSMLYFLTFSTLALVVGLIVANIIRPGDGLNISPETLDSSKVIGYV 126

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H  S +GF+ ++IP+T +S L +GNILQ L V+++FGI+L+  G+K + I   L+  
Sbjct: 127 EKAHQSSIVGFLMNIIPETVVSPLVNGNILQVLFVSVIFGIALAATGKKGEPIFVFLQNF 186

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           + PVF+MVSI+M++AP+GAFGAM+FTIGKYG+SSI NL+ L+   Y T+  F+  +LG +
Sbjct: 187 SDPVFKMVSILMKLAPIGAFGAMAFTIGKYGISSIGNLMMLIATFYITALLFVFIILGAV 246

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           A++  FSIIKLI ++K+E+ LVL TSSSE+ALP LMKKME AGC +S+V +V+PTGYSFN
Sbjct: 247 AKYNGFSIIKLIKYIKDELWLVLGTSSSEAALPSLMKKMENAGCEKSVVGLVIPTGYSFN 306

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QAT + LS+T+Q+SLLL+AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 307 LDGTNIYMTMAALFIAQATGIELSITEQISLLLVAMISSKGAAGVTGAGFITLAATLSVV 366

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           PS+P+AGM LILG+DRFMSECR++TN +GNA   +VV+RWE  LD +   + + 
Sbjct: 367 PSVPVAGMALILGIDRFMSECRALTNLVGNACACIVVARWEDALDKEEMYQALN 420


>gi|325915312|ref|ZP_08177632.1| Na+/H+ dicarboxylate symporter [Xanthomonas vesicatoria ATCC 35937]
 gi|325538505|gb|EGD10181.1| Na+/H+ dicarboxylate symporter [Xanthomonas vesicatoria ATCC 35937]
          Length = 457

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 237/423 (56%), Positives = 311/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GLIV ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMAYFLFFSTLALVVGLIVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQIVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG++ R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGVVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLTLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|16519987|ref|NP_444107.1| C4-dicarboxylate transporter DctA [Sinorhizobium fredii NGR234]
 gi|1486443|emb|CAA92421.1| C4-dicarboxylate transporter [Rhizobium sp.]
 gi|2182674|gb|AAB91894.1| C4-dicarboxylate transport protein DctA1 [Sinorhizobium fredii
           NGR234]
          Length = 504

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 231/415 (55%), Positives = 319/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY+QVL AI  G+ LG+F P +G +M+PLGD F+   KM+I PVIFLTV+TGI
Sbjct: 27  KTPHYRHLYVQVLAAIAVGILLGYFYPDVGSKMKPLGDAFIMLVKMIIAPVIFLTVATGI 86

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+  +G++  KAM  F  FS  AL++GL+V N+ +PG GM++D  SL+ ++IA + 
Sbjct: 87  AGMTDLAKVGRVAGKAMIYFLTFSTLALLVGLVVANVVQPGAGMHIDPASLDAKAIATYA 146

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L  +
Sbjct: 147 EKAHEQSVTGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKKAEAVVDFLHAL 206

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 207 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGVASIANLAMLIGTFYLTSFLFVFMVLGAV 266

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 267 ARYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 326

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+ P+S  DQ+ LLLIAM+SSKGAAG+TG+ FITLAAT++ V
Sbjct: 327 LDGTNIYMTLAALFIAQATDTPISYGDQILLLLIAMLSSKGAAGITGAGFITLAATLSAV 386

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILG+DRFMSECR++TN IGNAV T+VV++WE +L P      +  
Sbjct: 387 PSVPVAGMALILGIDRFMSECRAITNIIGNAVATIVVAKWEGELAPAQLATTLAG 441


>gi|293604467|ref|ZP_06686872.1| aerobic C4-dicarboxylate transporter [Achromobacter piechaudii ATCC
           43553]
 gi|292817048|gb|EFF76124.1| aerobic C4-dicarboxylate transporter [Achromobacter piechaudii ATCC
           43553]
          Length = 450

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 230/416 (55%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +   ++ILY+QV+ AI  G+ LG F P++G QMQPLGD F+K  KM+I PVIFLTV++GI
Sbjct: 12  KLKFHQILYVQVIFAIVIGVLLGAFKPELGQQMQPLGDAFIKLVKMIIAPVIFLTVASGI 71

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-I 130
           A M D+K +G++  KAM  F  FS  AL+IG+IV +I +PG GM++D  +L+ +++A+ +
Sbjct: 72  AAMSDLKKVGRVAGKAMLYFLTFSTLALIIGMIVSHIVQPGAGMHIDPSTLDQKAVANFV 131

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +H  +  GF+ ++IP T  S    G+ILQ L VA+LFGI+L++VGE+   I   +  +
Sbjct: 132 AKAHDSTITGFLMNIIPTTIFSPFVGGDILQVLFVAVLFGIALAMVGERGKPILNFMTAL 191

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++V+I+M+ AP+GAFGAM+FTIGKYG+ S+ NL  LV   YATS  F++ VLG++
Sbjct: 192 AQPIFKLVAILMKAAPIGAFGAMAFTIGKYGIKSVVNLAMLVGTFYATSVLFVVVVLGLV 251

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+KL+ +++EE+LLVL TSSSE+ALP LM+KME AGC +S+V +VVPTGYSFN
Sbjct: 252 ARYNGFSILKLVRYIREELLLVLGTSSSEAALPTLMQKMERAGCSKSVVGLVVPTGYSFN 311

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+T+A LFI+QA ++PLSL DQ+ LL +AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 312 LDGTNIYMTMAALFIAQACDIPLSLGDQILLLAVAMLSSKGAAGVTGAGFITLAATLSVV 371

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           PS+PIAGMTLILGVDRFMSECR++TN +GNA   VVV+RWE +LD +  +  +  +
Sbjct: 372 PSVPIAGMTLILGVDRFMSECRALTNLVGNATAAVVVARWEGELDQEQLHAALDGQ 427


>gi|257485921|ref|ZP_05639962.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331013473|gb|EGH93529.1| C4-dicarboxylate transporter DctA [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 452

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 200/417 (47%), Positives = 296/417 (70%), Gaps = 3/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P+YK LY QV+VAI  G+ +GHF P  G  ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPIYKSLYFQVIVAIVIGILIGHFYPDTGKALKPLGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D+ +L+   IA +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLIVVNVVQPGAGMNIDVSTLDASKIAAY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           + +   +S +GF+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 VTAGQDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGSYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRI--APLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
               +F +++++M +  AP+GAFGAM+FTIG YG+SS+  L  L+ C Y T A F++ VL
Sbjct: 183 FAHVMFNIINMIMIMKLAPIGAFGAMAFTIGAYGVSSLVQLGQLMICFYITCALFVVLVL 242

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G + R   FSI KL+ +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGY
Sbjct: 243 GAICRAHGFSIFKLVRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGY 302

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG++IY+T+A +FI+QATN  + +T Q++LLL+ ++SSKGAAGVTGS FI LAAT+
Sbjct: 303 SFNLDGTSIYLTMAAVFIAQATNTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATL 362

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           + V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W  +LD       + 
Sbjct: 363 SAVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVGELDTDKLQSELA 419


>gi|190575785|ref|YP_001973630.1| putative aerobic c4-dicarboxylate transport protein
           [Stenotrophomonas maltophilia K279a]
 gi|226723855|sp|B2FTT6|DCTA_STRMK RecName: Full=C4-dicarboxylate transport protein
 gi|190013707|emb|CAQ47342.1| putative aerobic c4-dicarboxylate transport protein
           [Stenotrophomonas maltophilia K279a]
          Length = 447

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 233/412 (56%), Positives = 309/412 (75%), Gaps = 1/412 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           +Y+ LY QV+VAI  G  LGH+ P IG +M+PLGD F+   KM+I PVIFLT+ TGIA M
Sbjct: 16  IYRQLYFQVIVAIVLGAILGHYEPLIGEKMKPLGDAFINLVKMIIAPVIFLTIVTGIASM 75

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKSS 133
             ++ +G++F KAM  F  FS  AL++G+IV ++ +PG GMN++   L+  ++ ++++ S
Sbjct: 76  THLRTVGRVFAKAMAYFLFFSTLALIVGMIVAHVVQPGAGMNINPAELDQTAVHSYVEKS 135

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
           H  + +GF+ D+IP T +SA   GNILQ L +A+LFGI+L+ VGEK   I   LE +  P
Sbjct: 136 HDLTLVGFLMDIIPKTLVSAFVDGNILQVLFIAVLFGIALASVGEKGKPILNFLEALVAP 195

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           VF++V I+M+ AP+GAFGA++FTIGKYG+ S+ NL +LV   Y T+  F+  +LG++ R 
Sbjct: 196 VFKLVHILMKAAPIGAFGAIAFTIGKYGVGSLVNLAWLVGSFYLTAFLFVAVILGVVCRL 255

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
           C FS+ KL  +LK E+LLVL TSSSESALP LM+KME AGC +S+V +VVPTGYSFNLDG
Sbjct: 256 CGFSVFKLARYLKAELLLVLGTSSSESALPSLMEKMERAGCSKSVVGLVVPTGYSFNLDG 315

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           +NIY+TLA LFI+QATN  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP +
Sbjct: 316 TNIYMTLAALFIAQATNTELTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPEV 375

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       +  
Sbjct: 376 PVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWEGALDRNRLQLALDG 427


>gi|323971386|gb|EGB66625.1| Sodium:dicarboxylate symporter family protein [Escherichia coli
           TA007]
          Length = 428

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSESALP ++ KM++ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMQKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLN 415


>gi|153002058|ref|YP_001367739.1| sodium:dicarboxylate symporter [Shewanella baltica OS185]
 gi|151366676|gb|ABS09676.1| sodium:dicarboxylate symporter [Shewanella baltica OS185]
          Length = 444

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 128/408 (31%), Positives = 227/408 (55%), Gaps = 8/408 (1%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+ +G    +    ++PLG +FV   KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIVIGMVLGIIVGVIFGEQATCLKPLGTLFVNAIKMLIVPLVFCSLIVGVTSMQDTG 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ IGL+VG + +PG G+ + L    T+      +    S 
Sbjct: 81  KMGRIGFKSFGFYLFTTAIAISIGLLVGYVLQPGAGLGLTLAEGATQ-----TAKAVPSL 135

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++A+ SG ILQ ++ A+  GI+L L+GE      K  E +   ++++ 
Sbjct: 136 VDTLVDIVPTNPIAAMASGQILQVIVFAIALGIALVLIGEHGKPAIKVFESLAEAMYKLA 195

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG    L R F + S
Sbjct: 196 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYLGCIIHVLGFYSFLLRGFAKLS 255

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   +L+  +TSSS   LP  MK   E  G H+ I S V+P G + N+DG+ +
Sbjct: 256 PLQFFKGISNAMLVAFTTSSSAGTLPASMKCASENLGVHKKISSFVLPLGTTINMDGTAL 315

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L++ D L+++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 316 YQGVTVLFVAQAFGIDLTIVDYLTIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 374

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD   +N    
Sbjct: 375 GVALIAGIDRILDMVRTVVNVSGDLVATTVIAKSEDELDMAHYNADTE 422


>gi|126173014|ref|YP_001049163.1| sodium:dicarboxylate symporter [Shewanella baltica OS155]
 gi|125996219|gb|ABN60294.1| sodium:dicarboxylate symporter [Shewanella baltica OS155]
          Length = 444

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 128/408 (31%), Positives = 227/408 (55%), Gaps = 8/408 (1%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+ +G    +    ++PLG +FV   KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIVIGMVLGIIVGVIFGEQATCLKPLGTLFVNAIKMLIVPLVFCSLIVGVTSMQDTG 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ IGL+VG + +PG G+ + L    T+      +    S 
Sbjct: 81  KMGRIGFKSFGFYLFTTAIAISIGLLVGYVLQPGAGLGLTLAEGATQ-----TAKAVPSL 135

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++A+ SG ILQ ++ A+  GI+L L+GE      K  E +   ++++ 
Sbjct: 136 VDTLVDIVPTNPIAAMASGQILQVIVFAIALGIALVLIGEHGKPAIKVFESLAEAMYKLA 195

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG    L R F + S
Sbjct: 196 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYLGCIIHVLGFYSFLLRGFAKLS 255

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   +L+  +TSSS   LP  MK   E  G H+ I S V+P G + N+DG+ +
Sbjct: 256 PLQFFKGISNAMLVAFTTSSSAGTLPASMKCASENLGVHKKISSFVLPLGTTINMDGTAL 315

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L++ D L+++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 316 YQGVTVLFVAQAFGIDLTVVDYLTIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 374

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD   +N    
Sbjct: 375 GVALIAGIDRILDMVRTVVNVSGDLVATTVIAKSEDELDMAHYNADTE 422


>gi|24372509|ref|NP_716551.1| proton/glutamate symporter [Shewanella oneidensis MR-1]
 gi|24346511|gb|AAN53996.1|AE015537_4 proton/glutamate symporter [Shewanella oneidensis MR-1]
          Length = 424

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 123/407 (30%), Positives = 227/407 (55%), Gaps = 9/407 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+ V +  G+ +G  + +    ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 5   LWLQIFVGMVLGILVGVTLGEQASYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMEDTA 64

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL+VG + +PG G+ +       +  A   +    S 
Sbjct: 65  KMGRIGFKSFSFYLCTTAIAISLGLVVGYVIQPGAGVPL------LQHEAVNTAKEVPSV 118

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++AL SG ILQ ++ A+  GI+L L+G+      K  E +   ++++ 
Sbjct: 119 MQTLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLT 178

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG   I+ R F + +
Sbjct: 179 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLN 238

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            +     +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 239 PLHFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 298

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D L+++L A ++S G AGV G+  + L   ++ V  LP+ 
Sbjct: 299 YQGVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTV-GLPLE 357

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD + +N  +
Sbjct: 358 GVALIAGIDRILDMARTVVNVSGDLVATTVIAKSENELDVEHYNADM 404


>gi|20138055|sp|Q9RRG7|DCTA_DEIRA RecName: Full=C4-dicarboxylate transport protein
          Length = 443

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 211/415 (50%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           P +++ LY+QV++AI  G+ +G   P+ G  ++PLGDIFVK  KM+I P+IF TV +G+A
Sbjct: 2   PKIFRSLYVQVIIAIVLGILVGALFPKFGEALKPLGDIFVKLIKMVIAPIIFATVVSGVA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M+D + +G++  KA+  F V S  AL+IG++V N+ +PG GMNVD  +L+T  +     
Sbjct: 62  HMRDTRKVGRVGGKALIYFEVVSTLALIIGMVVMNVLRPGAGMNVDPATLDTAGLTKYTE 121

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +  + +    +  +IPDT +SA T G +L  L+VALLFG +L  +G+  D I   ++ +N
Sbjct: 122 AAGEMTVWDHILKIIPDTLVSAFTGGELLPVLLVALLFGFALMRLGKLGDQILYGIDALN 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VF ++  +MR+AP+GAFGAM+FT+GKYGL S+++L +L+   Y T   FI  VLG++A
Sbjct: 182 QVVFVILGFIMRLAPIGAFGAMAFTVGKYGLKSLTSLGYLMGSFYLTCLLFIFVVLGLIA 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FSI KLI +++EE+L+VL TSSSESALP LM K+E AG  +S+V +VVPTGYSFNL
Sbjct: 242 RAAGFSIFKLIRYIREELLIVLGTSSSESALPRLMMKLEHAGAEKSVVGLVVPTGYSFNL 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+A LFI+QATN PL L +QLSLL + +++SKGAAGVTGS FITLAAT+  V 
Sbjct: 302 DGTSIYLTMAALFIAQATNTPLGLGEQLSLLAVLLLTSKGAAGVTGSGFITLAATLGAVG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AGM LILG+DRFMSE R++TNFIGNAV T+VV+R E  +D     + +  E
Sbjct: 362 HVPVAGMALILGIDRFMSEARALTNFIGNAVATLVVARSENAVDMNRLTRALNGE 416


>gi|262375470|ref|ZP_06068703.1| aerobic C4-dicarboxylate transporter [Acinetobacter lwoffii SH145]
 gi|262309724|gb|EEY90854.1| aerobic C4-dicarboxylate transporter [Acinetobacter lwoffii SH145]
          Length = 447

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 209/430 (48%), Positives = 306/430 (71%), Gaps = 15/430 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV+VAI +G+ +GHF P               +G Q++PLGD F++  
Sbjct: 1   MAKQPIYKSLYFQVIVAIIAGILVGHFSPSGTQIINGVEQHVPGLGEQLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  ALVIGL+V NI KPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALVIGLVVINIVKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  SL+T  I+ ++ S  ++S I F+ ++IP+T + A   G ILQ L+ A++FG +L 
Sbjct: 121 NVDPASLDTTGISKYVASGESQSTIDFLMNIIPNTVVGAFAEGEILQVLLFAIIFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G++   + K +++I+   F +V++VM++AP+GAFGAM+FTIGKYG+ S++ L  L+ C
Sbjct: 181 KLGDQGKPVLKLIDQISHVFFNIVNMVMKLAPIGAFGAMAFTIGKYGIGSLAQLAQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  VLG +ARF  FSI+K+I  ++EE+L+VL TSSSES LP ++KK+E AG 
Sbjct: 241 FYITCVLFIFIVLGSIARFAGFSIMKMIRLIREELLIVLGTSSSESVLPRMLKKLELAGA 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L L+ Q++LLL+ ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDLSHQITLLLVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT+  V ++P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W  +L
Sbjct: 361 VTGSGFIVMAATLAAVGNIPVAGLALILGIDRFMSEARALTNLVGNSLATLVVAKWVGQL 420

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 421 DMDKLNYALA 430


>gi|116671952|ref|YP_832885.1| sodium:dicarboxylate symporter [Arthrobacter sp. FB24]
 gi|116612061|gb|ABK04785.1| sodium:dicarboxylate symporter [Arthrobacter sp. FB24]
          Length = 502

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 165/419 (39%), Positives = 268/419 (63%), Gaps = 2/419 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + PLY+ L+ Q+L+A+ +G+ +GHF P +G Q++PLGD F++  KM+I P+IFL + T
Sbjct: 16  SKKKPLYRSLFFQILIAVVAGVLIGHFWPDLGSQLRPLGDGFIQLIKMIIAPLIFLVIVT 75

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-A 128
           GI+ + D+K +G++  KA+  F   ++FALV GLIVGNI +PG G+N+D  +L+ E++ A
Sbjct: 76  GISAVGDVKAVGRVGVKALLYFTAATLFALVFGLIVGNIVQPGAGLNIDPSTLSQEALNA 135

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVG-EKSDTIRKCL 187
              ++  K    F+ D+IP + + A  S ++LQ L  ++ FG ++ ++G E+   +   +
Sbjct: 136 KTGTTPPKDAAHFILDIIPTSVIGAFASNSLLQVLFFSVFFGAAIVVIGRERCMPVISLM 195

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E +   +F+++S +M++AP+GAFGAM+F IG+YGL ++     L+   Y  +  FI  + 
Sbjct: 196 ETVLELIFKIMSWIMKVAPIGAFGAMAFIIGQYGLGTLGTYAKLIAACYGAAVVFIALLF 255

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
            +   F R  +   + + +EE LL L T+S+E+ +P +M K+  AGC R+   +VVPTGY
Sbjct: 256 LVAWGFARVPLWHFLKYTREEFLLALGTASTEAVMPRIMTKLTNAGCSRATTGLVVPTGY 315

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+ IY++++ LF++QA    L L  QL+ L + +++SKG AGV GS+F+ L+AT 
Sbjct: 316 SFNLDGAAIYLSISLLFLAQAFGHNLDLGQQLAALGVLLLTSKGMAGVPGSSFLALSATA 375

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             +   P+AG+ L+LG DR M   R V N +GN V T VVS+WE + D  +  +    E
Sbjct: 376 AALGIFPVAGVALLLGADRLMDSMRVVVNLLGNCVATFVVSKWEGQFDRGVMVRAFRGE 434


>gi|224824794|ref|ZP_03697901.1| sodium:dicarboxylate symporter [Lutiella nitroferrum 2002]
 gi|224603287|gb|EEG09463.1| sodium:dicarboxylate symporter [Lutiella nitroferrum 2002]
          Length = 447

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 203/418 (48%), Positives = 294/418 (70%), Gaps = 2/418 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P Y  LY QVL+AI  G+ LG   P    +M+PLGD FVK  KM+I P+IF TV  G
Sbjct: 1   MKKPFYTRLYFQVLLAIAIGVTLGAVAPDFAAKMKPLGDAFVKLIKMMIAPIIFTTVVVG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA+M DMK +G++  KA+  F V +  ALVIGL+V N+ KPG G+N+D  +L++ ++A  
Sbjct: 61  IAKMGDMKEVGRVGGKALLYFEVVTTLALVIGLVVVNVLKPGAGLNIDPSTLDSAAVAKY 120

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            +   + + I F  ++IP + +SA   G+ILQ L+ ++L G +LS +GEK   +   L+E
Sbjct: 121 AAGAKSMNTIDFFMNIIPHSVVSAFAEGDILQVLLFSVLMGAALSAMGEKGKPLVSILDE 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F ++ ++M++AP+GAFGAM+FTIGKYG+ S+  L +L+ C+Y T A F+  VLG 
Sbjct: 181 FSHSMFHIIGMIMKLAPIGAFGAMAFTIGKYGVGSLKQLSYLMLCVYLTCAAFVFIVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FS+ K + ++KEE++LVL TSSSESALP +M KME  GC + +V MV+PTGYSF
Sbjct: 241 IAKLTGFSLWKFLAYIKEELILVLGTSSSESALPRMMTKMENLGCAKPVVGMVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QA NV L+L ++L LL + +++SKGAA VTG  FITLAAT+  
Sbjct: 301 NLDGTSIYLTMAAIFIAQAVNVDLTLGEELGLLGVLLLTSKGAAAVTGGGFITLAATLAT 360

Query: 370 VPS-LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +   LP+ G+ L+LGVDRFMSE R++TN IGN V TVVV++WE  LD +  N+ +  E
Sbjct: 361 LHGKLPVEGLALLLGVDRFMSEARAITNLIGNGVATVVVAKWENALDVERMNRVLNGE 418


>gi|121608804|ref|YP_996611.1| C4-dicarboxylate transporter DctA [Verminephrobacter eiseniae
           EF01-2]
 gi|171769487|sp|A1WIY6|DCTA_VEREI RecName: Full=C4-dicarboxylate transport protein
 gi|121553444|gb|ABM57593.1| sodium:dicarboxylate symporter [Verminephrobacter eiseniae EF01-2]
          Length = 439

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 292/418 (69%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + PL+K LY+QVL AI  G+ LGHF P  G  M+PLGD F+K  KM+I PVIF TV  
Sbjct: 1   MTKAPLHKSLYVQVLAAIVIGVVLGHFYPPSGEAMKPLGDGFIKLIKMIIAPVIFCTVVL 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-A 128
           GIA M+DMK +G+    A+  F + S  AL++GL++ N+ +PG GMN+D ++++T++I A
Sbjct: 61  GIAGMEDMKKVGKTGGLALLYFEIVSTLALIVGLVLVNVLQPGAGMNIDPRTIDTKAITA 120

Query: 129 HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           +         + F+ ++IP + + A   G+ILQ L++++LFG +L   G +   +   +E
Sbjct: 121 YTGPGKMTGTVEFLLNIIPVSMVDAFAKGDILQVLLISVLFGFALHRFGGRGTMVFDFIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
           +++  +F +V  +M+ AP+GAFGAM+FTIGKYG+ S+ +L  L+   Y T  FFI  VLG
Sbjct: 181 KVSQVLFAIVGTIMKAAPIGAFGAMAFTIGKYGIGSLLSLGKLMGTFYLTCLFFIFAVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            + R   FS+ K + ++KEE+L+VL TSSSES LP ++ KME  G  +++V +V+PTGYS
Sbjct: 241 TITRLHGFSVWKFVKYIKEELLIVLGTSSSESVLPRMLSKMENLGAKKTVVGLVIPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+ IY+T+A +FI+QATN P++L  +++LL + +++SKGAAG+TGS FI LAA+++
Sbjct: 301 FNLDGTAIYLTMAAVFIAQATNTPMTLMQEVTLLAVLLLTSKGAAGITGSGFIVLAASLS 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V  LP+AG+ LILG+DRFMSE R++TN IGN V ++VV++W K+LD +  +  +  +
Sbjct: 361 AVGHLPVAGLALILGIDRFMSEARALTNTIGNGVASIVVAKWSKELDEQRLHAQLNGQ 418


>gi|20141360|sp|P31601|DCTA_RHISN RecName: Full=C4-dicarboxylate transport protein
          Length = 497

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 231/415 (55%), Positives = 319/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY+QVL AI  G+ LG+F P +G +M+PLGD F+   KM+I PVIFLTV+TGI
Sbjct: 20  KTPHYRHLYVQVLAAIAVGILLGYFYPDVGSKMKPLGDAFIMLVKMIIAPVIFLTVATGI 79

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+  +G++  KAM  F  FS  AL++GL+V N+ +PG GM++D  SL+ ++IA + 
Sbjct: 80  AGMTDLAKVGRVAGKAMIYFLTFSTLALLVGLVVANVVQPGAGMHIDPASLDAKAIATYA 139

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L  +
Sbjct: 140 EKAHEQSVTGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKKAEAVVDFLHAL 199

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 200 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGVASIANLAMLIGTFYLTSFLFVFMVLGAV 259

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 260 ARYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 319

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QAT+ P+S  DQ+ LLLIAM+SSKGAAG+TG+ FITLAAT++ V
Sbjct: 320 LDGTNIYMTLAALFIAQATDTPISYGDQILLLLIAMLSSKGAAGITGAGFITLAATLSAV 379

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILG+DRFMSECR++TN IGNAV T+VV++WE +L P      +  
Sbjct: 380 PSVPVAGMALILGIDRFMSECRAITNIIGNAVATIVVAKWEGELAPAQLATTLAG 434


>gi|113969108|ref|YP_732901.1| sodium:dicarboxylate symporter [Shewanella sp. MR-4]
 gi|113883792|gb|ABI37844.1| sodium:dicarboxylate symporter [Shewanella sp. MR-4]
          Length = 435

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 124/407 (30%), Positives = 227/407 (55%), Gaps = 9/407 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+ V +  G+A+G  + +    ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIFVGMVLGIAVGVSLGEQASYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMEDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG + +PG G+ +       +  A   +    S 
Sbjct: 81  KMGRIGFKSFAFYLCTTAIAISLGLAVGYVVQPGAGVPL------LQHEAVQTAKEVPSV 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++AL SG ILQ ++ A+  GI+L L+G+      K  E +   ++++ 
Sbjct: 135 MQTLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG   I+ R F + +
Sbjct: 195 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            +     +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PLHFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D L+++L A ++S G AGV G+  + L   ++ V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD + +N  +
Sbjct: 374 GVALIAGIDRILDMARTVVNVSGDLVATTVIAKSEDELDVEHYNADM 420


>gi|77460457|ref|YP_349964.1| C4-dicarboxylate transporter DctA [Pseudomonas fluorescens Pf0-1]
 gi|123603633|sp|Q3K8D1|DCTA_PSEPF RecName: Full=C4-dicarboxylate transport protein
 gi|77384460|gb|ABA75973.1| aerobic C4-dicarboxylate transport protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 444

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 200/415 (48%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY QV+VAI  G+ALGH+ PQ GV ++PLGD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYFQVIVAICIGIALGHYYPQFGVAVKPLGDGFIKLIKMIIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M++MK +G+    A+  F + S  AL++GLIV NI +PG GM++D+ +L+   +A +
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLVGLIVVNIVQPGNGMHIDVSTLDASKVATY 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +     +S +GF+ ++IP T + A  +G+ILQ L+ +++FG +L  +G     I   ++ 
Sbjct: 123 VAQGADQSVVGFLLNVIPTTIVGAFATGDILQVLMFSVIFGFALHRLGAYGKPILDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP+GAFGAM+FTIG YG+ S+  L  L+ C Y T   FIL VLG 
Sbjct: 183 FAHVMFNIINMIMKLAPIGAFGAMAFTIGAYGVGSLVQLGQLMICFYITCLAFILIVLGG 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FS++K+I +++EE+L+VL TSSSES LP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 IARMHGFSVLKMIRYIREELLIVLGTSSSESVLPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+ IY+T+A +FI+QAT+  + +T Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTAIYLTMAAVFIAQATDTHMDITHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV T+VV++W K+LD  + +  + 
Sbjct: 363 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDTDVLDAELA 417


>gi|229000241|ref|ZP_04159810.1| C4-dicarboxylate transport protein [Bacillus mycoides Rock3-17]
 gi|228759573|gb|EEM08550.1| C4-dicarboxylate transport protein [Bacillus mycoides Rock3-17]
          Length = 431

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L+K L  QVL AI  G+ +G   P +G +M+P+GD F+   KM+I P+IFLT+  GIA
Sbjct: 8   KRLFKNLTFQVLTAIALGVLVGLMWPNVGKEMKPIGDTFINAVKMVIAPIIFLTIVLGIA 67

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V + FAL++GLIV N  KPG G+N +  +    S      
Sbjct: 68  KMGDMKKVGKVGGKAFIYFEVVTTFALIVGLIVVNAMKPGSGLNFNELAKGDVSKYTQGG 127

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
               ++I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GEK +++   L++++ 
Sbjct: 128 GQGINWIDFVTHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGNSVIDFLDKLSH 187

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  VM+ APLGAFGAM++TIG +GL+S+  L  L+  +Y T   F+  VL I+ +
Sbjct: 188 VFFKIIGYVMKAAPLGAFGAMAYTIGHFGLASLVPLGKLMMSVYITMFLFVFVVLNIICK 247

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+++E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 248 IYGFSLWNYLKFIRDEILIVLGTSSSESVLPRMMNKMERYGCSKSVVGLVIPTGYSFNLD 307

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++A +F++Q   V L++  Q++++L+ M++SKGAAGVTGS FI LA+T+  +  
Sbjct: 308 GTSIYLSMAVVFLAQVFGVDLTIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLAALKV 367

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + T+VV++ E + D     + I 
Sbjct: 368 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIVVAKSENEFDEMRHAEAIA 419


>gi|194367125|ref|YP_002029735.1| sodium:dicarboxylate symporter [Stenotrophomonas maltophilia
           R551-3]
 gi|226723854|sp|B4SI88|DCTA_STRM5 RecName: Full=C4-dicarboxylate transport protein
 gi|194349929|gb|ACF53052.1| sodium:dicarboxylate symporter [Stenotrophomonas maltophilia
           R551-3]
          Length = 447

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 232/412 (56%), Positives = 309/412 (75%), Gaps = 1/412 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           +Y+ LY QV+VAI  G  LGH+ P +G +M+PLGD F+   KM+I PVIFLT+ TGIA M
Sbjct: 16  IYRQLYFQVIVAIVLGAILGHYEPLVGEKMKPLGDAFINLVKMIIAPVIFLTIVTGIASM 75

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKSS 133
             ++ +G++F KAM  F  FS  AL++G+IV ++ +PG GMN++   L+  ++ ++++ S
Sbjct: 76  THLRTVGRVFAKAMAYFLFFSTLALIVGMIVAHVVQPGAGMNINPAELDQTAVHSYVEKS 135

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
           H  + +GF+ D+IP T +SA   GNILQ L +A+LFGI+L+ VGEK   I   LE +  P
Sbjct: 136 HDLTLVGFLMDIIPKTLVSAFVDGNILQVLFIAVLFGIALASVGEKGKPILNFLEALVAP 195

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           VF++V I+M+ AP+GAFGA++FTIGKYG+ S+ NL +LV   Y T+  F+  +LG++ R 
Sbjct: 196 VFKLVHILMKAAPIGAFGAIAFTIGKYGVGSLVNLAWLVGSFYLTAFLFVAVILGVVCRL 255

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
           C FS+ KL  +LK E+LLVL TSSSESALP LM+KME AGC +S+V +VVPTGYSFNLDG
Sbjct: 256 CGFSVFKLARYLKAELLLVLGTSSSESALPSLMEKMERAGCSKSVVGLVVPTGYSFNLDG 315

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           +NIY+TLA LFI+QATN  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +VP +
Sbjct: 316 TNIYMTLAALFIAQATNTELTLGHQIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPEV 375

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       +  
Sbjct: 376 PVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWEGALDRNRLQLALDG 427


>gi|330811225|ref|YP_004355687.1| Aerobic C4-dicarboxylate transport protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379333|gb|AEA70683.1| Aerobic C4-dicarboxylate transport protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 450

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 203/415 (48%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY QV+VAI  G+ LGHF PQ GV ++P GD F+K  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPFGDGFIKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH- 129
           IA M++MK +G+    A+  F + S  AL+IGL+V N+ +PG+GM++D+ +L+T  IA  
Sbjct: 63  IAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGVGMHIDVSTLDTSKIAGF 122

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           I +   +S I F+ ++IP+T + A  +G+ILQ L+ +++FG +L  +G     +   ++ 
Sbjct: 123 ISAGKDQSIIAFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++APLGAFGAM+FTIG YG+ S+  L  L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFIIINMIMKLAPLGAFGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFVLVVLGA 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++EE+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 243 ICRAHGFSVVKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + LT Q++LLL+ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 303 NLDGTSIYLTMAAVFIAQATDTQMDLTHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSA 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V +LP+AG+ LILG+DRFMSE R++TN +GNAV T+VV++W K+LD       + 
Sbjct: 363 VGTLPVAGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDEDQLQTELA 417


>gi|196248999|ref|ZP_03147699.1| sodium:dicarboxylate symporter [Geobacillus sp. G11MC16]
 gi|196211875|gb|EDY06634.1| sodium:dicarboxylate symporter [Geobacillus sp. G11MC16]
          Length = 421

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 142/411 (34%), Positives = 245/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ + +  G+ +G      P++   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQIFIGLILGIVVGAIFYGNPKVATYLQPIGDIFLRLIKMIVIPIVVSSLIVGVANVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD--LKSLNTESIAHIKSS 133
           D+K +G++  K +  F + +  A+V+GL+  N+ +PG G+N+    K+     I      
Sbjct: 66  DVKKLGKLGGKTIIYFEIITTIAIVVGLLAANVFQPGAGVNMKSLEKTDIQSYIDTANEV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
              S +    +++P      L++GNIL  +  +++FG+ ++ +GEK   +    +     
Sbjct: 126 QHHSMVETFVNIVPKNLFEELSNGNILPIIFFSVMFGLGVAAIGEKGKPVLHFFQGTAEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+ K+G++S+  L  LV  +Y   AFF+L VLG +A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSKFGVASLLPLSKLVVLVYGVMAFFVLVVLGGVAKL 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  +I  LK E++L  STSSSE+ LP +++KME  GC ++I S VVPTGYSFNLDG
Sbjct: 246 MGINIFHIIKILKNELVLAYSTSSSETVLPKIIEKMERFGCSKAITSFVVPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA +FI+Q   + + ++ Q+SL+L+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQALAAVFIAQLYGIDMPISQQISLVLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+  I G+DR +   R+  N +GNA+  V++S+WE + D +   +Y+ 
Sbjct: 365 PVEGLAFIAGIDRILDMARTAVNVVGNALAAVIMSKWEGQYDEEQGKQYLE 415


>gi|310818955|ref|YP_003951313.1| c4-dicarboxylate transport protein [Stigmatella aurantiaca DW4/3-1]
 gi|309392027|gb|ADO69486.1| C4-dicarboxylate transport protein [Stigmatella aurantiaca DW4/3-1]
          Length = 439

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 230/417 (55%), Positives = 312/417 (74%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++P L++ LY+QVL AI +G  LGHF P +G  ++PLGD F+K  KM+I PVIFLTV TG
Sbjct: 12  VKPGLHRHLYVQVLTAIAAGALLGHFFPSVGESLKPLGDGFIKLVKMIIAPVIFLTVVTG 71

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA  KD+  +G+I  KA   F  FS  AL+IGLIV N+ +PG GM++D K+L+  +++ +
Sbjct: 72  IAGTKDLDKVGRIALKAFAYFLTFSTAALIIGLIVANLVRPGDGMHIDPKTLDPGAVSLY 131

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +H +S +GF+  +IP T +SA   G ILQ L V++LFG++L+LVG++   + + L  
Sbjct: 132 ASKAHHQSLVGFLLGIIPVTVVSAFAEGEILQVLFVSILFGVALALVGDRGRPVLELLGS 191

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++   FR+V+I+M+ AP+GAFGA +FTIGKYGL SI+NL  LV   Y TSA F+L VLG 
Sbjct: 192 LSAAFFRLVAILMKAAPIGAFGAFAFTIGKYGLGSIANLAALVATFYVTSALFVLVVLGG 251

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSI+ L+ +LK E+ LVL TSSSE+ALP LM+K+E AGC + IV +VVPTGYSF
Sbjct: 252 VARFNGFSILALLRYLKAELFLVLGTSSSEAALPSLMEKLERAGCSKQIVGLVVPTGYSF 311

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLA LFI+QAT+  LSL  QL LLL+AM+SSKGAAGVTG+ FITLAAT+++
Sbjct: 312 NLDGTNIYMTLAALFIAQATDTHLSLGSQLLLLLVAMLSSKGAAGVTGAGFITLAATLSV 371

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AG+ LILG+DRFMSECR++TN IGNAV T+VV+ WE   D + F   +  +
Sbjct: 372 VPTVPVAGIALILGIDRFMSECRALTNVIGNAVATIVVANWEGGFDRERFASALRGQ 428


>gi|114326697|ref|YP_743854.1| c4-dicarboxylate transport protein [Granulibacter bethesdensis
           CGDNIH1]
 gi|122328318|sp|Q0BW71|DCTA_GRABC RecName: Full=C4-dicarboxylate transport protein
 gi|114314871|gb|ABI60931.1| c4-dicarboxylate transport protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 447

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 227/414 (54%), Positives = 306/414 (73%), Gaps = 1/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
             Y+ LY+QVL+A+   + LG+F P +     PLGD F+K  KM+I PVIFLTV TGIA 
Sbjct: 17  KWYQHLYVQVLIAMALSILLGYFAPDVAKSFGPLGDAFIKLVKMIIAPVIFLTVVTGIAG 76

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M+DMK +G++  KAM  F  FS  ALV+GL+V NI +PG  M+ D   L++  +  +++ 
Sbjct: 77  MRDMKTVGRVIGKAMIYFLCFSTLALVVGLVVVNIVQPGASMHADPAKLSSSLVQTYVQR 136

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +H  S IGF+ ++IP T +SAL SG+ILQ L  ++LFGI+L+ VGE    + K LE ++ 
Sbjct: 137 AHDTSLIGFLLNIIPATPVSALASGDILQVLFFSVLFGIALASVGEAGTPLLKVLESLSA 196

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +FR+V+I+MR APLGAFGAM++T+G +G+ SI NL  LV   Y T+  F+L VLG +AR
Sbjct: 197 SIFRLVAILMRAAPLGAFGAMAYTVGTFGIRSILNLAMLVGTFYITAILFVLIVLGSVAR 256

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           +  FSI+KLI ++KEE+LLVL TSSSE ALPGLM KME AGC +++V +V+PTGYSFNLD
Sbjct: 257 YNGFSILKLIRYIKEELLLVLGTSSSEPALPGLMAKMEAAGCEKTVVGLVIPTGYSFNLD 316

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+T+A LFI+QA N+PLS  DQ  LL +AM+SSKGAAGVTG+ F+TLAAT++++PS
Sbjct: 317 GTNIYMTIAALFIAQALNIPLSWGDQALLLAVAMLSSKGAAGVTGAGFVTLAATLSVIPS 376

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+AG+ LI GVDRFMSECR++TN IGNAV  +VV+RWE KLD       +  E
Sbjct: 377 IPVAGIGLIFGVDRFMSECRALTNLIGNAVAAIVVARWEGKLDKNQLTAALNGE 430


>gi|94495467|ref|ZP_01302047.1| C4-dicarboxylate transport protein [Sphingomonas sp. SKA58]
 gi|94424855|gb|EAT09876.1| C4-dicarboxylate transport protein [Sphingomonas sp. SKA58]
          Length = 443

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 234/420 (55%), Positives = 315/420 (75%), Gaps = 1/420 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +    R P Y+ LY+QVLVAI  G+A+GHF P  GVQ++PLG+ F+K  KM+I PVIFLT
Sbjct: 9   IQTAPRLPFYRQLYVQVLVAIALGVAIGHFFPDAGVQLKPLGEAFIKLVKMIIAPVIFLT 68

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           + TGIA MK++  IG++  KA   F  FS  AL++GLIV N+ +PG G+N+D  +L+   
Sbjct: 69  IVTGIAGMKELGAIGRVAAKAFGYFLTFSTLALIVGLIVANVVQPGAGLNIDPATLDAGK 128

Query: 127 IAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           +A     +H ++  GF+  +IP T +SA+  GNILQ L VA+LFGI+L+++G+K+  +  
Sbjct: 129 VADYAHQAHERTLTGFLMSIIPATMVSAVADGNILQVLFVAILFGIALTMIGDKAAPLMT 188

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            LE  +  VF++V  +M+ AP+GAFGAM+FTIG+YG+ +++NL  LV   Y TS  F+L 
Sbjct: 189 VLESASHAVFKLVGFLMKAAPIGAFGAMAFTIGEYGVGTLANLAGLVATFYLTSLLFVLV 248

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG +     F+I+ LI +LK E+LLVL TSSSE+ALP L++KME AGC +S+V +VVPT
Sbjct: 249 VLGAVCWAVGFNILHLIRYLKAELLLVLGTSSSEAALPSLIEKMERAGCRKSVVGLVVPT 308

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG+NIY+TLA LFI+QA NV +SL +Q+ LLL+AM+SSKGAAGVTG+ FITLAA
Sbjct: 309 GYSFNLDGTNIYMTLAALFIAQACNVHISLEEQILLLLVAMISSKGAAGVTGAGFITLAA 368

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           T+++VPS+P+AGMTLILGVDRFMSECRS+TNF+GNAV TVVVS WEK LD + F   +  
Sbjct: 369 TLSIVPSVPVAGMTLILGVDRFMSECRSLTNFVGNAVATVVVSVWEKGLDRERFTAAMAG 428


>gi|328552125|gb|AEB22617.1| C4-dicarboxylate transporter DctA [Bacillus amyloliquefaciens
           TA208]
 gi|328910398|gb|AEB61994.1| C4-dicarboxylate transport protein [Bacillus amyloliquefaciens LL3]
          Length = 418

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 173/404 (42%), Positives = 268/404 (66%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             ++K L +QV+ A+  G+ +G   P+ G QM+PLGD F+   KM+I P+IFLT+  GIA
Sbjct: 1   MKIFKNLTVQVITAVIIGVIVGLVWPEAGKQMKPLGDTFINAVKMIIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V +  AL+IGL+V NI KPG G++         S      
Sbjct: 61  KMGDMKKVGKVGGKAFIYFEVVTTIALIIGLLVVNIMKPGEGLDYSKLEKGDVSQYTQNG 120

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +I F+  ++P   + A   G+ILQ L  ++LFG+ L+ +GE+  +I    ++++ 
Sbjct: 121 GQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSVLFGVGLAALGERGKSIIDFFDKLSH 180

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR AP+GAFGAM++TIG +GL SI  L  L+  +Y T   F+   L I+ R
Sbjct: 181 VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMLSVYITMFLFVFVALNIICR 240

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+   + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 241 IFGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 300

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++AT+F++Q   V L++  Q++++L+ M++SKGAAGVTGS FI LA+T++ +  
Sbjct: 301 GTSIYLSMATVFLAQVFGVDLTIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQV 360

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDP 416
           +P+ G+ L+LGVDRFMSE R++ N IGN + T++V++ E + D 
Sbjct: 361 IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDE 404


>gi|58580740|ref|YP_199756.1| C4-dicarboxylate transporter DctA [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425334|gb|AAW74371.1| C4-dicarboxylate transport protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 474

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 235/423 (55%), Positives = 310/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LG F P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 32  PFYRQLYFQVVVAIILGALLGRFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 91

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GL+V ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 92  MTHLKTVGRVFGKAMVYFLFFSTLALVVGLVVAHVVQPGAGMNINPADLDQSAVKSYVEK 151

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 152 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 211

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 212 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 271

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG++ R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 272 VLVILGVVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 331

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 332 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 391

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 392 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLTLV 451

Query: 423 IGI 425
           +  
Sbjct: 452 LDG 454


>gi|193222303|emb|CAL61558.2| Aerobic C4-dicarboxylate transport protein [Herminiimonas
           arsenicoxydans]
          Length = 452

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 199/418 (47%), Positives = 291/418 (69%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             +PP YK LY+QV+ AI  G+ +GHF P+ G  M+P GD F+K  KM+I PVIF TV  
Sbjct: 14  MSKPPFYKSLYVQVIFAIVIGVLVGHFAPETGAAMKPFGDAFIKLIKMIIAPVIFCTVVI 73

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G+    A+  F V S  AL++GL++ N+ +PG GMN+D+ SL+  SIA 
Sbjct: 74  GIAGMEDMKKVGKTGGMALLYFEVMSTLALIVGLLIVNLLQPGAGMNIDVNSLDIASIAS 133

Query: 130 IK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
                  ++   F+  +IP + + A   G++LQ L+V++LFG +L   G +   +   +E
Sbjct: 134 YTAPGKMETVTEFLLHIIPSSMIDAFAKGDVLQVLLVSVLFGFALHKFGGRGTLVFDFIE 193

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
           +++  +F +V ++M+ AP+GAFGAM+FTIGKYG++S+ +L  L+   Y T  FFI  VLG
Sbjct: 194 KVSHVLFSIVGLIMKAAPIGAFGAMAFTIGKYGIASLLSLGKLMGTFYLTCLFFIFVVLG 253

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
           I++R   FSI K + ++KEE+L+VL TSSSES LP ++ KME  G  +S+V +V+PTGYS
Sbjct: 254 IVSRLHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMIAKMENLGAKKSVVGLVIPTGYS 313

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+ IY+T+A +FI+QATN P++L  Q++LL + +++SKGAAG+TGS FI LAAT++
Sbjct: 314 FNLDGTAIYLTMAAVFIAQATNTPMTLMQQITLLGVLLLTSKGAAGITGSGFIVLAATLS 373

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V  +P+AG+ LILG+DRFMSE R++TN IGN V T+VV+RW   LD +  +  +  E
Sbjct: 374 AVGHVPVAGLALILGIDRFMSEARALTNTIGNGVATLVVARWGNDLDMQTLHAQLNNE 431


>gi|226945187|ref|YP_002800260.1| C4-dicarboxylate transport protein [Azotobacter vinelandii DJ]
 gi|226720114|gb|ACO79285.1| C4-dicarboxylate transport protein [Azotobacter vinelandii DJ]
          Length = 441

 Score =  283 bits (724), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 192/416 (46%), Positives = 281/416 (67%), Gaps = 3/416 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L   LY+QVL+ +  G+ LG + P  G  ++PLGD F+K  KM+  P+IF TV  GIA
Sbjct: 3   KRLIGKLYVQVLIGVTIGIVLGIYSPNFGADLKPLGDAFIKLIKMVFAPIIFATVVLGIA 62

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M++MK +G++  +A+  F + S FALV+GL+V N+ +PG GMNVD  +L+T+SIA   +
Sbjct: 63  KMENMKELGRVGARALIYFEILSTFALVLGLVVVNLVQPGQGMNVDPATLDTKSIAAYTA 122

Query: 133 ---SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              S +  F  F+  +IP +   A     ILQ L+ + LFGI+LS +G ++  +   LE 
Sbjct: 123 GAASGSGGFTDFLLHIIPASVTDAFAKNEILQILLFSTLFGIALSHMGPRARPVVDVLEA 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +V ++MR+APL A GAM+FT+GKYGL SI +L  L+  +Y T   F+  VLG 
Sbjct: 183 FSHGMFHIVGMIMRVAPLAACGAMAFTVGKYGLGSIVSLGKLMGTMYLTCFLFVTIVLGS 242

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FS+ K + +LK+E+  VL TSSSES +P LM K+E  G  + +V +V+P+G +F
Sbjct: 243 IARLSGFSLWKFLKYLKDELFTVLGTSSSESVVPQLMNKLENVGVSKPVVGLVIPSGLTF 302

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           N DG  IY T+A +FI+QATN PL+LTDQL +L + +++SKG+AGVTGS FITLAAT+  
Sbjct: 303 NPDGQCIYYTMAAVFIAQATNTPLTLTDQLIVLGVLLLTSKGSAGVTGSGFITLAATLAS 362

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           + ++P+AGM L+LGVDRFMSE RS+TN IGNAV T+ +++W   LD +  ++ +  
Sbjct: 363 LGNIPVAGMVLLLGVDRFMSEARSITNTIGNAVGTMAIAKWVGALDKERMDQVLDG 418


>gi|21244196|ref|NP_643778.1| C4-dicarboxylate transporter DctA [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78049155|ref|YP_365330.1| C4-dicarboxylate transporter DctA [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325926609|ref|ZP_08187923.1| Na+/H+ dicarboxylate symporter [Xanthomonas perforans 91-118]
 gi|24211635|sp|Q8PGZ1|DCTA_XANAC RecName: Full=C4-dicarboxylate transport protein
 gi|123584235|sp|Q3BPI3|DCTA_XANC5 RecName: Full=C4-dicarboxylate transport protein
 gi|21109834|gb|AAM38314.1| C4-dicarboxylate transport protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78037585|emb|CAJ25330.1| C4-dicarboxylate:cation symporter family protein [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325542961|gb|EGD14410.1| Na+/H+ dicarboxylate symporter [Xanthomonas perforans 91-118]
          Length = 457

 Score =  283 bits (724), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 236/423 (55%), Positives = 312/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LGHF P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GL+V ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMAYFLFFSTLALVVGLVVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG+++R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGLVSRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLKLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|160876777|ref|YP_001556093.1| sodium:dicarboxylate symporter [Shewanella baltica OS195]
 gi|160862299|gb|ABX50833.1| sodium:dicarboxylate symporter [Shewanella baltica OS195]
 gi|315268977|gb|ADT95830.1| sodium:dicarboxylate symporter [Shewanella baltica OS678]
          Length = 444

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 127/408 (31%), Positives = 225/408 (55%), Gaps = 8/408 (1%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+ +G    +    ++PLG +FV   KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIVIGMVLGIIVGVIFGEQATCLKPLGTLFVNAIKMLIVPLVFCSLIVGVTSMQDTG 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I  K+   +   +  A+ IGL+VG + +PG G+ + L    T+      +    S 
Sbjct: 81  KMGRIGIKSFGFYLFTTAIAISIGLLVGYVLQPGAGLGLTLAEGATQ-----TAKAVPSL 135

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++A+ SG ILQ ++ A+  GI+L L+GE      K  E +   ++++ 
Sbjct: 136 VDTLVDIVPTNPIAAMASGQILQVIVFAIALGIALVLIGEHGKPAIKVFESLAEAMYKLA 195

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG    L R F + S
Sbjct: 196 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYLGCIIHVLGFYSFLLRGFAKLS 255

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   +L+  +TSSS   LP  MK   E  G H+ I S V+P G + N+DG+ +
Sbjct: 256 PLQFFKGISNAMLVAFTTSSSAGTLPASMKCASENLGVHKKISSFVLPLGTTINMDGTAL 315

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L++ D  +++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 316 YQGVTVLFVAQAFGIDLTVVDYFTIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 374

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD   +N    
Sbjct: 375 GVALIAGIDRILDMVRTVVNVSGDLVATTVIAKSEDELDMAHYNADTE 422


>gi|319764743|ref|YP_004128680.1| sodium:dicarboxylate symporter [Alicycliphilus denitrificans BC]
 gi|317119304|gb|ADV01793.1| sodium:dicarboxylate symporter [Alicycliphilus denitrificans BC]
          Length = 445

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 233/416 (56%), Positives = 310/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P Y+ LY QV++AI  G+ LGHF P  G  ++PLGD F+K  KM+I PVIFLT+ TG
Sbjct: 12  VRLPFYRQLYFQVVLAIALGVLLGHFEPAYGEALKPLGDAFIKLVKMIIAPVIFLTIVTG 71

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M  +  +G++F KAM  F  FS  ALV+G++V N+ +PG GMN++   L+  ++  +
Sbjct: 72  IAGMSQLSTVGRVFGKAMAYFLFFSGLALVVGMVVANVVQPGAGMNINPADLDQTAVKTY 131

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +  SH  +  GF+ D+IP T +S     NILQ L+VA+LFG++L+LVG     +   L+ 
Sbjct: 132 VAKSHEMTLSGFVLDIIPKTLVSPFVGDNILQVLLVAVLFGVALALVGAPGRPVLNFLDA 191

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +  PVF++V IVM+ AP+GAFGAM+FTIGK+GL S+ NL +LV   Y TS  F++ VLGI
Sbjct: 192 LTEPVFKVVGIVMKAAPVGAFGAMAFTIGKFGLGSLVNLAWLVGSFYVTSLLFVVVVLGI 251

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR C FS++KL  +L+ E++LVL TSSSESALP LM+KME+AGC +S+V +VVPTGYSF
Sbjct: 252 VARLCGFSVLKLGRYLRAELMLVLGTSSSESALPSLMEKMEKAGCDKSVVGLVVPTGYSF 311

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLA LFI+QATN  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +
Sbjct: 312 NLDGTNIYMTLAALFIAQATNTELTLGHQVALLLVAMLSSKGAAGVTGAGFITLAATLAV 371

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP +P+AGM LILGVDRFMSECRS+TNF+GNAV TVVVSRWE  LD    +  +  
Sbjct: 372 VPEVPVAGMALILGVDRFMSECRSLTNFMGNAVATVVVSRWENALDHGRLDAALNG 427


>gi|330826959|ref|YP_004390262.1| C4-dicarboxylate transport protein [Alicycliphilus denitrificans
           K601]
 gi|329312331|gb|AEB86746.1| C4-dicarboxylate transport protein [Alicycliphilus denitrificans
           K601]
          Length = 445

 Score =  283 bits (723), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 233/416 (56%), Positives = 310/416 (74%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P Y+ LY QV++AI  G+ LGHF P  G  ++PLGD F+K  KM+I PVIFLT+ TG
Sbjct: 12  VRLPFYRQLYFQVVLAIALGVLLGHFEPAYGEALKPLGDAFIKLVKMIIAPVIFLTIVTG 71

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M  +  +G++F KAM  F  FS  ALV+G++V N+ +PG GMN++   L+  ++  +
Sbjct: 72  IAGMSQLSTVGRVFGKAMAYFLFFSGLALVVGMVVANVVQPGAGMNINPADLDQTAVKTY 131

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +  SH  +  GF+ D+IP T +S     NILQ L+VA+LFG++L+LVG     +   L+ 
Sbjct: 132 VAKSHEMTLSGFVLDIIPKTLVSPFVGDNILQVLLVAVLFGVALALVGAPGRPVLNFLDA 191

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +  PVF++V IVM+ AP+GAFGAM+FTIGK+GL S+ NL +LV   Y TS  F++ VLGI
Sbjct: 192 LTEPVFKVVGIVMKAAPVGAFGAMAFTIGKFGLGSLVNLAWLVGSFYVTSLLFVVVVLGI 251

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR C FS++KL  +L+ E++LVL TSSSESALP LM+KME+AGC +S+V +VVPTGYSF
Sbjct: 252 VARLCGFSVLKLGRYLRAELMLVLGTSSSESALPSLMEKMEKAGCDKSVVGLVVPTGYSF 311

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLA LFI+QATN  L+L  Q++LLL+AM+SSKGAAGVTG+ FITLAAT+ +
Sbjct: 312 NLDGTNIYMTLAALFIAQATNTHLTLGHQVALLLVAMLSSKGAAGVTGAGFITLAATLAV 371

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           VP +P+AGM LILGVDRFMSECRS+TNF+GNAV TVVVSRWE  LD    +  +  
Sbjct: 372 VPEVPVAGMALILGVDRFMSECRSLTNFMGNAVATVVVSRWENALDHGRLDAALNG 427


>gi|50123282|ref|YP_052449.1| C4-dicarboxylate transporter DctA [Pectobacterium atrosepticum
           SCRI1043]
 gi|81643544|sp|Q6CYZ1|DCTA_ERWCT RecName: Full=C4-dicarboxylate transport protein
 gi|49613808|emb|CAG77259.1| aerobic C4-dicarboxylate transport protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 430

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 204/416 (49%), Positives = 299/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF PQ+G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG+GMN+D  +L+  ++A +
Sbjct: 61  IAGMESMKSVGRTGAAALLYFEVVSTIALIIGLVVVNVVQPGVGMNIDPSTLDASAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   +E 
Sbjct: 121 TQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMFGFALHRLGPKGKVIFDVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++M++APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F+  VLG 
Sbjct: 181 FSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLVQLGQLILCFYLTCILFVFLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSES LP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKMEKVGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV+++ ++LD K  +  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKYCRELDEKKLDAELSG 416


>gi|312112849|ref|YP_004010445.1| sodium:dicarboxylate symporter [Rhodomicrobium vannielii ATCC
           17100]
 gi|311217978|gb|ADP69346.1| sodium:dicarboxylate symporter [Rhodomicrobium vannielii ATCC
           17100]
          Length = 438

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 219/416 (52%), Positives = 304/416 (73%), Gaps = 1/416 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             + P YKILY+QVL+A+  G+ LG+F P +G  M+P GD F++  KM+I PVIF TV  
Sbjct: 1   MQKKPFYKILYVQVLIAVAIGILLGYFYPNLGASMKPFGDAFIRLVKMIIAPVIFCTVVV 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA+M D+K +G++  KA+  F V S FALV+GLIV    +PG G +V+++SL+T+++  
Sbjct: 61  GIAQMGDVKRVGRVGGKALIYFEVVSTFALVLGLIVARTVQPGAGFDVNVQSLDTKAVTS 120

Query: 130 IKSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
           I S  +  S + F+  +IPDT  SALTSG ILQ L +++L G +LS +G+  + +   + 
Sbjct: 121 ITSQSSHTSVVDFLIHIIPDTIFSALTSGEILQVLFISILTGFALSAMGKDGEPVLNGIR 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
            +   VF +V ++MR AP+GAFGAM+FTIG YG+ S+ NL+ L+   Y T+  F+  VLG
Sbjct: 181 LVERLVFSIVGMIMRFAPVGAFGAMAFTIGAYGVQSLGNLVGLILTFYFTAFLFVSIVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
           I+A+   F+I KL+ +L+EE+L+VL TSSSES LP LM+KME AG  R +VSMVVPTGYS
Sbjct: 241 IIAKIVGFNIFKLLRYLREELLIVLGTSSSESVLPALMRKMEAAGASRPVVSMVVPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+TLATLFI+QATN  ++L  +L +L +AM++SKGAA VTG  FITLAAT+ 
Sbjct: 301 FNLDGTNIYMTLATLFIAQATNTHITLQHELLILGVAMLTSKGAAAVTGGGFITLAATLQ 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
            VP +P+AGM L+LGVDRFMSECR++TNFIGNAV T+V++RWE +LD +  +  + 
Sbjct: 361 AVPEIPVAGMALLLGVDRFMSECRALTNFIGNAVATLVIARWEGQLDVQKLHAALD 416


>gi|120600106|ref|YP_964680.1| sodium:dicarboxylate symporter [Shewanella sp. W3-18-1]
 gi|146291967|ref|YP_001182391.1| sodium:dicarboxylate symporter [Shewanella putrefaciens CN-32]
 gi|120560199|gb|ABM26126.1| sodium:dicarboxylate symporter [Shewanella sp. W3-18-1]
 gi|145563657|gb|ABP74592.1| sodium:dicarboxylate symporter [Shewanella putrefaciens CN-32]
 gi|319425261|gb|ADV53335.1| sodium:dicarboxylate symporter [Shewanella putrefaciens 200]
          Length = 443

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 121/407 (29%), Positives = 225/407 (55%), Gaps = 9/407 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+ + +  G+ +G  + +  V ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIFIGMVLGITVGVVLGEQAVFLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMEDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL+VG + +PG G+         +      +    S 
Sbjct: 81  KMGRIGFKSFAFYLCTTAIAISLGLLVGYVIQPGAGVPP------LQHDVVHTAKEVPSV 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++AL SG ILQ ++ A+  GI+L L+G+      K  E +   ++++ 
Sbjct: 135 MQTLIDIVPTNPIAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG   I+ R F + +
Sbjct: 195 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYLGCIIHVLGFYSIVLRVFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            +     +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PLHFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D L+++L A ++S G AGV G+  + L   ++ V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           G+ LI G+DR +   R+V N  G+ V T ++++ E +LD   +N  +
Sbjct: 374 GVALIAGIDRILDMARTVVNVSGDLVATTIIAKSEDELDEAHYNADM 420


>gi|161525909|ref|YP_001580921.1| C4-dicarboxylate transporter DctA [Burkholderia multivorans ATCC
           17616]
 gi|160343338|gb|ABX16424.1| sodium:dicarboxylate symporter [Burkholderia multivorans ATCC
           17616]
          Length = 452

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 182/415 (43%), Positives = 279/415 (67%), Gaps = 2/415 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
                L+ +V++A+  G+ALG F P     ++PLGD F+K  KM+I P++F  V +G+A 
Sbjct: 16  KFLNSLFGRVVIALILGVALGAFFPHFAESLKPLGDGFLKLIKMVIGPIVFCVVVSGMAN 75

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-- 131
             D+K +G++  KA+  F V +  AL IGL++  + +PG GMN++L SL+  S+A     
Sbjct: 76  AGDLKKVGRVGLKAVVYFEVMTTLALGIGLVLAWLTRPGEGMNINLHSLDASSLASYAKN 135

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +   K   GF+  +IPDTA+ A   G+ILQ L+ A+LFG +LSL+G+K+  +   +EE++
Sbjct: 136 AESLKDTAGFLMKIIPDTAIDAFAKGDILQILVFAVLFGSALSLLGDKAKRVNGLIEELS 195

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
              FR++  ++++APLG  GA++FT GKYG++S+  L +LV   Y + A F+  VLGI+ 
Sbjct: 196 HVFFRVIGFIIKLAPLGVLGAIAFTTGKYGVASLKQLGYLVAVFYVSCAVFVTVVLGIVM 255

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KLI +L+EE+ +VL T+SS++ LP +M+K+E  G   S V +V+PTGYSFNL
Sbjct: 256 RLAGFSVFKLIRYLREELSIVLGTASSDAVLPQVMRKLEYMGVKDSTVGLVIPTGYSFNL 315

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG +IY+TLA LFI+QATN PLS  D + +L+++M++SKGA G+ GSA + LAAT++ +P
Sbjct: 316 DGFSIYLTLAVLFIAQATNTPLSAHDLIVVLIVSMITSKGAHGIPGSAIVILAATLSAIP 375

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+ G+ LIL VD F+   R++TN IGN V TVVV+ WE  +D     + +  E
Sbjct: 376 AIPVLGLVLILPVDWFVGIARALTNLIGNCVATVVVAVWENDIDRARAKRVLNRE 430


>gi|262369598|ref|ZP_06062926.1| aerobic C4-dicarboxylate transporter [Acinetobacter johnsonii
           SH046]
 gi|262315666|gb|EEY96705.1| aerobic C4-dicarboxylate transporter [Acinetobacter johnsonii
           SH046]
          Length = 447

 Score =  282 bits (722), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 203/426 (47%), Positives = 296/426 (69%), Gaps = 15/426 (3%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV+VAI +G+ +GHF P                G    PLG  F+K  
Sbjct: 1   MTKKPIYKSLYFQVIVAIIAGILVGHFFPSGTQVINGVEKYVPGWGELFYPLGQGFIKLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NI KPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLLVINIWKPGVGM 120

Query: 116 NVDLKSLNTESIAH-IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I+  ++S   +S + F   +IP+T + A   G ILQ L+ AL+FG +L 
Sbjct: 121 NVDPSTLDTSGISKFVESGQQQSTVDFFMHIIPNTVVGAFAEGEILQVLLFALMFGFALH 180

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K +++I+   F +V+++M++AP+GAFGAM++TIGKYG+ S++ L  L+ C
Sbjct: 181 KLGDAGKPVLKFIDQISHVFFNIVNMIMKLAPIGAFGAMAYTIGKYGIGSLAQLAQLIIC 240

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  VLG ++R C FSI+K+I  ++EE+L+VL TSSSES LP ++KK+E AGC
Sbjct: 241 FYITCLLFIFLVLGTISRLCGFSILKMIRMIREELLIVLGTSSSESVLPRMLKKLEIAGC 300

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L L  Q++LL + ++SSKGAAG
Sbjct: 301 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDLMHQVTLLGVLLISSKGAAG 360

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W  +L
Sbjct: 361 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGQL 420

Query: 415 DPKLFN 420
           D +  N
Sbjct: 421 DQEKLN 426


>gi|304410588|ref|ZP_07392206.1| sodium:dicarboxylate symporter [Shewanella baltica OS183]
 gi|307304681|ref|ZP_07584431.1| sodium:dicarboxylate symporter [Shewanella baltica BA175]
 gi|304351072|gb|EFM15472.1| sodium:dicarboxylate symporter [Shewanella baltica OS183]
 gi|306912083|gb|EFN42507.1| sodium:dicarboxylate symporter [Shewanella baltica BA175]
          Length = 444

 Score =  282 bits (722), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 127/408 (31%), Positives = 226/408 (55%), Gaps = 8/408 (1%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+ +G    +    ++PLG +FV   KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIVIGMVLGIIVGVIFGEQATCLKPLGTLFVNAIKMLIVPLVFCSLIVGVTSMQDTG 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ IGL+VG + +PG G+ + L     +      +    S 
Sbjct: 81  KMGRIGFKSFGFYLFTTAIAISIGLLVGYVLQPGAGLGLTLAEGAIQ-----TAKAVPSL 135

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++A+ SG ILQ ++ A+  GI+L L+GE      K  E +   ++++ 
Sbjct: 136 VDTLVDIVPTNPIAAMASGQILQVIVFAIALGIALVLIGEHGKPAIKVFESLAEAMYKLA 195

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG    L R F + S
Sbjct: 196 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYLGCIIHVLGFYSFLLRGFAKLS 255

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   +L+  +TSSS   LP  MK   E  G H+ I S V+P G + N+DG+ +
Sbjct: 256 PLQFFKGISNAMLVAFTTSSSAGTLPASMKCASENLGVHKKISSFVLPLGTTINMDGTAL 315

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L++ D L+++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 316 YQGVTVLFVAQAFGIDLTIVDYLTIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 374

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD   +N    
Sbjct: 375 GVALIAGIDRILDMVRTVVNVSGDLVATTVIAKSEDELDMAHYNADTE 422


>gi|111019570|ref|YP_702542.1| C4-dicarboxylate transporter [Rhodococcus jostii RHA1]
 gi|110819100|gb|ABG94384.1| C4-dicarboxylate transporter, DAACS family protein [Rhodococcus
           jostii RHA1]
          Length = 477

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 163/427 (38%), Positives = 260/427 (60%), Gaps = 2/427 (0%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           M E        +   Y+ L++QVL+ I  G+A G   P+    + PLG+ F+K  KM+++
Sbjct: 1   MSEVEIAAKPTKQRWYRSLFVQVLIGIALGIATGILFPEFSHHLAPLGEGFIKLIKMVVS 60

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           P+IFL + TGIA++  MK +G+I  KA+  F   + FAL +GL+VGN+ KPG G+N+D  
Sbjct: 61  PLIFLVIVTGIAKVGSMKALGKIGGKALLWFTAATTFALGLGLLVGNLVKPGSGLNIDPA 120

Query: 121 SLNTESI-AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
           +L+T ++    +  H    + F+  +IP +   A    N+LQ L+ A+LFG++L+   E 
Sbjct: 121 TLDTSALDEKTQGGHLPGGVEFVMHIIPTSVFDAFAQNNLLQVLLFAILFGVALASFSES 180

Query: 180 SDT-IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYAT 238
           +   +   +++    +FR+V  +M +APLGAFGAM+FT+G YG  S+ +   L+   Y  
Sbjct: 181 APPILMDVIDQTLHVIFRIVGYIMYLAPLGAFGAMAFTVGNYGAGSLKSFGMLILACYGA 240

Query: 239 SAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSI 298
           +  FI+ +  ++      +  K I + +EE +L L T SSE+ +P ++KK++ AGC R++
Sbjct: 241 ALVFIVVLSIVVKLITGVNAWKFIKYCREEFMLALGTGSSEAVMPRIIKKLDNAGCDRAV 300

Query: 299 VSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGS 358
           V +V+PTGYSFNLDG+ IY++LA +F++QA  V L   +QL+++ I ++SSKG AGV GS
Sbjct: 301 VGLVIPTGYSFNLDGAAIYLSLAMMFLAQAVGVDLGFGEQLAIMGILILSSKGMAGVPGS 360

Query: 359 AFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
           AF+ L+AT   + + P+A + L+LG DR M   R  TN +GN + T VV+ WE  LD   
Sbjct: 361 AFVALSATAAAIGAFPVAAVALLLGADRLMDSMRVFTNLLGNCLATFVVANWEGMLDKDK 420

Query: 419 FNKYIGI 425
               +  
Sbjct: 421 MRAVLDG 427


>gi|152980503|ref|YP_001353686.1| C4-dicarboxylate transporter DctA [Janthinobacterium sp. Marseille]
 gi|172049089|sp|A6SZI9|DCTA_JANMA RecName: Full=C4-dicarboxylate transport protein
 gi|151280580|gb|ABR88990.1| dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family
           [Janthinobacterium sp. Marseille]
          Length = 439

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 207/418 (49%), Positives = 292/418 (69%), Gaps = 1/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             +PPLYK LY QV+VAI  G+ LGHF+P+ G  M+PLGD F+K  KM+I PVIF TV  
Sbjct: 1   MKKPPLYKSLYAQVIVAIIIGVLLGHFLPETGTAMKPLGDGFIKLIKMIIAPVIFCTVVI 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G+    A+  F V S  AL++GLI+ N+ +PG GMNVD+ +L+T S+A 
Sbjct: 61  GIAGMEDMKKVGKTGGLALLYFEVMSTVALLVGLIIVNVLQPGAGMNVDVSTLDTASLAS 120

Query: 130 IK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
                  ++   F   +IP + + A   G++LQ L+V++LFG +L  +G +   +   +E
Sbjct: 121 YTAPGKLETVTEFAMHIIPMSMIDAFAKGDVLQVLLVSVLFGFALQKLGGRGTLVFDFIE 180

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
           +I+  +F +V  +MR AP+GAFGAM+FTIGKYG+SS+ +L  L+   Y T  FFI  VLG
Sbjct: 181 KISHVLFTIVGFIMRAAPVGAFGAMAFTIGKYGISSLLSLGKLMGAFYLTCLFFIFVVLG 240

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
           I+ R   FSI K + ++KEE+L+VL TSSSES LP ++ KME  G  +S+V +V+PTGYS
Sbjct: 241 IVTRLHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMIAKMENMGAKKSVVGLVIPTGYS 300

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+ IY+T+A +FI+QATN P+SL  Q++LL + +++SKGAAG+TGS FI LAAT++
Sbjct: 301 FNLDGTAIYLTMAAVFIAQATNTPMSLMQQVTLLAVLLLTSKGAAGITGSGFIVLAATLS 360

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            V  +P+AG+ LILG+DRFMSE R++TN IGN V T+VV++W   LD    +  +  E
Sbjct: 361 AVGHVPVAGLALILGIDRFMSEARALTNTIGNGVATLVVAKWVGDLDMDKLHAELDNE 418


>gi|261819449|ref|YP_003257555.1| C4-dicarboxylate transporter DctA [Pectobacterium wasabiae WPP163]
 gi|261603462|gb|ACX85948.1| sodium:dicarboxylate symporter [Pectobacterium wasabiae WPP163]
          Length = 430

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 203/416 (48%), Positives = 299/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF PQ+G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMN+D  +L+  ++A +
Sbjct: 61  IAGMESMKSVGRTGAAALLYFEIVSTIALIIGLIVVNVVQPGVGMNIDPSTLDASAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   ++ 
Sbjct: 121 TQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMFGFALHRLGPKGKVIFDVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++M++APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F+  VLG 
Sbjct: 181 FSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLVQLGQLILCFYITCVLFVFLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSES LP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKMEKVGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV+++ ++LD K  +  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKYCRELDEKKLDAELSG 416


>gi|118469979|ref|YP_888773.1| sodium:dicarboxylate symporter [Mycobacterium smegmatis str. MC2
           155]
 gi|118171266|gb|ABK72162.1| sodium:dicarboxylate symporter [Mycobacterium smegmatis str. MC2
           155]
          Length = 455

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 167/424 (39%), Positives = 264/424 (62%), Gaps = 6/424 (1%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
              R P Y  L+IQ+LVAI +G+ +G   P +G  ++PL D F+K  KMLI P+IF TV 
Sbjct: 4   SATRSPWYSSLFIQLLVAIVAGIVVGWLWPDVGGSLKPLADGFIKLIKMLIAPIIFCTVV 63

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
            GIA + D+K +G+I  KA+  F   + FAL+ GL+VGN+ KPG G N+D ++L T + A
Sbjct: 64  LGIAHVGDLKSVGRIGVKALIYFEAITTFALLFGLVVGNVVKPGAGFNIDAQTLATGAEA 123

Query: 129 HIKSSHAKSF---IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIR- 184
               +        + F+ ++IP + +SA     +LQ L  A+LFG+ L+  GE    +  
Sbjct: 124 VAAKTGDGELPHTVEFLLNIIPSSVVSAFAENALLQVLFFAVLFGLGLAKFGEHGPPVVL 183

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
           + ++ ++   F ++  +MR+APLGAFGAM++ IG+YG+ S+ +   L+   Y  +A FI+
Sbjct: 184 EFIDHLSHIFFTVIGWIMRLAPLGAFGAMAYIIGQYGIGSLGSYAKLIAACYVAAALFIV 243

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            +  +   F   ++ K  +++K+E+ L L T+S+E  LP +M K+  AGC R+   +VVP
Sbjct: 244 ILAVVTKVFAGVNLWKFFLYIKDEMFLALGTASTEVVLPRVMAKLTNAGCSRTTTGLVVP 303

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDG+ +Y+++  LF++QA  V LSL +Q+  +L+ M++SKG AGV GS+F+ L+
Sbjct: 304 TGYSFNLDGATLYLSICVLFLAQALGVDLSLGEQIMAVLVLMLTSKGMAGVPGSSFLALS 363

Query: 365 ATITLV--PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           AT+  +   ++P+A + L+LG DR M   R   N +GN V T+VV+ WE +LD +   K 
Sbjct: 364 ATVAAIGHGAIPVAAVALLLGADRIMDSMRVSVNLLGNCVATLVVAAWEGQLDRERMRKV 423

Query: 423 IGIE 426
           +  E
Sbjct: 424 LAGE 427


>gi|289624196|ref|ZP_06457150.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298486159|ref|ZP_07004222.1| C4-dicarboxylate transport protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159166|gb|EFI00224.1| C4-dicarboxylate transport protein [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330868086|gb|EGH02795.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 447

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 196/415 (47%), Positives = 292/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+ G  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPETGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ + A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ S++   S
Sbjct: 62  RMENMKELGRVGFWALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSSLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IPDT + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPDTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTIGKYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG  IY T+A +FI+QATN PL+L DQL +L++ M +SKG+AGVTGS FI LAAT+  + 
Sbjct: 302 DGQAIYYTIAAIFIAQATNTPLTLADQLIVLVVLMFTSKGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++TN IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|156936309|ref|YP_001440225.1| C4-dicarboxylate transporter DctA [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156534563|gb|ABU79389.1| hypothetical protein ESA_04209 [Cronobacter sakazakii ATCC BAA-894]
          Length = 437

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 206/417 (49%), Positives = 299/417 (71%), Gaps = 1/417 (0%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
             ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV 
Sbjct: 8   TPMKRSLFKSLYFQVLTAIAIGILLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVV 67

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
           TGIA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMNVD  +L+ +++A
Sbjct: 68  TGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLVIVNLVQPGAGMNVDPATLDAKAVA 127

Query: 129 -HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
            + + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G     I   +
Sbjct: 128 VYAEQAQQQGIVAFLMDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGRNGQLIFNVI 187

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E  +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VL
Sbjct: 188 ESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIVCFYITCILFVVVVL 247

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +AR   F+I K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGY
Sbjct: 248 GSIARATGFNIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGY 307

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI
Sbjct: 308 SFNLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATI 367

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           + V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  N  + 
Sbjct: 368 SAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDEKQLNDTLN 424


>gi|126652250|ref|ZP_01724429.1| C4-dicarboxylate transport protein [Bacillus sp. B14905]
 gi|126590982|gb|EAZ85094.1| C4-dicarboxylate transport protein [Bacillus sp. B14905]
          Length = 419

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 190/411 (46%), Positives = 281/411 (68%)

Query: 16  YKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           +K L +QVL+AI  G+ +G   P+ G +++ L DIF+K  KMLI P+IFLTV  GI  M 
Sbjct: 5   FKNLTVQVLIAIVLGIIVGATFPEFGAKLKILADIFIKLIKMLIAPIIFLTVVIGIGSMG 64

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHA 135
           D+K +G+I  KA+  F + S FAL IGLIV NI +PG G N +  +    S     ++  
Sbjct: 65  DVKKVGKIGGKALIYFEIVSTFALAIGLIVVNIVQPGKGFNTEAANGADVSQYTNAAAAE 124

Query: 136 KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVF 195
                F+  +IPD  + AL +G +L  L  A+LFG++ + +GE +  + K  E++    F
Sbjct: 125 HGLGAFIMQIIPDNVVGALANGELLPVLFSAVLFGLAAAAIGEPAKPVIKFFEQVADIFF 184

Query: 196 RMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCR 255
           ++V++VM+I+P+GAFGAMS+TIG +GL S+ NL FL+  +Y T   FI+ ++G ++ +  
Sbjct: 185 KIVNMVMKISPIGAFGAMSYTIGNFGLKSLGNLGFLMLSVYITMFIFIVVIIGFISHYFG 244

Query: 256 FSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSN 315
           FSI K I ++K+E+ +V+ TSSSESALP +M+K+E  GC + +V +V+PTGYSFNLDG++
Sbjct: 245 FSIFKFIKYIKDEIFIVIGTSSSESALPSMMRKLENYGCSKQVVGLVIPTGYSFNLDGTS 304

Query: 316 IYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI 375
           IY+++A +FI+QA  V L +  Q++LL I M++SKGAAGVTGS FITLAAT+   P +P+
Sbjct: 305 IYLSMAAIFIAQAYGVDLDIWHQITLLAILMLTSKGAAGVTGSGFITLAATLAAFPMIPV 364

Query: 376 AGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            G+ L++GVDRFMSE R+VTN IGN V TVVVS+ EK+ D +   + +  +
Sbjct: 365 EGIALLIGVDRFMSEARAVTNLIGNGVATVVVSKMEKEFDTEQEKRALSGQ 415


>gi|295097120|emb|CBK86210.1| Na+/H+-dicarboxylate symporters [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 428

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGIVAFLLDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIVCFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  N  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLNDTLN 415


>gi|171769884|sp|A7MKP4|DCTA_ENTS8 RecName: Full=C4-dicarboxylate transport protein
          Length = 428

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKRSLFKSLYFQVLTAIAIGILLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLVIVNLVQPGAGMNVDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G     I   +E 
Sbjct: 121 AEQAQQQGIVAFLMDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGRNGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIVCFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFNIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD K  N  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDEKQLNDTLN 415


>gi|71737092|ref|YP_273825.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71557645|gb|AAZ36856.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320325254|gb|EFW81321.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 447

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 195/415 (46%), Positives = 293/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+ G  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPETGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ ++A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ S++   S
Sbjct: 62  RMENMKELGRVGFRALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSSLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IPDT + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPDTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTIGKYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           D   IY T+A +FI+QATN PL+LTDQL +L++ M +S+G+AGVTGS FI LAAT+  + 
Sbjct: 302 DRQAIYYTIAAIFIAQATNTPLTLTDQLIVLVVLMFTSEGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++TN IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|254250663|ref|ZP_04943982.1| Na+/H+-dicarboxylate symporters [Burkholderia cenocepacia PC184]
 gi|124879797|gb|EAY67153.1| Na+/H+-dicarboxylate symporters [Burkholderia cenocepacia PC184]
          Length = 535

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 155/416 (37%), Positives = 255/416 (61%), Gaps = 4/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ L +QVL ++  G+  G   P+ G Q++ LGD+F+   K  + P++FLT+  GI
Sbjct: 84  KRPWYRKLGMQVLASLVLGVVAGLLFPKFGTQLKILGDVFLALIKAGVAPLVFLTIVHGI 143

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A   D+K  G++ W+A+  F V S  AL  GL+ GN+ + G GM         +      
Sbjct: 144 ASAGDVKSAGRVGWRAIVYFEVVSTIALAFGLLAGNLLQTGQGMT---SVAVGKVPVAAA 200

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGE-KSDTIRKCLEEI 190
            +  + F  F+  ++PD  + A   G +LQ + +A++ GI +  + E +   I   L++I
Sbjct: 201 KAAPQGFTEFVMHLVPDNFIGAFAKGELLQVVALAVMVGIGILAIPEGRRARINDGLDQI 260

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F  +++VM++APLG FGA++F +G  G + +  L  LV   YA    FI+ V+GI+
Sbjct: 261 SEVLFSFINLVMKLAPLGTFGAIAFAVGSNGTAVLVALAQLVLSFYAVVVLFIVVVMGIV 320

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           A+   FS+ + + ++K+E+L+VL T+SSESALP L+ K+E  GC +  V +V+PTGY+FN
Sbjct: 321 AKLAGFSMWRFMRYIKDEILIVLGTASSESALPRLLIKLERLGCAKQTVGLVLPTGYAFN 380

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++I++ +  +FI+ A NVPL+   Q+ +LL+ +++SKGAA V+G +F+  AAT+T  
Sbjct: 381 LDGTSIFMAMGVMFIAHAYNVPLTFEHQMGILLLMLLTSKGAATVSGGSFVVFAATVTST 440

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             LP+ G+ LI GV RFMS   +  N IGN++ TVVV++W    D  +  +++  E
Sbjct: 441 GLLPVEGLALIFGVYRFMSMAIATCNTIGNSLATVVVAKWSGTFDETVARRHLYPE 496


>gi|289647241|ref|ZP_06478584.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 447

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 197/415 (47%), Positives = 293/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+IG  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPEIGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ + A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ S++   S
Sbjct: 62  RMENMKELGRVGFWALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSSLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IPDT + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPDTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTIGKYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG  IY T+A +FI+QATN PL+L DQL +L++ M +SKG+AGVTGS FI LAAT+  + 
Sbjct: 302 DGQAIYYTIAAIFIAQATNTPLTLADQLIVLVVLMFTSKGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++TN IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|194014562|ref|ZP_03053179.1| proton/sodium-glutamate symport protein (Glutamate-aspartate
           carrierprotein) [Bacillus pumilus ATCC 7061]
 gi|194013588|gb|EDW23153.1| proton/sodium-glutamate symport protein (Glutamate-aspartate
           carrierprotein) [Bacillus pumilus ATCC 7061]
          Length = 429

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 138/419 (32%), Positives = 245/419 (58%), Gaps = 6/419 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             L   L  Q+L+ +  G+ +G      P +   ++P+GD F++  KM++ P++  ++  
Sbjct: 2   KKLKFGLATQILIGLILGVVVGAIFFGNPGVETYLKPIGDFFLRLIKMIVIPIVVSSLIL 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESI 127
           G+A   D K +G++ ++ +  F + + FA+++GL++ N  +PG G++         ++ +
Sbjct: 62  GVAGAGDGKKVGKLGFRTILYFEIITTFAIILGLVLANFVQPGAGVDFGNTEKQDISQYV 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              K   +KS       ++P     +L  G++L  +   +LF + +S +GE+   +    
Sbjct: 122 ETEKEQSSKSVADTFLHIVPTNFFQSLAEGDLLAIIFFTVLFALGVSAIGERGKPVLAFF 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E ++  +F +V++VM+ AP G F  +  T+ K+GL S+ +L  LV  +Y   A F++ V 
Sbjct: 182 EGVSHAMFHVVNVVMKAAPFGVFALIGVTVSKFGLESLISLGKLVGLVYFALALFLIVVF 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+ +    +I + + ++K+E+LL  STSSSE+ LP +M KME  GC + IVS V+P GY
Sbjct: 242 GIIGKMIGVNIFRFLAYMKDEMLLAFSTSSSETVLPRVMDKMERIGCPKGIVSFVIPIGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FNLDGS +Y  +A LF++Q   + L++  QL+L+L+ MV+SKG A V G++F+ L AT+
Sbjct: 302 TFNLDGSVLYQAIAALFLAQVYGIDLTIVQQLTLVLVLMVTSKGMAAVPGTSFVVLLATL 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             +  +P  G+  I GVDR M   R+V N  GNA+  VV+S+WE + DP+  ++ +  +
Sbjct: 362 GTI-GVPAEGLAFIAGVDRIMDMARTVVNLTGNALAAVVMSKWEGQYDPEKGHRVMTGQ 419


>gi|238757381|ref|ZP_04618567.1| C4-dicarboxylate transport protein [Yersinia aldovae ATCC 35236]
 gi|238704420|gb|EEP96951.1| C4-dicarboxylate transport protein [Yersinia aldovae ATCC 35236]
          Length = 430

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKASIFKSLYFQVLTAITLGVLLGHFYPDIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG+GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGVGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIVPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTQMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCKQLDNDQLQAVLS 415


>gi|295691327|ref|YP_003595020.1| sodium:dicarboxylate symporter [Caulobacter segnis ATCC 21756]
 gi|295433230|gb|ADG12402.1| sodium:dicarboxylate symporter [Caulobacter segnis ATCC 21756]
          Length = 443

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 232/413 (56%), Positives = 307/413 (74%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y  LY+QV+VAI +G  +GHF P+ G  ++PLGD F+K  KM+I PVIFLT++TGIA 
Sbjct: 16  PWYAQLYVQVMVAIIAGALIGHFWPKFGADLKPLGDAFIKLVKMVIAPVIFLTIATGIAG 75

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS- 132
           M+D+   G++  KA   F  FS  ALV+GL+VGN+  PG GMN+D  +L+++ +A   + 
Sbjct: 76  MRDLGKFGRVVLKAFAYFLTFSTLALVLGLVVGNLVHPGAGMNIDPATLHSDKVADYAAK 135

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +H  + +GF+ ++IP T  +A   G+ILQ L  ++LFG+SL L+G+K   +   LE I  
Sbjct: 136 AHETTIVGFLSNIIPTTVTAAFADGDILQVLFFSILFGVSLVLIGDKGQPVVDLLESIAH 195

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             FR+V ++M+ AP+GAFGA +FTIGKYG+ S+ NL  LV   Y TS  F++ VLG +A 
Sbjct: 196 AFFRLVGLLMKAAPIGAFGAFAFTIGKYGIGSVVNLAALVATFYVTSIIFVIVVLGAVAW 255

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSI+KLI +LK E+LLVL TSSSESALP L+ K+E AGC + +V +VVPTGYSFNLD
Sbjct: 256 FNGFSILKLIRYLKSELLLVLGTSSSESALPSLIDKLERAGCAKPVVGLVVPTGYSFNLD 315

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QAT V LSL DQL LL +AM+SSKGAAGVTG+ FITLAAT+++VPS
Sbjct: 316 GTNIYMTLAALFIAQATGVHLSLGDQLLLLSVAMLSSKGAAGVTGAGFITLAATLSVVPS 375

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILGVDRFMSECR++TNFIGNAV T+VVSRWEK LD +  +  +  
Sbjct: 376 VPVAGMALILGVDRFMSECRALTNFIGNAVATIVVSRWEKALDKEALDAALAG 428


>gi|154248662|ref|YP_001419620.1| sodium:dicarboxylate symporter [Xanthobacter autotrophicus Py2]
 gi|154162747|gb|ABS69963.1| sodium:dicarboxylate symporter [Xanthobacter autotrophicus Py2]
          Length = 453

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 208/417 (49%), Positives = 302/417 (72%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R P YKILY+QVL AI  G+ALGHF P + +QM+PLGD F+K  KMLI  VIF TV +G
Sbjct: 10  TRKPFYKILYVQVLFAIAVGIALGHFWPTLAIQMKPLGDGFIKLIKMLIALVIFCTVVSG 69

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M+ MK IG+I  K++  F V S  AL IG+IVGN+ +PG G NVD  +L+ +++ ++
Sbjct: 70  IAGMESMKKIGRIGGKSLLYFEVVSTLALAIGMIVGNVLRPGAGFNVDPATLDAKAVMSY 129

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  ++ + F+ ++IP+T + A   G+IL  +++++LFG  LS +GEK   +++ ++ 
Sbjct: 130 AGKAQEQTIVEFLLNIIPNTVVDAFAKGDILSVVMISVLFGCVLSRLGEKGRLVKEMIDG 189

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  VF  +++VM++AP GAFGAM+FTIG+YG++S+  L+ L+   Y TS  F+L VLG 
Sbjct: 190 TSGLVFGAINVVMKLAPAGAFGAMAFTIGRYGIASLGPLLQLILAFYLTSLIFVLVVLGA 249

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSII+ + ++KEE+L+VL TSSS+SALP LM K+E  GC R +V +VVPTGY F
Sbjct: 250 IARAAGFSIIRFLAYIKEEILIVLGTSSSDSALPSLMAKLERLGCSRPVVGLVVPTGYVF 309

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           N DG++IY+T+A LF++QATN  L+LT QLS+  +AM++SKGA+GVTG++FI L  T+++
Sbjct: 310 NTDGTSIYMTMAALFVAQATNTDLTLTQQLSIFAVAMLTSKGASGVTGASFIALVGTLSV 369

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P+AGM LILG+DRFMSE R++ N IGN V TVV++RWE +LD       +  E
Sbjct: 370 VPTIPVAGMALILGIDRFMSEARALVNMIGNGVATVVMARWEGELDHARLTAVLRGE 426


>gi|157691747|ref|YP_001486209.1| DAACS family dicarboxylate/amino acid:cation symporter [Bacillus
           pumilus SAFR-032]
 gi|157680505|gb|ABV61649.1| DAACS family dicarboxylate/amino acid:cation symporter [Bacillus
           pumilus SAFR-032]
          Length = 429

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 138/419 (32%), Positives = 244/419 (58%), Gaps = 6/419 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             L   L  Q+L+ +  G+ +G      P +   ++P+GD F++  KM++ P++  ++  
Sbjct: 2   KKLKFGLATQILIGLILGVVVGAIFFGNPGVETYLKPIGDFFLRLIKMIVIPIVVSSLIL 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESI 127
           G+A   D K +G++ ++ +  F + + FA+++GL++ N  +PG G++         ++ +
Sbjct: 62  GVAGAGDGKKVGKLGFRTILYFEIITTFAIILGLVLANFVQPGAGVDFGHTEKQDISQYV 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              K    KS       ++P     +L  G++L  +   +LF + +S +GE+   +    
Sbjct: 122 ETEKEQSGKSIADTFLHIVPTNFFQSLAEGDLLAIIFFTVLFALGVSAIGERGKPVLAFF 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E ++  +F +V++VM+ AP G F  +  T+ K+GL S+ +L  LV  +Y   A F++ V 
Sbjct: 182 EGVSHAMFHVVNVVMKAAPFGVFALIGVTVSKFGLESLISLGKLVGLVYFALALFLIVVF 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+ +    +I + + ++K+E+LL  STSSSE+ LP +M KME  GC + IVS V+P GY
Sbjct: 242 GIIGKMIGVNIFRFLAYMKDEMLLAFSTSSSETVLPRVMDKMERIGCPKGIVSFVIPIGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FNLDGS +Y  +A LF++Q   + L++  QL+L+L+ MV+SKG A V G++F+ L AT+
Sbjct: 302 TFNLDGSVLYQAIAALFLAQVYGIDLTIVQQLTLILVLMVTSKGMAAVPGTSFVVLLATL 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
             +  +P  G+  I GVDR M   R+V N  GNA+  VV+S+WE + DP+  ++ +  +
Sbjct: 362 GTI-GVPAEGLAFIAGVDRIMDMARTVVNLTGNALAAVVMSKWEGQYDPEKGHRVMTGQ 419


>gi|206559120|ref|YP_002229880.1| C4-dicarboxylate transporter DctA [Burkholderia cenocepacia J2315]
 gi|198035157|emb|CAR51031.1| C4-dicarboxylate transport protein [Burkholderia cenocepacia J2315]
          Length = 421

 Score =  281 bits (719), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 210/408 (51%), Positives = 303/408 (74%), Gaps = 1/408 (0%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           LY+QV+ AI  G+ LGH+ P +   M+PLGD F+K  KM+I P+IF TV TGIA M+DMK
Sbjct: 2   LYVQVIFAIIVGVILGHYYPALATDMKPLGDGFIKLIKMVIGPIIFCTVVTGIAGMEDMK 61

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS-SHAKS 137
            +G++  KA+  F + S FAL++GL   ++ +PG+G N+D  +L+ +++A   + +H +S
Sbjct: 62  KVGRVGGKALLYFEIVSTFALLLGLAATHLLRPGVGFNIDPATLDGKAVASYAAKAHGQS 121

Query: 138 FIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRM 197
            + F+  +IP+T + A   G ILQ L++ALLFG  L+ +GE+   +   ++ +   +F +
Sbjct: 122 TVDFLMHIIPNTMVDAFAQGEILQILLIALLFGSVLAHLGERGRVVTDFIDGLTRVLFGI 181

Query: 198 VSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFS 257
           V IV ++AP+GAFGAM+FTIGKYG+ S+  L+ L+   Y TS  F+L VLG +ARF  FS
Sbjct: 182 VHIVTKLAPIGAFGAMAFTIGKYGVGSLVPLLKLIGTFYLTSVVFVLVVLGAIARFTGFS 241

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIY 317
           II+ + ++KEE+L+VL TSSSE+ALP LM+K+E+AGC RS+V +VVPTGYSFNLDG+NIY
Sbjct: 242 IIRFVSYIKEELLIVLGTSSSEAALPQLMEKLEKAGCSRSVVGLVVPTGYSFNLDGTNIY 301

Query: 318 ITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAG 377
           +T+A LFI+QATN+ L+   QL+LL +AM++SKGA+GVTG+ FITLAAT+ +VP++P++G
Sbjct: 302 MTMAVLFIAQATNIELTWMQQLTLLAVAMLTSKGASGVTGAGFITLAATLAVVPTIPLSG 361

Query: 378 MTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           M LILG+DRFMSECR++TN +GN V TVVVS WEK+LD     + +  
Sbjct: 362 MVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLRQALKG 409


>gi|311277546|ref|YP_003939777.1| sodium:dicarboxylate symporter [Enterobacter cloacae SCF1]
 gi|308746741|gb|ADO46493.1| sodium:dicarboxylate symporter [Enterobacter cloacae SCF1]
          Length = 428

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 211/415 (50%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+P GD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAVGILLGHFYPELGAQMKPFGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+  ++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTLALIIGLIIVNLVQPGAGMNVDPATLDAHAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGVVAFLLDIIPSSVIGAFASGNILQVLMFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F ++++VMR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMVMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I ++KEE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVTGFSIFKFIRYIKEELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDSKKLDDVLN 415


>gi|145590212|ref|YP_001156809.1| C4-dicarboxylate transporter DctA [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|189082864|sp|A4T0I1|DCTA_POLSQ RecName: Full=C4-dicarboxylate transport protein
 gi|145048618|gb|ABP35245.1| sodium:dicarboxylate symporter [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 442

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 199/421 (47%), Positives = 292/421 (69%), Gaps = 1/421 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
                +PP+YK+LY QVL A+  G+ LGHF P +GV M+P GD F+K  KMLI P+IF T
Sbjct: 2   TATLKKPPIYKVLYFQVLTAVVIGVLLGHFYPSLGVDMKPFGDAFIKGIKMLIAPIIFCT 61

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V  GIA M+DMK +G+    A+  F + S  AL++GL+V N+ +PG GMN+D  SL+T+ 
Sbjct: 62  VVLGIAGMEDMKKVGKTGGLALLYFEIVSTIALMVGLVVVNVLQPGAGMNIDPASLDTKG 121

Query: 127 IAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           IA         +   F+ ++IP +A+ A   G ILQ L +A+LFG +L   G +   +  
Sbjct: 122 IAAYTGPGKMGTTTEFLLNIIPSSAVDAFAKGEILQVLFIAILFGFALHKFGGRGTMVFD 181

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            +E+ +  +F M++I+M+ AP+GAFGAM+FTIGKYG+ S+ +L  L+   Y T   F+  
Sbjct: 182 LIEKTSHVLFDMIAIIMKFAPIGAFGAMAFTIGKYGIGSLFSLGKLMGSFYLTCLLFVFI 241

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLGI+AR   F+I K + ++KEE+L+VL TSSSES LP +M+KME  G  ++ V +V+PT
Sbjct: 242 VLGIIARLNGFNIFKFVRYIKEELLIVLGTSSSESVLPRMMEKMELLGAKKACVGLVIPT 301

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG++IY+T+A +FI+QATN P++L  +++LL + +++SKGAAGVTGS FI LAA
Sbjct: 302 GYSFNLDGTSIYLTMAAVFIAQATNTPMTLLQEVTLLAVLLLTSKGAAGVTGSGFIVLAA 361

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           T++ V  +P+AG+ +ILG+DRFMSE R++TN +GN V T+VV++W  +LD K   + +  
Sbjct: 362 TLSAVGDVPVAGLAIILGIDRFMSEARALTNLVGNGVATIVVAKWTGELDQKQLTRALNR 421

Query: 426 E 426
           +
Sbjct: 422 D 422


>gi|229132338|ref|ZP_04261192.1| Proton glutamate symport protein [Bacillus cereus BDRD-ST196]
 gi|228651044|gb|EEL07025.1| Proton glutamate symport protein [Bacillus cereus BDRD-ST196]
          Length = 424

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 136/410 (33%), Positives = 249/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G       ++   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFGNQEVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+ +GL++ NI +PG G+++D  +    ++     +  
Sbjct: 66  DIKKLGRLGGKTIIYFEIITTIAIAVGLLIANIFQPGKGVDMDKLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLAEGDMLAIIFFSVLFGLGVAAIGERGKPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIELSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PAEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|261342008|ref|ZP_05969866.1| aerobic C4-dicarboxylate transport protein [Enterobacter
           cancerogenus ATCC 35316]
 gi|288315925|gb|EFC54863.1| aerobic C4-dicarboxylate transport protein [Enterobacter
           cancerogenus ATCC 35316]
          Length = 428

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLTAIAVGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAIY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGVVAFLLDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQIIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARAAGFNIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHKKLDDTLN 415


>gi|217974635|ref|YP_002359386.1| sodium:dicarboxylate symporter [Shewanella baltica OS223]
 gi|217499770|gb|ACK47963.1| sodium:dicarboxylate symporter [Shewanella baltica OS223]
          Length = 444

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 128/408 (31%), Positives = 228/408 (55%), Gaps = 8/408 (1%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+ +G    +    ++PLG +FV   KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIVIGMVLGIIVGVIFGEQATCLKPLGTLFVNAIKMLIVPLVFCSLIVGVTSMQDTG 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ IGL+VG + +PG G+ + L    T+      +    S 
Sbjct: 81  KMGRIGFKSFGFYLFTTAIAISIGLLVGYVLQPGAGLGLTLAEGATQ-----TAKAVPSL 135

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++A+ SG ILQ ++ A+  GI+L L+GE   +  K  E +   ++++ 
Sbjct: 136 VDTLVDIVPTNPIAAMASGQILQVIVFAIALGIALVLIGEHGKSAIKVFESLAEAMYKLA 195

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      +LG    L R F + S
Sbjct: 196 DMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYLGCIIHVLGFYSFLLRGFAKLS 255

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   +L+  +TSSS   LP  MK   E  G H+ I S V+P G + N+DG+ +
Sbjct: 256 PLQFFKGISNAMLVAFTTSSSAGTLPASMKCASENLGVHKKISSFVLPLGTTINMDGTAL 315

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L++ D L+++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 316 YQGVTVLFVAQAFGIDLTVVDYLTIILTATLASIGTAGVPGAGLVMLTLVMTTV-GLPLE 374

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +LD   +N    
Sbjct: 375 GVALIAGIDRILDMVRTVVNVSGDLVATTVIAKSEDELDMAHYNADTE 422


>gi|324327484|gb|ADY22744.1| C4-dicarboxylate transporter DctA [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 420

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 177/412 (42%), Positives = 275/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIIKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWVDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 FYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDEEKYTRVIE 411


>gi|227328200|ref|ZP_03832224.1| C4-dicarboxylate transporter DctA [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 430

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 203/416 (48%), Positives = 299/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF PQ+G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ +PG+GMN+D  +L+  ++A +
Sbjct: 61  IAGMESMKSVGRTGAVALLYFEIVSTIALIIGLVVVNVVQPGVGMNIDPSTLDASAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   ++ 
Sbjct: 121 TQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMFGFALHRLGPKGKVIFDVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++M++APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F+  VLG 
Sbjct: 181 FSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLIQLGQLIACFYITCVLFVFLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSES LP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKMEKVGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV+++ ++LD K  +  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKYCRELDEKKLDAELSG 416


>gi|296105259|ref|YP_003615405.1| C4-dicarboxylate transporter DctA [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059718|gb|ADF64456.1| C4-dicarboxylate transporter DctA [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 428

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTLALIIGLIIVNVVQPGAGMNVDPSTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGVVAFLLDVIPGSVIGAFASGNILQVLLFAVMFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARAAGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHKKLDDTLN 415


>gi|297562479|ref|YP_003681453.1| sodium:dicarboxylate symporter [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846927|gb|ADH68947.1| sodium:dicarboxylate symporter [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 509

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 169/419 (40%), Positives = 267/419 (63%), Gaps = 1/419 (0%)

Query: 2   KESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITP 61
           + + +     R P+Y+ LY  VLV I  G+A+G   P     M+ L D+F+K  K++I P
Sbjct: 12  QSADKAPPRRRKPIYRHLYFWVLVGIALGIAVGLLFPAWAADMRWLADLFIKLVKVVIAP 71

Query: 62  VIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKS 121
            IF TV  GIA + ++   G +  + +  F   ++ AL IGL+  N+ +PG+G+NV    
Sbjct: 72  TIFCTVVVGIAGLGNLAKAGGLALRTLVYFTALTVLALAIGLVTVNVMRPGVGLNVSFDE 131

Query: 122 LNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSD 181
            +         +    F GF+  MIPD+  SA   G ++Q L++A+L   +L+++G + +
Sbjct: 132 ADAADTIAEAEAGGTGFSGFILHMIPDSFFSAFVEGELIQVLVLAILVACALTMLGRRGE 191

Query: 182 TIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAF 241
              + L+ ++  +F ++ IVM  AP+GAFG M+FTIG+YG   +S+L + +   Y T   
Sbjct: 192 PAVRALDTMSHIMFGVIKIVMYAAPVGAFGGMAFTIGEYGGQVLSSLAYFMLSFYVTCVL 251

Query: 242 FILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSM 301
           FI+ VLG+++R   FS+ +L+  +++E+L+VL TSSSES LP +M K+E AG  +S+V +
Sbjct: 252 FIVVVLGLVSRLAGFSLFRLVRLIRDELLIVLGTSSSESVLPRMMTKLEAAGAKKSVVGL 311

Query: 302 VVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFI 361
            +PTGYSFNLDG+ IY+T+  +FI+QAT   +S+  Q+ LLL  ++SSKGAAGV+G+  +
Sbjct: 312 TIPTGYSFNLDGTAIYMTMGAIFIAQATGSDISVWTQVGLLLFMLLSSKGAAGVSGAGLV 371

Query: 362 TLAATITLVPS-LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           TLAA++      +P+AG+ LI+G+DRFMSE R++TN IGNAV T+V++RW   LD +  
Sbjct: 372 TLAASLAAFGDVIPLAGIALIVGIDRFMSEGRALTNLIGNAVGTLVIARWTGGLDRERL 430


>gi|229542980|ref|ZP_04432040.1| sodium:dicarboxylate symporter [Bacillus coagulans 36D1]
 gi|229327400|gb|EEN93075.1| sodium:dicarboxylate symporter [Bacillus coagulans 36D1]
          Length = 433

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 149/412 (36%), Positives = 256/412 (62%), Gaps = 6/412 (1%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQ---IGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
            L  Q+ + +  G+A+G        +   +QP GD F++  KM++ P++  ++  G+A  
Sbjct: 5   SLAWQIFIGLILGIAIGGIFHGNDTVAHILQPFGDFFLRLIKMIVIPIVVSSLIVGVAGA 64

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDL--KSLNTESIAHIKS 132
            DMK +G++  KA+  F + +  A+V+GL+ GN+  PG G+++    K+  +  +   K 
Sbjct: 65  GDMKQVGKLGLKALIYFEIVTTIAIVVGLLAGNLFHPGTGVDMGSLAKTSISSYVETTKE 124

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +     +  + +++P     +L+ GN+L  +  +++FGI ++ +GEK   + +  + ++ 
Sbjct: 125 TQHNGIVDTILNIVPTNLFESLSQGNMLPIIFFSVMFGIGVAAIGEKGKPVLRFFQGVSE 184

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +F + ++VM++AP+G FG +  T+ ++GL S+  L  LVF +Y T  FF++ VLG++  
Sbjct: 185 AMFYVTNLVMKVAPIGVFGLIGVTVAQFGLKSLIPLSKLVFTVYGTIIFFVVVVLGLIGW 244

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             R +I KL   LK+E++L  ST+SSE+ LP LM+KME+ GC +SI ++V+PTGYSFNLD
Sbjct: 245 LFRVNIFKLFKILKDELILAYSTASSEAVLPRLMEKMEKFGCPKSITTLVIPTGYSFNLD 304

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           GS +Y +LA LFI+Q   + +S+  Q+SL+L+ MV+SKG AGV G +F+ L AT+  V  
Sbjct: 305 GSTLYQSLAALFIAQMYGIHMSIGAQISLVLVLMVTSKGIAGVPGVSFVVLLATLGTV-G 363

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +PI G+  I G+DR +   R+V N +GN + T++VS+WE K D +    Y+ 
Sbjct: 364 IPIEGLAFIAGIDRILDMARTVCNVVGNTLATIIVSKWEGKYDKEKGEAYLA 415


>gi|229191673|ref|ZP_04318652.1| C4-dicarboxylate transport protein [Bacillus cereus ATCC 10876]
 gi|228591835|gb|EEK49675.1| C4-dicarboxylate transport protein [Bacillus cereus ATCC 10876]
          Length = 420

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|84622671|ref|YP_450043.1| C4-dicarboxylate transporter DctA [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|123522927|sp|Q2P6Q8|DCTA_XANOM RecName: Full=C4-dicarboxylate transport protein
 gi|172044626|sp|Q5H3V0|DCTA_XANOR RecName: Full=C4-dicarboxylate transport protein
 gi|84366611|dbj|BAE67769.1| C4-dicarboxylate transport protein [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 457

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 235/423 (55%), Positives = 310/423 (73%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LG F P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIILGALLGRFEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GL+V ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMVYFLFFSTLALVVGLVVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG+SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGVSLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG++ R C FS++KLI +LK E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGVVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLTLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|330892119|gb|EGH24780.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 447

 Score =  280 bits (717), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 195/415 (46%), Positives = 292/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+ G  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPETGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ ++A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ S++   S
Sbjct: 62  RMENMKELGRVGFRALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSSLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IPDT + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPDTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTI KYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIDKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG  IY T+A +FI+QATN PL+LTDQL +L++ M +SKG+AGVTGS FI LAAT+  + 
Sbjct: 302 DGQAIYYTIAAIFIAQATNTPLTLTDQLIVLVVLMFTSKGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++T  IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITKTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|238793264|ref|ZP_04636891.1| C4-dicarboxylate transport protein [Yersinia intermedia ATCC 29909]
 gi|238727432|gb|EEQ18959.1| C4-dicarboxylate transport protein [Yersinia intermedia ATCC 29909]
          Length = 431

 Score =  280 bits (717), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKVSIFKSLYFQVLTAITLGVLLGHFYPDIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIVPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IARFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCKQLDNDQLQAVLS 415


>gi|320327763|gb|EFW83771.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330877602|gb|EGH11751.1| C4-dicarboxylate transport protein 3 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 447

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 194/415 (46%), Positives = 293/415 (70%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             +   LY+QVL+A+  G  +G   P+ G  ++P+GD F+K  KML+ PVIFLTV +GIA
Sbjct: 2   KSILGKLYVQVLLAVILGAIVGVVAPETGAALKPIGDAFIKLIKMLLAPVIFLTVVSGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           RM++MK +G++ ++A+  F V S  ALVIGL+V ++ KPG GMN+D+ +L++ S++   S
Sbjct: 62  RMENMKELGRVGFRALIYFEVVSTLALVIGLVVVDVFKPGAGMNIDVATLDSSSLSTYTS 121

Query: 133 SHA-KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +    SF+ F+  +IP+T + A   GNILQ L+ ++L GI+L+ VG ++      L+ + 
Sbjct: 122 AAKHSSFMDFLMGIIPNTIIDAFAKGNILQILLFSILLGIALAQVGPRAKPFVDALDSLM 181

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V++VMR+APLGAFGA++FTIGKYG  S+ +L  L+ C+Y T A F++ VLG + 
Sbjct: 182 QGMFRIVNMVMRLAPLGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPIC 241

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ K + F+KEE+  VL TSSSES LP ++ KME+AG  + +  M++P+G +FN 
Sbjct: 242 RYSGFSLWKFLRFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFNP 301

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           D   IY T+A +FI+QATN PL+LTDQL +L++ M +S+G+AGVTGS FI LAAT+  + 
Sbjct: 302 DRQAIYYTIAAIFIAQATNTPLTLTDQLIVLVVLMFTSEGSAGVTGSGFIILAATLASLG 361

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AGM L+LGVDRFMSE R++TN IGN V T+ +++W   LD +  ++ +  E
Sbjct: 362 TIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDSEKMHRALNGE 416


>gi|220914160|ref|YP_002489469.1| sodium:dicarboxylate symporter [Arthrobacter chlorophenolicus A6]
 gi|219861038|gb|ACL41380.1| sodium:dicarboxylate symporter [Arthrobacter chlorophenolicus A6]
          Length = 495

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 166/417 (39%), Positives = 268/417 (64%), Gaps = 2/417 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R PLYK L+ Q+L+A+ +G+ +GHF P +G Q++PLGD F+K  KM+I P+IFL + TGI
Sbjct: 18  RKPLYKSLFFQILIAVVAGVLIGHFWPDLGSQLRPLGDGFIKLIKMIIAPLIFLVIVTGI 77

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           + + D+K +G++  KA+  F   ++FAL+ GL+VGN+ +PG G+N+D  +L+   + A  
Sbjct: 78  SAVGDVKAVGRVGVKALVYFTAATLFALLFGLVVGNVVQPGAGLNIDPATLSQADLDAKT 137

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVG-EKSDTIRKCLEE 189
            S+  K    F+ D+IP + + A  S ++LQ L  ++ FG ++ ++G E+   +   +E 
Sbjct: 138 GSAAPKDAASFILDVIPASVIGAFASNSLLQVLFFSVFFGAAIVVIGRERCMPVISLMET 197

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +   +F+++S +M++AP+GAFGAM+F IG+YGLS++S    L+   Y  +  FI  +  +
Sbjct: 198 VLELIFKIMSWIMKVAPIGAFGAMAFIIGQYGLSTLSTYAVLIAACYGAAVVFIGLLFAV 257

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
                R  + + + + +EE LL L T+S+E+ +P +M K+  AGC R+   +VVPTGYSF
Sbjct: 258 AWLTARVPLWQFLKYTREEFLLALGTASTEAVMPRIMTKLTNAGCSRATTGLVVPTGYSF 317

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+ IY++++ LF++QA    L L  QL+ L + +++SKG AGV GS+F+ L+AT   
Sbjct: 318 NLDGAAIYLSISLLFLAQAFGHNLDLGQQLAALGVLLLTSKGMAGVPGSSFLALSATAAA 377

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +   P+AG+ L+LG DR M   R V N +GN V T VVS+WE + D  +  +    E
Sbjct: 378 LGIFPVAGVALLLGADRLMDSMRVVVNLLGNCVATFVVSKWEGQFDRSVMVRAFKGE 434


>gi|119775900|ref|YP_928640.1| proton/glutamate symporter [Shewanella amazonensis SB2B]
 gi|119768400|gb|ABM00971.1| proton/glutamate symporter [Shewanella amazonensis SB2B]
          Length = 430

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 125/408 (30%), Positives = 228/408 (55%), Gaps = 9/408 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+L  +  G+ +G  +      ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 18  LWLQILTGMLLGIGVGLVLGPDASALKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMQDTA 77

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL+VG + +PG G++++   L+ E         A S 
Sbjct: 78  RMGRIGFKSFAFYLATTAIAISVGLMVGWLLEPGAGLSLEGHDLSAE------VKTAPSV 131

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + +++P   ++AL SG ILQ ++ A+  G++L L+G+      K  E +   ++++ 
Sbjct: 132 MDTLINIVPTNPVAALASGQILQVIVFAVALGVALVLIGDHGKPAIKVFESLAEAMYKLT 191

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF-CRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y   A  ILG   ++ +     S
Sbjct: 192 DMVMKLAPYGVFGLMAWVAGEYGIDMLLPLIKVIIAVYLGCALHILGFYSLVLKLVAGLS 251

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            I+    +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 252 PIQFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 311

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  V L+  D L+++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 312 YQGVTALFVAQAFGVDLTWVDYLTIVLTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 370

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ +I G+DR +   R+V N  G+ V T V++R E ++D   +N  + 
Sbjct: 371 GVAIIAGIDRILDMARTVVNVSGDLVATTVIARSEGEIDIAHYNADME 418


>gi|228990542|ref|ZP_04150507.1| Proton glutamate symport protein [Bacillus pseudomycoides DSM
           12442]
 gi|228996643|ref|ZP_04156282.1| Proton glutamate symport protein [Bacillus mycoides Rock3-17]
 gi|229004291|ref|ZP_04162092.1| Proton glutamate symport protein [Bacillus mycoides Rock1-4]
 gi|228757152|gb|EEM06396.1| Proton glutamate symport protein [Bacillus mycoides Rock1-4]
 gi|228763275|gb|EEM12183.1| Proton glutamate symport protein [Bacillus mycoides Rock3-17]
 gi|228769068|gb|EEM17666.1| Proton glutamate symport protein [Bacillus pseudomycoides DSM
           12442]
          Length = 423

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 142/410 (34%), Positives = 249/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G        +   ++P+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFYGDSTVVGYLKPIGDIFIRLIKMIVVPIVVASIIVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+V+GL+V NI +PG G+N+D  +    ++        
Sbjct: 66  DVKKLGRLGGKTIIYFEIITTIAIVVGLLVANIFQPGKGVNMDQLTKTDISKYAETTAQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ VGE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLVDGDMLAIIFFSVLFGLGVAAVGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  LV  +Y +  FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLVIVVYGSMIFFVVVVLGLTAKL 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
            R +I +    LK+E++L  ST+SSE+ LP LM+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FRINIFQFFKILKDELILAYSTASSETVLPKLMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D      Y+
Sbjct: 365 PAEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDDAKGQAYL 414


>gi|229166373|ref|ZP_04294130.1| Proton glutamate symport protein [Bacillus cereus AH621]
 gi|228617115|gb|EEK74183.1| Proton glutamate symport protein [Bacillus cereus AH621]
          Length = 424

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 136/410 (33%), Positives = 249/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+ +G       ++   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGITVGAIFFGNQEVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+V+GL++ NI +PG G+++D  +    ++     +  
Sbjct: 66  DIKKLGRLGGKTIIYFEIITTLAIVVGLLIANIFQPGKGVDMDKLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLAEGDMLAIIFFSVLFGLGVAAIGERGKPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIELSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PAEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|188535495|ref|YP_001909292.1| C4-dicarboxylate transporter DctA [Erwinia tasmaniensis Et1/99]
 gi|226723838|sp|B2VCL2|DCTA_ERWT9 RecName: Full=C4-dicarboxylate transport protein
 gi|188030537|emb|CAO98432.1| Aerobic C4-dicarboxylate transport protein [Erwinia tasmaniensis
           Et1/99]
          Length = 424

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 206/414 (49%), Positives = 300/414 (72%), Gaps = 1/414 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++P L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV +G
Sbjct: 1   MKPSLFKSLYFQVLAAIAIGVLLGHFNPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVSG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALIYFEVVSTIALIIGLVVVNVLQPGAGMNVDPATLDAKAVAMY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G+K   +   ++ 
Sbjct: 121 AQQAEQQGVVAFLLDVIPGSVIGAFASGNILQVLLFAILFGFALHRMGDKGTLVFNFIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +   F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG+
Sbjct: 181 FSHVFFGIINMIMRLAPVGAFGAMAFTIGKYGVGSLVQLGQLIVCFYITCLLFVVVVLGL 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARVVGFNIFKFIAYIKEELLIVLGTSSSESALPRMLAKMENLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD K   + +
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATLVVAKWVGQLDEKKLKEQL 414


>gi|332163405|ref|YP_004299982.1| C4-dicarboxylate transporter DctA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607903|emb|CBY29401.1| aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667635|gb|ADZ44279.1| C4-dicarboxylate transporter DctA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862171|emb|CBX72334.1| C4-dicarboxylate transport protein [Yersinia enterocolitica W22703]
          Length = 430

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKASLFKSLYFQVLTAITLGVLLGHFYPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCVLFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQAVLS 415


>gi|238787715|ref|ZP_04631512.1| C4-dicarboxylate transport protein [Yersinia frederiksenii ATCC
           33641]
 gi|238724058|gb|EEQ15701.1| C4-dicarboxylate transport protein [Yersinia frederiksenii ATCC
           33641]
          Length = 431

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKVSIFKSLYFQVLTAITLGVLLGHFYPDLGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IARFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + L  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTQMDLIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQAVLS 415


>gi|238756538|ref|ZP_04617840.1| C4-dicarboxylate transport protein [Yersinia ruckeri ATCC 29473]
 gi|238705244|gb|EEP97659.1| C4-dicarboxylate transport protein [Yersinia ruckeri ATCC 29473]
          Length = 430

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 210/415 (50%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTNIFKSLYFQVLTAITLGVLLGHFYPDIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL++ N+ +PG GMN+D  SL+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEVVSTIALLIGLVIVNVVQPGAGMNIDPASLDAKAVAMY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 ADQASQQGIIPFLLDIIPGSVIGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLLQLGQLIVCFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I ++KEE+L+VL TSSSES LP +++KME AGC +S+V +V+PTGYSF
Sbjct: 241 IARANGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLEKMERAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIMHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQATLS 415


>gi|228966480|ref|ZP_04127533.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228793202|gb|EEM40752.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 420

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 178/412 (43%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTKVIE 411


>gi|166713346|ref|ZP_02244553.1| C4-dicarboxylate transporter DctA [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 457

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 233/423 (55%), Positives = 307/423 (72%), Gaps = 11/423 (2%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y+ LY QV+VAI  G  LG   P     ++PLGD F+K  KM+I PVIFLT+ TGIA 
Sbjct: 15  PFYRQLYFQVVVAIVLGALLGRCEPAFAESLKPLGDAFIKLVKMIIAPVIFLTIVTGIAG 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKS 132
           M  +K +G++F KAM  F  FS  ALV+GL+V ++ +PG GMN++   L+  ++ ++++ 
Sbjct: 75  MTHLKTVGRVFGKAMVYFLFFSTLALVVGLVVAHVVQPGAGMNINPADLDQSAVKSYVEK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTS----------GNILQTLIVALLFGISLSLVGEKSDT 182
           SH  + +GF+ D+IP++ + A T            NILQ L VA+LFG SL+LVGE+   
Sbjct: 135 SHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVLFGASLALVGERGKP 194

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   LE +  PVF++V I+MR AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F
Sbjct: 195 VLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLTSLLF 254

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           +L +LG + R C FS++KLI +L+ E+LLVL TSSSESALP LM+KME+AGC +S+V +V
Sbjct: 255 VLVILGAVCRLCGFSVLKLIRYLRAELLLVLGTSSSESALPSLMEKMEKAGCEKSVVGLV 314

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           VPTGYSFNLDG+NIY+TLA LFI+QATN  L+L  Q++LL +AM+SSKGAAGVTG+ FIT
Sbjct: 315 VPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLSSKGAAGVTGAGFIT 374

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           LAAT+ +VP +P+AGM LILGVDRFMSECRS+TNFIGNAV TVVVSRWE  LD       
Sbjct: 375 LAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDRLKLV 434

Query: 423 IGI 425
           +  
Sbjct: 435 LDG 437


>gi|325122835|gb|ADY82358.1| C4-dicarboxylate transporter DctA [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 443

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 199/430 (46%), Positives = 297/430 (69%), Gaps = 24/430 (5%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQ--------------IGVQMQPLGDIFVKTT 55
             + P+YK LY QV++AI +G+ +GHF P               +G +++PLGD F++  
Sbjct: 1   MAKKPIYKSLYFQVIIAIIAGILVGHFSPSSTQIVNGVEQHIPGLGEKLKPLGDAFIRLI 60

Query: 56  KMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGM 115
           KM+I PVIF TV +GIA M+ MK +G+    A+  F + S  AL+IGL+V NIAKPG+GM
Sbjct: 61  KMIIAPVIFCTVVSGIAGMESMKSVGKTGGVALLYFEIVSTIALLIGLVVINIAKPGVGM 120

Query: 116 NVDLKSLNTESIA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS 174
           NVD  +L+T  I  ++ S  ++S I F+  +IPDT         ++Q L+ A+LFG +L 
Sbjct: 121 NVDPTTLDTSGIQKYVSSGESQSTIDFLMHIIPDT---------VVQVLLFAILFGFALH 171

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            +G+    + K ++++    F +V++VM++AP+GAFGAM+FTIGKYG+ S+  L  L+ C
Sbjct: 172 KLGDAGRPVLKFIDQVAHVFFNIVNMVMKLAPIGAFGAMAFTIGKYGVGSLVQLGQLIIC 231

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
            Y T   FI  +LG ++R   FSI+K+I  ++EE+L+VL TSSSES LP +++K+E AGC
Sbjct: 232 FYITCLLFIFLILGTISRISGFSILKMIRLIREELLIVLGTSSSESVLPRMLRKLEIAGC 291

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
            +S+V +V+PTGYSFNLDG++IY+T+A +FI+QATN  L +  Q++LLL+ ++SSKGAAG
Sbjct: 292 EKSVVGLVIPTGYSFNLDGTSIYLTMAAIFIAQATNTQLDIQHQITLLLVLLISSKGAAG 351

Query: 355 VTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           VTGS FI +AAT++ V  +P+AG+ LILG+DRFMSE R++TN +GN++ T+VV++W   L
Sbjct: 352 VTGSGFIVMAATLSAVGHIPVAGLALILGIDRFMSEARALTNLVGNSLATIVVAKWVGAL 411

Query: 415 DPKLFNKYIG 424
           D    N  + 
Sbjct: 412 DKDKLNDALN 421


>gi|157149131|ref|YP_001456450.1| C4-dicarboxylate transporter DctA [Citrobacter koseri ATCC BAA-895]
 gi|167012297|sp|A8ARA1|DCTA_CITK8 RecName: Full=C4-dicarboxylate transport protein
 gi|157086336|gb|ABV16014.1| hypothetical protein CKO_04970 [Citrobacter koseri ATCC BAA-895]
          Length = 428

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGSGMNVDPATLDAKAVAIY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  +GF+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGIVGFLMDIIPGSVIGAFASGNILQVLLFAVMFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIVCFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSES LP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARAAGFSIFKFIRYIREELLIVLGTSSSESVLPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHKKLDDVLN 415


>gi|283787829|ref|YP_003367694.1| C4-dicarboxylate transport protein [Citrobacter rodentium ICC168]
 gi|282951283|emb|CBG90978.1| C4-dicarboxylate transport protein [Citrobacter rodentium ICC168]
          Length = 428

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAQAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGIVAFLMDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD +  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHQKLDDVLN 415


>gi|253686491|ref|YP_003015681.1| sodium:dicarboxylate symporter [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645144|sp|C6DGQ8|DCTA_PECCP RecName: Full=C4-dicarboxylate transport protein
 gi|251753069|gb|ACT11145.1| sodium:dicarboxylate symporter [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 430

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 204/416 (49%), Positives = 298/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF PQ+G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V NI +PG GMN+D  +L+  ++A +
Sbjct: 61  IAGMESMKSVGRTGAVALLYFEIVSTIALIIGLVVVNIVQPGAGMNIDPSTLDASAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   ++ 
Sbjct: 121 TQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMFGFALHRLGAKGKVIFDVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++M++APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   FI  VLG 
Sbjct: 181 FSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLVQLGQLIACFYITCVLFIFLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSES LP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKMEKVGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV+++ ++LD K  +  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKYCRELDEKKLDAELSG 416


>gi|218898680|ref|YP_002447091.1| C4-dicarboxylate transporter [Bacillus cereus G9842]
 gi|218542561|gb|ACK94955.1| C4-dicarboxylate transporter [Bacillus cereus G9842]
          Length = 420

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 178/412 (43%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDLGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTKVIE 411


>gi|299535836|ref|ZP_07049157.1| C4-dicarboxylate transporter DctA [Lysinibacillus fusiformis ZC1]
 gi|298729036|gb|EFI69590.1| C4-dicarboxylate transporter DctA [Lysinibacillus fusiformis ZC1]
          Length = 419

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 192/410 (46%), Positives = 280/410 (68%)

Query: 16  YKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           +K L +QVL+AI  G+ +G   P+ G +++ L DIF+K  KMLI P+IFLTV  GI  M 
Sbjct: 5   FKNLTVQVLIAIVLGIIIGATFPEFGAKLKILADIFIKLIKMLIAPIIFLTVVIGIGSMG 64

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHA 135
           D+K +G+I  KA+  F + S FAL IGLIV NI +PG G N D  S    S     +S  
Sbjct: 65  DVKKVGKIGGKALIYFEIVSTFALAIGLIVVNIVQPGKGFNTDAASGADVSQYTEAASAE 124

Query: 136 KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVF 195
                F+  +IP+  + AL +G +L  L  A+LFG++ + +GE +  + K  E++    F
Sbjct: 125 HGLGAFIMQIIPENVVGALANGELLPVLFSAVLFGLAAAAIGEPAKPVIKFFEQVADIFF 184

Query: 196 RMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCR 255
           ++V++VM+I+P+GAFGAMS+TIG +GL S+ NL FL+  +Y T   FI+ ++G++  +  
Sbjct: 185 KIVNMVMKISPIGAFGAMSYTIGNFGLKSLGNLGFLMLSVYITMFIFIVVIIGLITHYFG 244

Query: 256 FSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSN 315
           FSI K I ++K+E+ +V+ TSSSESALP +M+K+E  GC + +V +V+PTGYSFNLDG++
Sbjct: 245 FSIFKFIKYIKDEIFIVIGTSSSESALPSMMRKLENYGCSKQVVGLVIPTGYSFNLDGTS 304

Query: 316 IYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI 375
           IY+++A +FI+QA  V L +  Q++LL I M++SKGAAGVTGS FITLAAT+   P +P+
Sbjct: 305 IYLSMAAIFIAQAYGVDLDVWHQITLLAILMLTSKGAAGVTGSGFITLAATLAAFPMIPV 364

Query: 376 AGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
            G+ L++GVDRFMSE R+VTN IGN V TVVVS+ EK+ D +   + +  
Sbjct: 365 EGIALLIGVDRFMSEARAVTNLIGNGVATVVVSKMEKEFDTEQEKRALSG 414


>gi|218232428|ref|YP_002368401.1| C4-dicarboxylate transporter DctA [Bacillus cereus B4264]
 gi|218160385|gb|ACK60377.1| C4-dicarboxylate transporter [Bacillus cereus B4264]
          Length = 420

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 275/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A + G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFSKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|297199490|ref|ZP_06916887.1| sodium:dicarboxylate symporter [Streptomyces sviceus ATCC 29083]
 gi|197712965|gb|EDY56999.1| sodium:dicarboxylate symporter [Streptomyces sviceus ATCC 29083]
          Length = 457

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 180/408 (44%), Positives = 278/408 (68%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           LY+Q L+ +F+G A+G   P  G  ++PLGD F+   +M+I PVIF TV  GIA M + +
Sbjct: 5   LYVQCLIGVFAGAAVGWLWPSFGADLKPLGDGFIALVRMMIAPVIFCTVVHGIASMGNAR 64

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G++  KA+  F V +  A+VIGL+V N+ +PG+G++V++ +L+TE +    +   +S 
Sbjct: 65  AVGRVSLKALIYFEVLTTVAMVIGLVVVNLVQPGVGLHVEVSTLSTEGLPPEATQSHESV 124

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
             F+   IPDT +SALT   IL  L+V++LFG  L+ VGE    I + +E+++  +F ++
Sbjct: 125 AAFVLSTIPDTLISALTGHEILPVLLVSVLFGFGLNAVGEAGAGITQGIEKLSKVLFTLI 184

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSI 258
             +MR+AP+GAFG+M+FTIG YGL ++ +L  LV   + T+ FF+L VLG + R     +
Sbjct: 185 RWIMRLAPIGAFGSMAFTIGNYGLDTLRHLFLLVGSFWLTALFFVLVVLGTVMRINGLRL 244

Query: 259 IKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYI 318
           +  + ++KEE+L+VL TSSSE  LP +M K++ AG  + +V + +P GYSFNLDG+ IY+
Sbjct: 245 LPFLRYIKEELLIVLGTSSSEPVLPRMMAKLQHAGASKPVVGITLPAGYSFNLDGTAIYL 304

Query: 319 TLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGM 378
           T+ ++F++QA  + LSLT QLS+L + +++SKGAAGVTGS FI LAAT++ VP +P+A +
Sbjct: 305 TMGSVFLAQALGIDLSLTQQLSMLAVMLLTSKGAAGVTGSGFIALAATLSAVPHVPVAAL 364

Query: 379 TLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            LI GVDRFMSE R++T+ +GN V T+ V++WE +LD       +  E
Sbjct: 365 ALIFGVDRFMSEARALTSVVGNGVATLAVAKWEGELDEDRARAVLRGE 412


>gi|295675338|ref|YP_003603862.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1002]
 gi|295435181|gb|ADG14351.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1002]
          Length = 426

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 219/417 (52%), Positives = 306/417 (73%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P++K+LY+QV+VAI  G+ LGHF P + + M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPIHKVLYVQVIVAIIIGIVLGHFYPNLAIDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   ++ +PG G NVD  SL+  ++A  
Sbjct: 61  IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHLLRPGAGFNVDPASLDGRAVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F   +IPDT  SA   G ILQ L++ALLFG  L+  GEK   +   +E 
Sbjct: 121 AAKAHGQSTVDFFMHLIPDTLSSAFAQGEILQILLIALLFGAVLATAGEKGKPVTNFIEG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F MV I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ L+   Y TS  F++ VLG 
Sbjct: 181 LSHILFGMVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I++ I ++KEE+L+VL TSSSE+ALP LM+K+E  GC RS+V +VVPTGYSF
Sbjct: 241 IARMVGFNILRFIAYIKEEMLIVLGTSSSEAALPQLMQKLENLGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  LS   QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNTDLSWGQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    NK +  E
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRSRLNKVLRGE 417


>gi|146313557|ref|YP_001178631.1| C4-dicarboxylate transporter DctA [Enterobacter sp. 638]
 gi|167012301|sp|A4WFV0|DCTA_ENT38 RecName: Full=C4-dicarboxylate transport protein
 gi|145320433|gb|ABP62580.1| sodium:dicarboxylate symporter [Enterobacter sp. 638]
          Length = 428

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 211/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTIALIIGLIIVNVMQPGAGMNVDPSTLDAKAVAIY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGIVAFLLDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLIQLGQLIICFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFNIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LPIAG+ LILG+DRFMSE R++TN IGN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPIAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWVKELDHKKLDDTLN 415


>gi|228902085|ref|ZP_04066249.1| C4-dicarboxylate transport protein [Bacillus thuringiensis IBL
           4222]
 gi|228857511|gb|EEN02007.1| C4-dicarboxylate transport protein [Bacillus thuringiensis IBL
           4222]
          Length = 420

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 177/412 (42%), Positives = 273/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YA  A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYAAMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDLGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTKVIE 411


>gi|154245718|ref|YP_001416676.1| sodium:dicarboxylate symporter [Xanthobacter autotrophicus Py2]
 gi|154159803|gb|ABS67019.1| sodium:dicarboxylate symporter [Xanthobacter autotrophicus Py2]
          Length = 448

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 231/415 (55%), Positives = 319/415 (76%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
              Y  LY QV++AI +G+ LGHF P +G  ++PLGD F+K  KM+I PVIFLTV TGIA
Sbjct: 15  RKFYHHLYFQVIIAIIAGILLGHFYPDVGASLKPLGDAFIKLVKMVIAPVIFLTVVTGIA 74

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIK 131
            M+D+  +G++  KAM  F  FS  AL+IGL+V N+ +PG G+N+D KSL+ +++A +  
Sbjct: 75  GMRDLAKVGRVAGKAMIYFITFSTLALLIGLVVANVVQPGSGLNIDPKSLDPKAVAGYAA 134

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
            +H  + IGF+ ++IP T +SAL SG+ILQ L  A+LFGI+L  VGE  + + K L   +
Sbjct: 135 QAHDSTIIGFLMNIIPTTPISALASGDILQVLFFAVLFGIALGGVGEAGEPVMKILNSAS 194

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR+V+I+M+ APLGAFGAM+FTIGKYG+ S++NL  L+   Y T+A FI  VLG++A
Sbjct: 195 AAMFRLVAILMKAAPLGAFGAMAFTIGKYGIGSVANLAMLIVTFYITAALFIFVVLGLVA 254

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R+  FS+ KL+ +++EE+LLVL TSSSE+ALPGLM KME AGC +S+V +V+PTGYSFNL
Sbjct: 255 RYNGFSLWKLLKYIREELLLVLGTSSSEAALPGLMLKMERAGCAKSVVGLVIPTGYSFNL 314

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLA LFI+QAT + LS  +Q+ LLL+AM+SSKGAAG+TG+ FITLAAT+++VP
Sbjct: 315 DGTNIYMTLAALFIAQATGIHLSFEEQILLLLVAMLSSKGAAGITGAGFITLAATLSVVP 374

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           S+P+AG+ LILG+DRFMSECR++TNFIGNAV T+VV+RWE +L+    ++ +  E
Sbjct: 375 SVPVAGLALILGIDRFMSECRAITNFIGNAVATIVVARWEGELNKDQLSRALNGE 429


>gi|229071085|ref|ZP_04204311.1| C4-dicarboxylate transport protein [Bacillus cereus F65185]
 gi|228712025|gb|EEL63974.1| C4-dicarboxylate transport protein [Bacillus cereus F65185]
          Length = 420

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|145298197|ref|YP_001141038.1| C4-dicarboxylate transporter DctA [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|167012051|sp|A4SK68|DCTA_AERS4 RecName: Full=C4-dicarboxylate transport protein
 gi|142850969|gb|ABO89290.1| DAACS family C4-dicarboxylate symporter [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 427

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 215/415 (51%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R  ++  LY QVL+AI  G+ LGH  P +G  M+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MRNKIFSSLYFQVLLAITLGVFLGHVYPDLGADMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M+ MK +G+    A+  F V S  ALVIGL V N+ +PG+GMNVD  +L+  +I A+
Sbjct: 61  IAGMESMKAVGKTGAIALLYFEVVSTIALVIGLCVVNLLQPGVGMNVDPATLDASAISAY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + ++  I F+ D+IP + + A  SGNILQ L+ A+LFG SL  +GEK   I   ++ 
Sbjct: 121 AEQAKSQGIIAFLLDVIPGSVIGAFASGNILQVLLFAVLFGFSLHHIGEKGKLIFNVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   FI  VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPVGAFGAMAFTIGKYGIGSLVQLGQLIACFYVTCLLFIFMVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI++ I ++KEE+L+VL TSSSES LP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARANGFSILRFISYIKEELLIVLGTSSSESVLPRMLVKMEALGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN PL L  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAIFIAQATNTPLDLFQQITLLVVLLISSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV+R+  +LD +  N+ + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLIGNGVATVVVARYCDQLDEQQMNEVLA 415


>gi|157368402|ref|YP_001476391.1| C4-dicarboxylate transporter DctA [Serratia proteamaculans 568]
 gi|167012307|sp|A8G823|DCTA_SERP5 RecName: Full=C4-dicarboxylate transport protein
 gi|157320166|gb|ABV39263.1| sodium:dicarboxylate symporter [Serratia proteamaculans 568]
          Length = 429

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKLTIFKSLYFQVLTAITLGVLLGHFYPDIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLLIVNLVQPGAGMNIDPGTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G+K   I   +E 
Sbjct: 121 AEQAQQQGIVPFLLDIIPGSVIGAFASGNILQVLLFAVLFGFALHRLGDKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGSLLQLGQLIACFYLTCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K + ++KEE+L+VL TSSSES LP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARANGFSIFKFVRYIKEELLIVLGTSSSESVLPRMLDKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDEKQLHDTLS 415


>gi|228922295|ref|ZP_04085602.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228837350|gb|EEM82684.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 420

 Score =  279 bits (714), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|300718963|ref|YP_003743766.1| Aerobic C4-dicarboxylate transport protein [Erwinia billingiae
           Eb661]
 gi|299064799|emb|CAX61919.1| Aerobic C4-dicarboxylate transport protein [Erwinia billingiae
           Eb661]
          Length = 428

 Score =  279 bits (714), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 204/416 (49%), Positives = 301/416 (72%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QV+ AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVITAIVIGVLLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG+GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTIALIIGLVVVNVLQPGVGMNIDPATLDAKAVAMY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP++ + A  SGNILQ L+ A++FG +L  +G+K   +   +E 
Sbjct: 121 AQQAEQQGVVAFLLDIIPNSVIGAFASGNILQVLLFAIMFGFALHRMGDKGTLVFNFIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCLLFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I ++KEE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVVGFNIFKFIAYIKEELLIVLGTSSSESALPRMLDKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNAHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W  +LD +     +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVDQLDEQQLKDTLDG 416


>gi|242241284|ref|YP_002989465.1| C4-dicarboxylate transporter DctA [Dickeya dadantii Ech703]
 gi|242133341|gb|ACS87643.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech703]
          Length = 430

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 211/416 (50%), Positives = 301/416 (72%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QMQPLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKSIFKSLYFQVLTAITIGVLLGHFYPALGQQMQPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMNVD   L+ +++A+ 
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTLALIIGLIVVNVLQPGVGMNVDPAVLDAKAVANY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            S +  +  + F+ D+IP + + A  SGNILQ L+ A++FG +L  +G+K   I   ++ 
Sbjct: 121 ASQAQQQGVVPFLMDVIPSSVIGAFASGNILQVLLFAVMFGFALHHLGDKGTLIFDVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCIVFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLEKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  N  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDAKQLNDVLSG 416


>gi|56421069|ref|YP_148387.1| proton/sodium:glutamate symporter [Geobacillus kaustophilus HTA426]
 gi|56380911|dbj|BAD76819.1| proton/sodium:glutamate symporter [Geobacillus kaustophilus HTA426]
          Length = 422

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 143/411 (34%), Positives = 252/411 (61%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ + +  G+ +G      P++   +QP+GD+F++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQIFIGLILGIMVGAIFYGSPKVATYLQPIGDVFLRLIKMIVIPIVVSSLIVGVANVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD--LKSLNTESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL+  NI +PG+G+N+    K+     +      
Sbjct: 66  DVKKLGKLGGKTILYFEIITTIAIIVGLLAANIFQPGVGVNMKSLEKTDIQSYVDTTNEV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
              S +    +++P     AL++GN+L  +  +++FG+ ++ +GEK   + +  +     
Sbjct: 126 QHHSMVETFVNIVPKNVFEALSTGNMLPIIFFSVMFGLGVAAIGEKGKPVLRFFQGTAEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+ K+G++S+  L  LV  +YA  AFF+L VLG +A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSKFGVASLLPLSKLVVLVYAVMAFFVLVVLGAVAKL 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  +I  LK+E++L  STSSSE+ LP +M+KME+ GC +++ S VVPTGYSFNLDG
Sbjct: 246 VGTNIFHIIKILKDELVLAYSTSSSETVLPKVMEKMEKFGCSKAVTSFVVPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA +FI+Q   + + ++ Q+SL+L+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQALAAVFIAQLYGIDMPISQQISLVLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+  I G+DR +   R+V N IGN++  VV+S+WE + + +   +YI 
Sbjct: 365 PVEGLAFIAGIDRLLDMARTVVNVIGNSLAAVVMSKWEGQYNEEQGKQYIA 415


>gi|261418448|ref|YP_003252130.1| sodium:dicarboxylate symporter [Geobacillus sp. Y412MC61]
 gi|319767592|ref|YP_004133093.1| sodium:dicarboxylate symporter [Geobacillus sp. Y412MC52]
 gi|261374905|gb|ACX77648.1| sodium:dicarboxylate symporter [Geobacillus sp. Y412MC61]
 gi|317112458|gb|ADU94950.1| sodium:dicarboxylate symporter [Geobacillus sp. Y412MC52]
          Length = 422

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 142/411 (34%), Positives = 252/411 (61%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ + +  G+ +G      P++   +QP+GD+F++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQIFIGLILGIMVGAIFYGNPKVATYLQPIGDVFLRLIKMIVIPIVVSSLIVGVANVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD--LKSLNTESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL+  N+ +PG+G+N+    K+     +      
Sbjct: 66  DVKKLGKLGGKTILYFEIITTVAIIVGLLAANLFQPGVGVNMKSLEKTDIQSYVDTTNEV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
              S +    +++P     AL++GN+L  +  +++FG+ ++ +GEK   + +  +     
Sbjct: 126 QHHSMVETFVNIVPKNVFEALSTGNMLPIIFFSVMFGLGVAAIGEKGKPVLRFFQGTAEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+ K+G++S+  L  LV  +YA  AFF+L VLG +A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSKFGVASLLPLSKLVVLVYAVMAFFVLVVLGAVAKL 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  +I  LK+E++L  STSSSE+ LP +M+KME+ GC +++ S VVPTGYSFNLDG
Sbjct: 246 VNTNIFHIIKILKDELVLAYSTSSSETVLPKVMEKMEKFGCSKAVTSFVVPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA +FI+Q   + + ++ Q+SL+L+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQALAAVFIAQLYGIDMPISQQISLVLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+  I G+DR +   R+V N IGN++  VV+S+WE + + +   +YI 
Sbjct: 365 PVEGLAFIAGIDRLLDMARTVVNVIGNSLAAVVMSKWEGQYNEEQGKQYIA 415


>gi|90424356|ref|YP_532726.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris BisB18]
 gi|122476065|sp|Q213M9|DCTA_RHOPB RecName: Full=C4-dicarboxylate transport protein
 gi|90106370|gb|ABD88407.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris BisB18]
          Length = 449

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 198/415 (47%), Positives = 293/415 (70%), Gaps = 4/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVST 69
           R P YK+LY+QVLVAI  G+ LG   P I     ++ LGD FVK  KM+I P+IF TV +
Sbjct: 22  RKPWYKLLYLQVLVAIVLGVLLGWLSPHIATNEWVKALGDGFVKLIKMVIAPIIFCTVVS 81

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA ++D + +G++  KA+  F V S FAL+IGL+VGN+ + G G+     +       +
Sbjct: 82  GIAHIQDARKVGRVGVKALLYFEVVSSFALLIGLVVGNVVQIGHGLGATGDAAAVSK--Y 139

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +K + A+  + F+ ++IPD+ + A   G+ILQ L+ A+LFG +L  +GE+   +R  +++
Sbjct: 140 VKQAEAQHSVDFVLNIIPDSVVGAFAKGDILQVLLFAILFGFALMTLGERGHRLRDVIDD 199

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  VF +++IVM+ AP+GAFGAM+FTIGK+G +++ NLI L+   Y T+A F++ VLG+
Sbjct: 200 ASHAVFGVIAIVMKAAPVGAFGAMAFTIGKFGPAALGNLIGLIAVFYITAALFVVLVLGL 259

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   F+I K + ++K+E+L+VL TSSSESALP LM+K+E  GC +S+V +VVPTGYSF
Sbjct: 260 IAKIVGFNIFKFLKYIKDELLIVLGTSSSESALPQLMEKLERLGCSKSVVGLVVPTGYSF 319

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLATLFI+QA  V L+ T+QL++LL+AM++SKGA+GV+G+ FITLAAT+++
Sbjct: 320 NLDGTNIYMTLATLFIAQALGVDLTWTEQLTILLVAMLTSKGASGVSGAGFITLAATLSV 379

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V    + GM ++  VD+FMSE R++TN  GN V TV VS WE +LD       + 
Sbjct: 380 VNPALVPGMAIVFSVDKFMSEVRALTNITGNGVATVFVSWWENELDHDKLAAALN 434


>gi|56419096|ref|YP_146414.1| C4-dicarboxylate transporter DctA [Geobacillus kaustophilus HTA426]
 gi|56378938|dbj|BAD74846.1| C4-dicarboxylate transport system (permease) [Geobacillus
           kaustophilus HTA426]
          Length = 480

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 187/410 (45%), Positives = 283/410 (69%), Gaps = 2/410 (0%)

Query: 6   QVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFL 65
           +  G++R  L K L +QV++ I  G+ +G   P+ G +++ L D F+K  KM+I P+IF 
Sbjct: 56  KGVGEMRRKL-KNLTVQVIIGIILGIIVGFLFPEFGAKLKVLADGFIKLIKMVIAPIIFF 114

Query: 66  TVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD-LKSLNT 124
           TV  GI  M D+K +G+I  KA+  F + + FAL IG++V N+ KPG+G + D +K  + 
Sbjct: 115 TVVIGIGNMGDLKKVGRIGGKALIYFEIVTTFALAIGIVVVNLVKPGVGFHTDAVKGGDI 174

Query: 125 ESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIR 184
                     +  F+ F+  +IPD  ++A+ SG +L  L  A+LFG++ + +GEK+  + 
Sbjct: 175 SQYTKQAEETSHGFVDFILSIIPDNVVAAMASGQLLPVLFFAVLFGLAAAALGEKAKPVI 234

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
              E +    F +V++VM+++P+ AFGAM++TIG +GL S+ +L  L+  +Y T A FI 
Sbjct: 235 SLFERLAEIFFGVVNMVMKVSPIAAFGAMAYTIGTFGLGSLVSLGKLMGSVYITMALFIF 294

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLG +A+F  F+I K + ++KEE+LLVL TSSSESALP LM+++E+ GC +S+V +VVP
Sbjct: 295 VVLGGIAKFYGFNIFKFLAYIKEELLLVLGTSSSESALPRLMERLEKYGCSKSVVGLVVP 354

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDG++IY+++A +FI+QA  + L++  +L+LL + M++SKGAAGVTGS FITLA
Sbjct: 355 TGYSFNLDGTSIYLSMAAIFIAQAYGIDLTIWQELTLLGVLMLTSKGAAGVTGSGFITLA 414

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           AT+   P +P+ G+ L+LGVDRFMSE R++TN IGNAV TVVVS+ E + 
Sbjct: 415 ATLAAFPMIPVEGIALLLGVDRFMSEARAITNIIGNAVATVVVSKMENEF 464


>gi|148548890|ref|YP_001268992.1| sodium:dicarboxylate symporter [Pseudomonas putida F1]
 gi|148512948|gb|ABQ79808.1| sodium:dicarboxylate symporter [Pseudomonas putida F1]
          Length = 435

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 190/415 (45%), Positives = 279/415 (67%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L K LY Q+L A+  G+ +GHF  Q  V ++PLGD F+K  KM+I PV+F T+ TGIA
Sbjct: 1   MRLAKSLYFQILCAVLLGVVVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D + +G++  K + LF   ++ +LVIGL    + KPG GMN+D  +L+T  ++   +
Sbjct: 61  GMTDKRSLGRLMSKTLLLFLGLTVVSLVIGLAAVYLFKPGAGMNIDPATLSTAGLSQYTA 120

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           S AK S + F   +IPDT + A   G +L  L +A+L G +LS +GEK   +   LE  +
Sbjct: 121 SAAKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLDVLESAS 180

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFR+   +MR AP+GAFGA++FT+G+YG++S+  L  LV  LY   AFF+L VLG + 
Sbjct: 181 TMVFRIFGYLMRFAPVGAFGALAFTVGQYGITSLGALAKLVGTLYIACAFFVLVVLGGIC 240

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KL+ + +EE L+VL TSS+E  LP +++K+E+ GC + +V +V+PTGYSFNL
Sbjct: 241 RAHGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL 300

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+ IY++LA +FI+QA N+ LSL   +++L I ++SSKGAAGVTGS F+ LA+T+T++ 
Sbjct: 301 DGTAIYLSLAAVFIAQACNIDLSLGQVVTMLAIMLLSSKGAAGVTGSGFVALASTLTVIH 360

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ L++GVDRFMSE R++T+   NAV TVVVS  E   D +  +  +  E
Sbjct: 361 DIPLAGLALLIGVDRFMSEARALTSLASNAVATVVVSLSENACDRQTLHSRLNGE 415


>gi|209521259|ref|ZP_03269979.1| sodium:dicarboxylate symporter [Burkholderia sp. H160]
 gi|209498301|gb|EDZ98436.1| sodium:dicarboxylate symporter [Burkholderia sp. H160]
          Length = 426

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 221/417 (52%), Positives = 308/417 (73%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P+YK+LY+QV+VAI  G+ LGHF P + + M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPIYKVLYVQVIVAIIIGVVLGHFYPNLAIDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+DMK +G++  KA+  F + S FALV+GL   ++ +PG G NVD  SL+  ++A +
Sbjct: 61  IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHLLRPGAGFNVDPASLDGRAVASY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H +S + F   +IPDT  SA   G ILQ L++ALLFG  L+  GEK   +   +E 
Sbjct: 121 AEKAHGQSTVDFFMHIIPDTITSAFAQGEILQILLIALLFGAVLATAGEKGKPVMNIIEG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           I+  +F MV I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ LV   Y TS  F++ VLG 
Sbjct: 181 ISHALFGMVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLVGTFYLTSIVFVVFVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I++ + ++KEE+L+VL TSSSE+ALP LM+K+E+ GC RS+V +VVPTGYSF
Sbjct: 241 IARMVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMQKLEKLGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  LS   QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNTDLSWGQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    NK +  E
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRAQLNKVLRGE 417


>gi|228909395|ref|ZP_04073220.1| C4-dicarboxylate transport protein [Bacillus thuringiensis IBL 200]
 gi|228850172|gb|EEM95001.1| C4-dicarboxylate transport protein [Bacillus thuringiensis IBL 200]
          Length = 420

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 178/412 (43%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    I    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPIIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVIE 411


>gi|228959772|ref|ZP_04121447.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228799902|gb|EEM46844.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 420

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 275/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K + ++KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAYIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|238783918|ref|ZP_04627935.1| C4-dicarboxylate transport protein [Yersinia bercovieri ATCC 43970]
 gi|238715157|gb|EEQ07152.1| C4-dicarboxylate transport protein [Yersinia bercovieri ATCC 43970]
          Length = 431

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKASIFKSLYFQVLTAITLGVLLGHFYPDLGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIVPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQIIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQAVLS 415


>gi|229047268|ref|ZP_04192867.1| C4-dicarboxylate transport protein [Bacillus cereus AH676]
 gi|228724010|gb|EEL75356.1| C4-dicarboxylate transport protein [Bacillus cereus AH676]
          Length = 420

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+ +G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIVVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K + ++KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAYIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|313499820|gb|ADR61186.1| DctM [Pseudomonas putida BIRD-1]
          Length = 439

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 190/415 (45%), Positives = 279/415 (67%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L K LY Q+L A+  G+ +GHF  Q  V ++PLGD F+K  KM+I PV+F T+ TGIA
Sbjct: 5   MRLAKSLYFQILCAVLLGVVVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA 64

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D + +G++  K + LF   ++ +LVIGL    + KPG GMN+D  +L+T  ++   +
Sbjct: 65  GMTDKRSLGRLMSKTLLLFLGLTVVSLVIGLAAVYLFKPGAGMNIDPATLSTAGLSQYTA 124

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           S AK S + F   +IPDT + A   G +L  L +A+L G +LS +GEK   +   LE  +
Sbjct: 125 SAAKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLDVLESAS 184

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFR+   +MR AP+GAFGA++FT+G+YG++S+  L  LV  LY   AFF+L VLG + 
Sbjct: 185 TMVFRIFGYLMRFAPVGAFGALAFTVGQYGITSLGALAKLVGTLYIACAFFVLVVLGGIC 244

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KL+ + +EE L+VL TSS+E  LP +++K+E+ GC + +V +V+PTGYSFNL
Sbjct: 245 RAHGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL 304

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+ IY++LA +FI+QA N+ LSL   +++L I ++SSKGAAGVTGS F+ LA+T+T++ 
Sbjct: 305 DGTAIYLSLAAVFIAQACNIDLSLGQVVTMLAIMLLSSKGAAGVTGSGFVALASTLTVIH 364

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ L++GVDRFMSE R++T+   NAV TVVVS  E   D +  +  +  E
Sbjct: 365 DIPLAGLALLIGVDRFMSEARALTSLASNAVATVVVSLSENACDRQTLHSRLNGE 419


>gi|284036769|ref|YP_003386699.1| sodium:dicarboxylate symporter [Spirosoma linguale DSM 74]
 gi|283816062|gb|ADB37900.1| sodium:dicarboxylate symporter [Spirosoma linguale DSM 74]
          Length = 414

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 177/414 (42%), Positives = 272/414 (65%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L   L ++VL+AI  G+  G+F P+   +++PLGD+F+   KM+I P+IFLT+  GI+
Sbjct: 1   MKLLNNLTVRVLIAITLGILTGYFFPETAAKLKPLGDLFINLIKMVIAPIIFLTIVLGIS 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D+K +G++  KA+  F V +  AL IGL++ N+ +PG G+         +   + + 
Sbjct: 61  NMGDLKKVGRVGGKALLYFEVVTTGALAIGLVLANLVRPGDGVQTA-TVKGGDISKYAEQ 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                +  F   ++P  A+ A   G ILQ L+ ++LFG+ L+ +GE    + +  E ++ 
Sbjct: 120 GAGMDWTEFFIHIVPSNAIKAFAEGEILQVLVFSVLFGVGLTRMGETGKPLIQTFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++++VM +APLGAFG M+FTIGKYGLS++  L  L+  +YAT   FI  VL ++ R
Sbjct: 180 VFFNILAVVMVLAPLGAFGGMAFTIGKYGLSTLLPLAKLMGTVYATMILFIFVVLNLILR 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           + + S+  ++ F+KEE+L+VL TSSSESALP +M K+E  GC RS+V +VVP GYSFNLD
Sbjct: 240 YYKISLWAVLKFIKEELLIVLGTSSSESALPQIMDKLESLGCSRSVVGLVVPAGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+ +AT+F++Q   V L++  +L+++ I MV+SKGAAGVTGS FI LA+T+T +  
Sbjct: 300 GTTIYLVMATVFLAQVFGVDLTVGQELTIIGILMVTSKGAAGVTGSGFIVLASTLTAIKV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+ G+ L+LGVDRFMSE RS+TN IGN V T+ ++  E + D   + + +G E
Sbjct: 360 IPVEGLALLLGVDRFMSEARSITNIIGNTVATIFIANNEGEFDRSKYERVVGQE 413


>gi|229151782|ref|ZP_04279982.1| C4-dicarboxylate transport protein [Bacillus cereus m1550]
 gi|228631709|gb|EEK88338.1| C4-dicarboxylate transport protein [Bacillus cereus m1550]
          Length = 420

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|169829145|ref|YP_001699303.1| C4-dicarboxylate transporter DctA [Lysinibacillus sphaericus C3-41]
 gi|168993633|gb|ACA41173.1| C4-dicarboxylate transport protein (C4-dicarboxylate permease)
           [Lysinibacillus sphaericus C3-41]
          Length = 419

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 191/411 (46%), Positives = 281/411 (68%)

Query: 16  YKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           +K L +QVL+AI  G+ +G   P+ G +++ L DIF+K  KMLI P+IFLTV  GI  M 
Sbjct: 5   FKNLTVQVLIAIVLGIIVGATFPEFGAKLKILADIFIKLIKMLIAPIIFLTVVIGIGSMG 64

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHA 135
           D+K +G+I  KA+  F + S FAL IGLIV NI KPG G N +  +    S     ++  
Sbjct: 65  DVKKVGKIGGKALIYFEIVSTFALAIGLIVVNIVKPGKGFNTEAANGADVSQYTDAAAAE 124

Query: 136 KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVF 195
                F+  +IPD  + AL +G +L  L  A+LFG++ + +GE +  + K  E++    F
Sbjct: 125 HGLGAFIMQIIPDNVVGALANGELLPVLFSAVLFGLAAAAIGEPAKPVIKFFEQVADIFF 184

Query: 196 RMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCR 255
           ++V++VM+++P+GAFGAMS+TIG +GL S+ NL FL+  +Y T   FI+ ++G + R+  
Sbjct: 185 KIVNMVMKVSPIGAFGAMSYTIGNFGLKSLGNLGFLMLSVYITMFIFIVVIIGAITRYFG 244

Query: 256 FSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSN 315
           FSI K I ++K+E+ +V+ TSSSESALP +M+K+E  GC + +V +V+PTGYSFNLDG++
Sbjct: 245 FSIFKFIKYIKDEIFIVIGTSSSESALPSMMRKLENYGCSKQVVGLVIPTGYSFNLDGTS 304

Query: 316 IYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI 375
           IY+++A +FI+QA  V L +  Q++LL I M++SKGAAGVTGS FITLAAT+   P +P+
Sbjct: 305 IYLSMAAIFIAQAYGVDLDIWHQITLLAILMLTSKGAAGVTGSGFITLAATLAAFPMIPV 364

Query: 376 AGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            G+ L++GVDRFMSE R+VTN IGN V TVVVS+ EK+ D +   + +  +
Sbjct: 365 EGIALLIGVDRFMSEARAVTNLIGNGVATVVVSKMEKEFDTEQEKRALSGQ 415


>gi|332975123|gb|EGK12028.1| DAACS family dicarboxylate/amino acid:cation symporter [Desmospora
           sp. 8437]
          Length = 424

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 181/399 (45%), Positives = 273/399 (68%)

Query: 16  YKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           +  L ++V++ I  G+ +G   P+ G Q++ L DIF+K  KMLI P+IF TV  GI  M 
Sbjct: 12  FNNLTVRVIIGIVLGILVGFLFPEFGAQLKVLADIFIKLIKMLIAPIIFFTVVIGIGNMG 71

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHA 135
           D+K +G+I  KA+  F + + FAL IG+IV N+ +PG+G N +       S    ++  +
Sbjct: 72  DLKKVGRIGGKALIYFEIVTTFALAIGIIVVNLIQPGVGFNTEAVKGGDISQYTEQAKES 131

Query: 136 KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVF 195
             F  F+  +IPD  + A+ +G++L  L  A+LFG+  + +GEK+  +    +      F
Sbjct: 132 GGFTDFILSIIPDNIIGAMAAGDLLPILFAAVLFGLVAASLGEKAKPVINLFQRFTDIFF 191

Query: 196 RMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCR 255
            +V++VM+I+P+ AFGAM++TIG +G+ S+ +L  L+  +Y T   FI+ VLG +A+F  
Sbjct: 192 GIVNMVMKISPIAAFGAMAYTIGTFGIGSLVSLGKLMSGVYLTMFLFIVLVLGAIAKFYG 251

Query: 256 FSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSN 315
           F+I K I ++KEE+LLVL TSSSESALP +M++ME  GC + +V +V+PTGYSFNLDG++
Sbjct: 252 FNIFKFIAYMKEEILLVLGTSSSESALPRMMERMERYGCSKPVVGLVIPTGYSFNLDGTS 311

Query: 316 IYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI 375
           IY+++A +FI+QA  + L++  +L+LL I M++SKGAAGVTGS FITLAAT++  P +P+
Sbjct: 312 IYLSMAAIFIAQAYGIDLTIWQELTLLGILMLTSKGAAGVTGSGFITLAATLSAFPMIPV 371

Query: 376 AGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
            G+ L+LGVDRFMSE R++TN IGN V TVVVS+ E + 
Sbjct: 372 EGIALLLGVDRFMSEARAITNLIGNGVATVVVSKMENEF 410


>gi|227113862|ref|ZP_03827518.1| C4-dicarboxylate transporter DctA [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 430

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 203/416 (48%), Positives = 299/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF PQ+G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ +PG+GMN+D  +L+  ++A +
Sbjct: 61  IAGMESMKSVGRTGAVALLYFEIVSTIALIIGLVVVNVVQPGVGMNIDPSTLDASAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   ++ 
Sbjct: 121 TQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMFGFALHRLGAKGKVIFDVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++M++APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F+  VLG 
Sbjct: 181 FSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLIQLGQLIACFYITCVLFVFLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSES LP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKMEKVGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV+++ ++LD K  +  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVAKYCRELDEKKLDAELSG 416


>gi|163851747|ref|YP_001639790.1| sodium:dicarboxylate symporter [Methylobacterium extorquens PA1]
 gi|163663352|gb|ABY30719.1| sodium:dicarboxylate symporter [Methylobacterium extorquens PA1]
          Length = 465

 Score =  279 bits (713), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 189/414 (45%), Positives = 287/414 (69%), Gaps = 3/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y++LYIQVL+AI  G+ LG   P+ G  ++ LGD F+   KMLI P+IF T+  GIA 
Sbjct: 20  PWYRVLYIQVLIAIVLGVLLGWLQPEWGKSLKWLGDGFIALIKMLIAPIIFCTIVHGIAS 79

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           + D+K +G++  KA+  F V S  AL+IG+IVG + +PG G   D+  L+ +++  +   
Sbjct: 80  IGDLKKVGRVGLKALIYFEVVSSLALLIGIIVGEVVQPGAGFGADVSKLDAKAVEGYASK 139

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           + A S +  +  +IP +   A  +G++LQ L++++L G+ L+ +G+K ++I   ++    
Sbjct: 140 AAADSTVAHLLGIIPKSFFDAFATGDLLQVLLISVLTGVVLTGMGKKGESITHGIDAAGQ 199

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             FR++ +++++AP+GAFGAM+FT+G+YG+  + +L +LV   Y TS  FI  VLG +A 
Sbjct: 200 VFFRIIGLIVKLAPIGAFGAMAFTVGQYGIGKVIDLAWLVGTFYTTSLLFIFVVLGGIAA 259

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSIIK + ++K+E+L+VL TSSSE+ LP +M KM+  G   S+V +V+PTGYSFNLD
Sbjct: 260 FAGFSIIKFLAYIKDELLIVLGTSSSETVLPHMMTKMKRLGASDSVVGLVIPTGYSFNLD 319

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TL TLF++QA    LS+    ++ L+AM++SKGA+GVTG+ FITLAAT+  +P 
Sbjct: 320 GTNIYMTLTTLFLAQAVGADLSVGQYATIFLVAMLTSKGASGVTGAGFITLAATLAAIPG 379

Query: 373 --LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+A MTL+LGVD+FMSECR++TN IGN V T+VVSRWE +LD K   + + 
Sbjct: 380 APVPVAAMTLVLGVDKFMSECRALTNLIGNGVATIVVSRWEGELDRKKLAEVMA 433


>gi|15837578|ref|NP_298266.1| C4-dicarboxylate transporter DctA [Xylella fastidiosa 9a5c]
 gi|9105906|gb|AAF83786.1|AE003935_12 C4-dicarboxylate transport protein [Xylella fastidiosa 9a5c]
          Length = 490

 Score =  278 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 227/413 (54%), Positives = 306/413 (74%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y  LY  V++AI  G  LGH  P +G Q++PLGD F+K  KM+I+PVIFLT+ TGIA 
Sbjct: 59  PFYLQLYFWVIIAIILGALLGHCYPVVGQQLKPLGDAFIKLVKMIISPVIFLTIVTGIAS 118

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           +  +  + ++F KAM  F  FS  AL++GL+V ++  PG+GMN++   L+   IA +++ 
Sbjct: 119 VAHVGTVARVFGKAMVYFLFFSTLALLLGLVVAHVVHPGVGMNINPADLHQGEIASYVEK 178

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  + +GF+ D+IP T LS     NILQ L VA+LFGI+L+L GE+   +   L+ +  
Sbjct: 179 SHDLTLVGFLMDIIPKTLLSPFVGDNILQVLFVAVLFGIALALAGERGKPVLNLLDALTL 238

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V ++M++AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F+L +LG ++ 
Sbjct: 239 PVFKLVQMLMKMAPIGAFGAIAFTIGKYGVDSLVNLGWLVGSFYLTSLLFVLVILGAVSW 298

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSI+KLI +LK E+LLVL TSSSE+ALP LM+KM +AGC +S+V +VVPTGYSFNLD
Sbjct: 299 FSGFSILKLIRYLKSELLLVLGTSSSEAALPSLMEKMVQAGCKKSVVGLVVPTGYSFNLD 358

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN  L+   QL+L L+AM+SSKGAAGV+G+ FITLAAT+T+VP 
Sbjct: 359 GTNIYMTLAALFIAQATNTELTPAHQLALFLVAMLSSKGAAGVSGAGFITLAATLTVVPE 418

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +PIAGM LILGVDRFMSECRS+TNFIGNAV T+VVSRWE  L+ +     +  
Sbjct: 419 VPIAGMALILGVDRFMSECRSLTNFIGNAVATLVVSRWENALNHEQLKIALDG 471


>gi|148546604|ref|YP_001266706.1| sodium:dicarboxylate symporter [Pseudomonas putida F1]
 gi|148510662|gb|ABQ77522.1| sodium:dicarboxylate symporter [Pseudomonas putida F1]
          Length = 438

 Score =  278 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 187/421 (44%), Positives = 288/421 (68%), Gaps = 1/421 (0%)

Query: 4   SVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVI 63
             +     R P YK +Y QVLV I  G  +GHF P     ++PLGD F+K  KM+I PV+
Sbjct: 13  QTKPAARTRQPFYKAMYFQVLVGIVLGGIVGHFWPDFAASLKPLGDAFIKLIKMIIGPVV 72

Query: 64  FLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN 123
           F TV TGIA M+D+K +G++  KA+  F + S  +L+IGL+ G++  PG G +V+  SL+
Sbjct: 73  FCTVVTGIAGMQDLKKVGRVGGKALIYFEIISTLSLIIGLLGGHLFNPGAGFHVNPNSLD 132

Query: 124 TESIAH-IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
             ++    + +     + F+  +IP+T +SAL  GNIL  L++++LFG +LS +G+K   
Sbjct: 133 ASAVTGFAEKAQHLGVVEFLLGIIPNTFVSALADGNILCILLISVLFGCALSAMGDKGKP 192

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   +E ++   F +V I+ +++ +GAFGA++FT+G YG +S+  L+ L+   Y    FF
Sbjct: 193 VYAMIEGVSGVFFGIVHIIAKLSAIGAFGAIAFTVGTYGAASLLPLLKLIASFYILCIFF 252

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           I+ VLG +AR C FSI++ + F+K+E+L+VL TSSSE  LP +M+KME  GC +S+V +V
Sbjct: 253 IVLVLGFVARVCGFSILRFVSFIKDELLIVLGTSSSEVVLPQIMEKMERLGCSKSVVGLV 312

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +PTGYSFNLDG+NIY+T+A LFI+QA ++ L+   QL+L+++AM+SSKGA+GV+G+AF+ 
Sbjct: 313 IPTGYSFNLDGTNIYLTMAVLFIAQALDIELTWGQQLTLVIVAMLSSKGASGVSGAAFVM 372

Query: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           L +T+ ++P +P+AGM LILG+ RFM    ++TN +GN V  +VVS WEK+LD    N+ 
Sbjct: 373 LTSTLLVIPVVPVAGMVLILGIHRFMGTGLAMTNLVGNGVAALVVSAWEKELDRDKLNQE 432

Query: 423 I 423
           +
Sbjct: 433 L 433


>gi|270264224|ref|ZP_06192491.1| transporter [Serratia odorifera 4Rx13]
 gi|270041873|gb|EFA14970.1| transporter [Serratia odorifera 4Rx13]
          Length = 429

 Score =  278 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKITIFKSLYFQVLTAITLGVLLGHFYPEIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTLALLIGLLIVNVVQPGAGMNIDPGTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G+K   I   ++ 
Sbjct: 121 AEQAQQQGIVPFLLDIIPGSVIGAFASGNILQVLLFAVLFGFALHRLGDKGQLIFNVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLLQLGQLIACFYITCVLFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K + ++KEE+L+VL TSSSES LP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARANGFSIFKFVRYIKEELLIVLGTSSSESVLPRMLDKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIVHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K     + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDEKQLKDTLS 415


>gi|297529300|ref|YP_003670575.1| sodium:dicarboxylate symporter [Geobacillus sp. C56-T3]
 gi|297252552|gb|ADI25998.1| sodium:dicarboxylate symporter [Geobacillus sp. C56-T3]
          Length = 422

 Score =  278 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 143/411 (34%), Positives = 252/411 (61%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ + +  G+ +G      P++   +QP+GD+F++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQIFIGLILGIMVGAIFYGNPKVATYLQPIGDVFLRLIKMIVIPIVVSSLIVGVANVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD--LKSLNTESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL+  NI +PG+G+N+    K+     +      
Sbjct: 66  DVKKLGKLGGKTILYFEIITTIAIIVGLLAANIFQPGVGVNMKSLEKTDIQSYVDTTNEV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
              S +    +++P     AL++GN+L  +  +++FG+ ++ +GEK   + +  +     
Sbjct: 126 QHHSMVETFVNIVPKNVFEALSTGNMLPIIFFSVMFGLGVAAIGEKGKPVLRFFQGTAEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+ K+G++S+  L  LV  +YA  AFF+L VLG +A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSKFGVASLLPLSKLVVLVYAVMAFFVLVVLGAVAKL 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  +I  LK+E++L  STSSSE+ LP +M+KME+ GC +++ S VVPTGYSFNLDG
Sbjct: 246 VNTNIFHIIKILKDELVLAYSTSSSETVLPKVMEKMEKFGCSKAVTSFVVPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA +FI+Q   + + ++ Q+SL+L+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQALAAVFIAQLYGIDMPISQQISLVLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+  I G+DR +   R+V N IGN++  VV+S+WE + + +   +YI 
Sbjct: 365 PVEGLAFIAGIDRLLDMARTVVNVIGNSLAAVVMSKWEGQYNEEQGKQYIA 415


>gi|300771580|ref|ZP_07081455.1| aerobic C4-dicarboxylate transporter [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|300761569|gb|EFK58390.1| aerobic C4-dicarboxylate transporter [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 414

 Score =  278 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 172/410 (41%), Positives = 269/410 (65%), Gaps = 1/410 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           ++K L  QVL AI  G+  G + P      + + + F+   KM+I P+IFLT+  GIA M
Sbjct: 4   IFKNLTFQVLTAIILGVLAGIYFPGFADTARIISETFINMIKMVIAPIIFLTIVLGIASM 63

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSH 134
            DMK +G++  KA+  F + + FAL+IGL V +  +PG G+N + + +        +++ 
Sbjct: 64  GDMKKVGRVGGKALLYFEIVTTFALIIGLFVAHYTEPGRGVNFNHEGVADIQKYKNEAAE 123

Query: 135 AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPV 194
             ++I F   ++P     A T GNILQ L  ++LFG+ L+ +GE+   + +  +  +  +
Sbjct: 124 I-NWIEFFTHIVPSNVFKAFTDGNILQVLFFSILFGLGLTKLGEQGQPLLRSFDRFSKVL 182

Query: 195 FRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFC 254
           F ++ ++MR+APLGAFG M++TIG +G+ +++ +  L+  +YAT   FI   L I+ R  
Sbjct: 183 FNIMKMIMRLAPLGAFGGMAYTIGTHGIEALAPMGRLMLSVYATMILFIFVCLNIICRMY 242

Query: 255 RFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGS 314
           +FS+ K + F+KEE+L+VL TSSSES LP +M+KME+ GC RS+V +V+PTGYSFNLDG+
Sbjct: 243 KFSLWKYLKFIKEEILIVLGTSSSESVLPNIMQKMEDFGCSRSVVGLVIPTGYSFNLDGT 302

Query: 315 NIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLP 374
            IY+++AT+F++Q  +V LS    L+++ I +V+SKGAA VTG  FI LA T+T +  +P
Sbjct: 303 TIYLSMATIFLAQVFHVDLSFAQLLTIIGILLVTSKGAAAVTGGGFIVLAGTLTALKVIP 362

Query: 375 IAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           + GM ++LGVDRFMSE R++TN IGN V TVV+++ EK+ D + +   I 
Sbjct: 363 VEGMAILLGVDRFMSEARAITNLIGNGVATVVIAKSEKEFDEEKYENAIS 412


>gi|307728780|ref|YP_003906004.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1003]
 gi|307583315|gb|ADN56713.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1003]
          Length = 445

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 204/417 (48%), Positives = 296/417 (70%), Gaps = 2/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             R P Y ILY+QVL AI +G+ LGHF P   V ++PLGD+F+K  +M+I PVIF TV T
Sbjct: 1   MKRKPFYTILYVQVLAAIVAGVLLGHFAPHAAVALKPLGDLFIKLVRMIIGPVIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F   S  AL IGL+  ++  PG G NVD  +L+  +++ 
Sbjct: 61  GIASMQDMKKVGRVGGKALLYFEAASTLALAIGLLAAHVLAPGKGFNVDPSTLDARAVSG 120

Query: 130 --IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              +++H     GF+  +IP+T + AL  G+IL  L++A+LFG +L+L+GE    +   +
Sbjct: 121 YVAQAAHGDGITGFIAHVIPETFVGALVQGDILPVLLIAMLFGTALALMGEPGAPVAHLI 180

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E ++   FR+V +V  +AP+GAFGAM+FTIG+YG+ S+  ++ L+   Y T+  F+  VL
Sbjct: 181 ETLSKAFFRIVRMVTSLAPIGAFGAMAFTIGRYGIVSLLPMLKLIGTFYFTAFLFVAVVL 240

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+AR C FSI + + ++++E+L+VL TS+SE+ALP LM K+E  GC R +V +VVPTGY
Sbjct: 241 GIVARLCGFSIWRFLGYIRDELLIVLGTSTSEAALPQLMDKLERLGCPRGVVGLVVPTGY 300

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+NIY+TLA LF++QATN  LS   +++LLL+ M++SKG+ GVTG+ FITLAA++
Sbjct: 301 SFNLDGTNIYMTLAVLFLAQATNTHLSFAQEITLLLVTMLTSKGSTGVTGAGFITLAASL 360

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           ++VP++P++ M LILGVDRFMSECR++TN +GN V T+VVS WE  LD       +G
Sbjct: 361 SVVPTVPVSAMVLILGVDRFMSECRALTNIVGNGVATIVVSAWEGGLDRTKLAMALG 417


>gi|206576872|ref|YP_002236111.1| aerobic C4-dicarboxylate transport protein [Klebsiella pneumoniae
           342]
 gi|288933107|ref|YP_003437166.1| sodium:dicarboxylate symporter [Klebsiella variicola At-22]
 gi|290511901|ref|ZP_06551269.1| C4-dicarboxylate transporter [Klebsiella sp. 1_1_55]
 gi|226723840|sp|B5XN31|DCTA_KLEP3 RecName: Full=C4-dicarboxylate transport protein
 gi|206565930|gb|ACI07706.1| aerobic C4-dicarboxylate transport protein [Klebsiella pneumoniae
           342]
 gi|288887836|gb|ADC56154.1| sodium:dicarboxylate symporter [Klebsiella variicola At-22]
 gi|289775691|gb|EFD83691.1| C4-dicarboxylate transporter [Klebsiella sp. 1_1_55]
          Length = 428

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY+QVL AI  G+ LGHF P++G QM+P GD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYVQVLTAIAIGILLGHFYPELGAQMKPFGDAFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTIALIIGLIIVNVVQPGAGMNVDPSTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGVVAFLLDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDAKQMDDVLN 415


>gi|30271870|gb|AAP29969.1| C4-dicarboxylate transport protein [Pseudomonas putida]
          Length = 438

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 201/415 (48%), Positives = 299/415 (72%), Gaps = 3/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            R PLYK LY+QVLVAI  G+ LGH+ P+ GV ++PLGD FVK  KM+I P+IF TV +G
Sbjct: 3   TRQPLYKSLYVQVLVAITIGILLGHYYPETGVALKPLGDGFVKLIKMVIAPIIFCTVVSG 62

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+ KPG GM++D+ +LN  S+A  
Sbjct: 63  IAGMQSMKSVGKTGGYALLYFEIVSTVALIIGLVVVNVVKPGAGMHIDVSTLNASSVAAY 122

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            ++ A+ + +GF+ ++IP+T + A  +G+ILQ L+ ++LFG +L  +G     +   ++ 
Sbjct: 123 AAAGAQQTTVGFLLNVIPNTVVGAFANGDILQVLMFSVLFGFALHRLGSYGKPVLDMIDR 182

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               +F +++++M++AP  AFGAM+FTIG+YG+ S+  L +L+ C Y T   F+L VLG 
Sbjct: 183 FAHVMFNIINMIMKLAP--AFGAMAFTIGQYGVGSLVQLGYLMACFYITCLLFVLVVLGG 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           + R   FS++KLI +++ E+L+VL TSSSESALP ++ KME  G  +S+V +V+PTGYSF
Sbjct: 241 ICRAHGFSVLKLIRYIRVELLIVLGTSSSESALPRMLAKMERLGAKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QAT+  + +T Q++LLL+ +V+SKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATDTTMDITHQITLLLVLLVASKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GNAV TVVV++W K++D       + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKEMDNDKLASELA 415


>gi|228947201|ref|ZP_04109495.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228812448|gb|EEM58775.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 420

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGSIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLSHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVLE 411


>gi|26988781|ref|NP_744206.1| sodium:dicarboxylate symporter [Pseudomonas putida KT2440]
 gi|24983578|gb|AAN67670.1|AE016397_4 C4-dicarboxylate transport protein [Pseudomonas putida KT2440]
          Length = 439

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 190/415 (45%), Positives = 279/415 (67%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L K LY Q+L A+  G+ +GHF  Q  V ++PLGD F+K  KM+I PV+F T+ TGIA
Sbjct: 5   MRLAKSLYFQILCAVLLGVVVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA 64

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D + +G++  K + LF   ++ +LVIGL    + KPG GMN+D  +L+T  ++   +
Sbjct: 65  GMTDKRSLGRLMSKTLLLFLGLTVVSLVIGLAAVYLFKPGAGMNIDPATLSTAGLSQYTA 124

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           S AK S + F   +IPDT + A   G +L  L +A+L G +LS +GEK   +   LE  +
Sbjct: 125 SAAKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLDVLESAS 184

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFR+   +MR AP+GAFGA++FT+G+YG++S+  L  LV  LY   AFF+L VLG + 
Sbjct: 185 TMVFRIFGYLMRFAPIGAFGALAFTVGQYGITSLGALAKLVGTLYIACAFFVLVVLGGIC 244

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KL+ + +EE L+VL TSS+E  LP +++K+E+ GC + +V +V+PTGYSFNL
Sbjct: 245 RAHGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL 304

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+ IY++LA +FI+QA N+ LSL   +++L I ++SSKGAAGVTGS F+ LA+T+T++ 
Sbjct: 305 DGTAIYLSLAAVFIAQACNIDLSLGQVVTMLAIMLLSSKGAAGVTGSGFVALASTLTVIH 364

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ L++GVDRFMSE R++T+   NAV TVVVS  E   D +  +  +  E
Sbjct: 365 DIPLAGLALLIGVDRFMSEARALTSLASNAVATVVVSLSENACDRQTLHSRLNGE 419


>gi|75762273|ref|ZP_00742159.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74490239|gb|EAO53569.1| C4-dicarboxylate transport protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 420

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 177/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIAKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A  +G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFATGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YA  A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYAAMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDLGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTKVIE 411


>gi|238797066|ref|ZP_04640569.1| C4-dicarboxylate transport protein [Yersinia mollaretii ATCC 43969]
 gi|238719111|gb|EEQ10924.1| C4-dicarboxylate transport protein [Yersinia mollaretii ATCC 43969]
          Length = 431

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKASIFKSLYFQVLTAITLGVLLGHFYPDLGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIVPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQIIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQAVLS 415


>gi|238750214|ref|ZP_04611716.1| C4-dicarboxylate transport protein [Yersinia rohdei ATCC 43380]
 gi|238711447|gb|EEQ03663.1| C4-dicarboxylate transport protein [Yersinia rohdei ATCC 43380]
          Length = 430

 Score =  278 bits (712), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKASIFKSLYFQVLTAITLGVLLGHFYPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLMFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C YAT   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYATCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCKQLDNDQLQAVLS 415


>gi|123444239|ref|YP_001008207.1| C4-dicarboxylate transporter DctA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|167012308|sp|A1JSS6|DCTA_YERE8 RecName: Full=C4-dicarboxylate transport protein
 gi|122091200|emb|CAL14083.1| C4-dicarboxylate transport protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 430

 Score =  278 bits (712), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 206/415 (49%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKASVFKSLYFQVLTAITLGVLLGHFYPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTIALLIGLVIVNVVQPGAGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCVLFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMEKAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W  +LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCNQLDNDQLQAVLS 415


>gi|317046364|ref|YP_004114012.1| sodium:dicarboxylate symporter [Pantoea sp. At-9b]
 gi|316947981|gb|ADU67456.1| sodium:dicarboxylate symporter [Pantoea sp. At-9b]
          Length = 428

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 303/415 (73%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVLVAI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLVAIGIGVLLGHFYPELGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIVVNVIQPGAGMNIDPATLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP++ + A  SGNILQ L+ A+LFG +L  +G+K   I   +E 
Sbjct: 121 AQQAEQQGVIAFLLDVIPNSVIGAFASGNILQVLLFAILFGFALHRLGDKGTLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG+
Sbjct: 181 FSKVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGL 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K + ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARVAGFNIFKFVAYIKEELLIVLGTSSSESALPRMLDKMERLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNAHMDVIHQITLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W  +LD +  N+ + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVGQLDERQLNETLS 415


>gi|206975527|ref|ZP_03236440.1| C4-dicarboxylate transporter [Bacillus cereus H3081.97]
 gi|217960987|ref|YP_002339555.1| C4-dicarboxylate transporter DctA [Bacillus cereus AH187]
 gi|222097041|ref|YP_002531098.1| c4-dicarboxylate transporter dcta [Bacillus cereus Q1]
 gi|229140200|ref|ZP_04268758.1| C4-dicarboxylate transport protein [Bacillus cereus BDRD-ST26]
 gi|206746429|gb|EDZ57823.1| C4-dicarboxylate transporter [Bacillus cereus H3081.97]
 gi|217065087|gb|ACJ79337.1| C4-dicarboxylate transporter [Bacillus cereus AH187]
 gi|221241099|gb|ACM13809.1| C4-dicarboxylate transport protein [Bacillus cereus Q1]
 gi|228643286|gb|EEK99559.1| C4-dicarboxylate transport protein [Bacillus cereus BDRD-ST26]
          Length = 420

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+I+ N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIIANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWVDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPIGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDEEKYTRVIE 411


>gi|229197696|ref|ZP_04324416.1| C4-dicarboxylate transport protein [Bacillus cereus m1293]
 gi|228585773|gb|EEK43871.1| C4-dicarboxylate transport protein [Bacillus cereus m1293]
          Length = 420

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 177/412 (42%), Positives = 275/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPIGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 FYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVLE 411


>gi|260599821|ref|YP_003212392.1| C4-dicarboxylate transporter DctA [Cronobacter turicensis z3032]
 gi|260218998|emb|CBA34353.1| C4-dicarboxylate transport protein [Cronobacter turicensis z3032]
          Length = 452

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 204/417 (48%), Positives = 299/417 (71%), Gaps = 1/417 (0%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVS 68
             ++  ++K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV 
Sbjct: 23  TPMKLSIFKSLYFQVLTAIAIGILLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVV 82

Query: 69  TGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA 128
           TGIA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMNVD  +L+ +++A
Sbjct: 83  TGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLVIVNVIQPGAGMNVDPATLDAKAVA 142

Query: 129 -HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
            + + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G     I   +
Sbjct: 143 VYAEQAQQQGIVAFLMDVIPSSVIGAFASGNILQVLLFAVLFGFALHRLGRNGQLIFNVI 202

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E  +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VL
Sbjct: 203 ESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYLTCILFVVVVL 262

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +AR   F+I K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGY
Sbjct: 263 GSIARATGFNIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGY 322

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT+
Sbjct: 323 SFNLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATL 382

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           + V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 383 SAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDEKQLHDTLN 439


>gi|152972386|ref|YP_001337532.1| C4-dicarboxylate transporter DctA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238896976|ref|YP_002921721.1| C4-dicarboxylate transporter DctA [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040585|ref|ZP_06013825.1| aerobic C4-dicarboxylate transporter [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|329999239|ref|ZP_08303387.1| aerobic C4-dicarboxylate transport protein [Klebsiella sp. MS 92-3]
 gi|167012302|sp|A6TFD1|DCTA_KLEP7 RecName: Full=C4-dicarboxylate transport protein
 gi|150957235|gb|ABR79265.1| C4-dicarboxylate transport protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238549303|dbj|BAH65654.1| C4-dicarboxylate transport protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042077|gb|EEW43108.1| aerobic C4-dicarboxylate transporter [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328538365|gb|EGF64497.1| aerobic C4-dicarboxylate transport protein [Klebsiella sp. MS 92-3]
          Length = 428

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 300/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY+QVL AI  G+ LGHF P++G QM+P GD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYVQVLTAIAIGILLGHFYPELGAQMKPFGDAFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTIALIIGLIIVNVVQPGAGMNVDPSTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGVVAFLLDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDAKQMDDVLN 415


>gi|300693976|ref|YP_003749949.1| c4-dicarboxylate transport protein 3 [Ralstonia solanacearum PSI07]
 gi|299076013|emb|CBJ35324.1| C4-dicarboxylate transport protein 3 [Ralstonia solanacearum PSI07]
          Length = 446

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 193/418 (46%), Positives = 291/418 (69%), Gaps = 3/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            IR  L K LY+QVL+ + +G+ALG   P +G  ++PLGD+F+K  KM+  P+IF TV+ 
Sbjct: 1   MIRKTLGK-LYVQVLIGVAAGIALGVMAPNLGSDLKPLGDVFIKLIKMVFAPIIFATVTL 59

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIARM++MK +G++  +A+  F V S FAL +GLIV N+ +PG GMNVD   L+T++IA 
Sbjct: 60  GIARMENMKELGRVGVRALLYFEVLSTFALALGLIVVNLVQPGRGMNVDPAHLDTKAIAS 119

Query: 130 IK--SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
               ++  ++F+ F+  ++P + + AL   ++LQ L+ A LFGI+LS +G ++  +   L
Sbjct: 120 YTHAAAKPQTFVDFLLSLVPSSIVDALARNDVLQILVFATLFGIALSRMGTRARPVVDFL 179

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           +     VF +V ++MR+AP+ AFGAM+FT+GKYGL SI+ L  L+  +Y T   F+  VL
Sbjct: 180 DAFTHGVFSIVGMIMRLAPIAAFGAMAFTVGKYGLGSIAALGKLMATMYITCVLFVAIVL 239

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +AR   FS+ K + ++++E+  VL TSSSES +P LM+K+E AG  + +V +VVP+G 
Sbjct: 240 GGVARLAGFSLWKFLKYIQDEIFTVLGTSSSESVVPQLMRKLESAGVSKPVVGLVVPSGL 299

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FN DG  IY T+A +F++QATN PL+LTDQL +L + +++SKG+AGVTGS FITLAAT+
Sbjct: 300 TFNPDGQCIYYTMAAIFVAQATNTPLTLTDQLVVLGVLLLTSKGSAGVTGSGFITLAATL 359

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
             + ++P+AGM L+LG+DRFMSE R++TN IGNAV T+ ++RW   +D +     +  
Sbjct: 360 ASLGNIPVAGMVLLLGIDRFMSEARAITNTIGNAVGTLAIARWVGAVDRQRLQAVLDG 417


>gi|52141949|ref|YP_084880.1| C4-dicarboxylate transporter DctA [Bacillus cereus E33L]
 gi|51975418|gb|AAU16968.1| C4-dicarboxylate transport protein [Bacillus cereus E33L]
          Length = 420

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLSHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVLE 411


>gi|226310852|ref|YP_002770746.1| C4-dicarboxylate transporter DctA [Brevibacillus brevis NBRC
           100599]
 gi|226093800|dbj|BAH42242.1| probable C4-dicarboxylate ABC transporter permease protein
           [Brevibacillus brevis NBRC 100599]
          Length = 430

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 184/400 (46%), Positives = 278/400 (69%), Gaps = 1/400 (0%)

Query: 16  YKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           +K L +QV++AI  G+ +GHF P+ G +++ L DIFVK  KM+I P++F TV  GIA M 
Sbjct: 5   FKNLTVQVVIAIILGILVGHFAPKFGAELKVLADIFVKLIKMVIPPIVFFTVVNGIASMG 64

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDL-KSLNTESIAHIKSSH 134
           DMK +G+I  KA+  F + +  AL IGL+V N+ KPG G +     S +        +  
Sbjct: 65  DMKKVGKIGGKALLYFEIVTTIALAIGLLVVNLIKPGAGFDKTGLTSGDVSKYTEAAAQS 124

Query: 135 AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPV 194
              FI F+  +IP+  + A+  G +L  L  A+LFG+SL+ +G+ S  + K  +++    
Sbjct: 125 NNGFIDFITGIIPENVVGAMAKGELLPILFFAVLFGLSLAAMGQASQPVIKLFDKLTHGF 184

Query: 195 FRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFC 254
           F +V+++M+++P+ AFGAM++TIGK+G+ S++ L  L+  +Y T   FI+ VLG +AR+ 
Sbjct: 185 FGVVNMIMKVSPIAAFGAMAYTIGKFGIGSLTRLGLLMTAVYITMFLFIILVLGGVARYY 244

Query: 255 RFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGS 314
           +FSI   I +++EE+LLVL TSSSESALP +M ++E+ GC +S+V +VVPTGYSFNLDG+
Sbjct: 245 KFSIFSFIKYIREEILLVLGTSSSESALPRMMDRLEKYGCSKSVVGLVVPTGYSFNLDGT 304

Query: 315 NIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLP 374
           +IY+++A +FI+QA  + LS  +Q++LL I M++SKGAAGVTGS FITLAAT+   P +P
Sbjct: 305 SIYLSMAAIFIAQAYGIELSFWEQITLLGILMITSKGAAGVTGSGFITLAATLAAFPVIP 364

Query: 375 IAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
           + G+ L++GVDRFMSE R++TN IGN V TVV+++ E + 
Sbjct: 365 VEGIALLIGVDRFMSEARAITNLIGNGVATVVIAKHENEF 404


>gi|227535779|ref|ZP_03965828.1| DAACS family dicarboxylate/amino acid:cation symporter
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|227244267|gb|EEI94282.1| DAACS family dicarboxylate/amino acid:cation symporter
           [Sphingobacterium spiritivorum ATCC 33300]
          Length = 414

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 172/410 (41%), Positives = 269/410 (65%), Gaps = 1/410 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           ++K L  QVL AI  G+  G + P      + + + F+   KM+I P+IFLT+  GIA M
Sbjct: 4   IFKNLTFQVLTAIILGVLAGIYFPGFADTARIISETFINMIKMVIAPIIFLTIVLGIASM 63

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSH 134
            DMK +G++  KA+  F + + FAL+IGL V +  +PG G+N + + +        +++ 
Sbjct: 64  GDMKKVGRVGGKALLYFEIVTTFALIIGLFVAHYTEPGRGVNFNHEGVADIQKYKNEAAE 123

Query: 135 AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPV 194
             ++I F   ++P     A T GNILQ L  ++LFG+ L+ +GE+   + +  +  +  +
Sbjct: 124 I-NWIEFFTHIVPSNVFKAFTDGNILQVLFFSILFGLGLTKLGEQRQPLLRSFDRFSKVL 182

Query: 195 FRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFC 254
           F ++ ++MR+APLGAFG M++TIG +G+ +++ +  L+  +YAT   FI   L I+ R  
Sbjct: 183 FNIMKMIMRLAPLGAFGGMAYTIGTHGIEALAPMGRLMLSVYATMILFIFVCLNIICRMY 242

Query: 255 RFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGS 314
           +FS+ K + F+KEE+L+VL TSSSES LP +M+KME+ GC RS+V +V+PTGYSFNLDG+
Sbjct: 243 KFSLWKYLKFIKEEILIVLGTSSSESVLPNIMQKMEDFGCSRSVVGLVIPTGYSFNLDGT 302

Query: 315 NIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLP 374
            IY+++AT+F++Q  +V LS    L+++ I +V+SKGAA VTG  FI LA T+T +  +P
Sbjct: 303 TIYLSMATIFLAQVFHVDLSFAQLLTIIGILLVTSKGAAAVTGGGFIVLAGTLTALKVIP 362

Query: 375 IAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           + GM ++LGVDRFMSE R++TN IGN V TVV+++ EK+ D + +   I 
Sbjct: 363 VEGMAILLGVDRFMSEARAITNLIGNGVATVVIAKSEKEFDEEKYQNAIS 412


>gi|157960603|ref|YP_001500637.1| sodium:dicarboxylate symporter [Shewanella pealeana ATCC 700345]
 gi|157845603|gb|ABV86102.1| sodium:dicarboxylate symporter [Shewanella pealeana ATCC 700345]
          Length = 432

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 122/408 (29%), Positives = 224/408 (54%), Gaps = 9/408 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+  G  + +    ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIMIGMLLGILTGVSLGEQATYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMQDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG+I +PG G+++                 A S 
Sbjct: 81  KMGRIGFKSFAFYLGTTSIAITLGLAVGHIMQPGTGLDM------VAHETAEVVKQAPSI 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + D++P   ++AL SG ILQ ++ A+  GI+L L+GE      K  E +   ++++ 
Sbjct: 135 MQTLIDIVPTNPIAALASGQILQVIVFAVALGIALVLIGEHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL-GILARFCRFS 257
            +VM+ AP G FG M++  G+YG+  +  LI ++  +Y      ++G    +L  F + +
Sbjct: 195 DLVMKFAPYGVFGLMAWVAGEYGVDMLMPLIKVIIAVYIGCFLHVVGFYSFVLVVFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            I+    +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PIQFFKGISNAIAVAYTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D ++++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLTWVDYITIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E ++D + +N    
Sbjct: 374 GVALIAGIDRILDMARTVVNVSGDLVATTVIAKSEGEIDVEHYNANAE 421


>gi|16124881|ref|NP_419445.1| sodium:dicarboxylate symporter family protein [Caulobacter
           crescentus CB15]
 gi|221233601|ref|YP_002516037.1| C4-dicarboxylate transport protein [Caulobacter crescentus NA1000]
 gi|20137916|sp|Q9AAH2|DCTA_CAUCR RecName: Full=C4-dicarboxylate transport protein
 gi|254767174|sp|B8H0N0|DCTA_CAUCN RecName: Full=C4-dicarboxylate transport protein
 gi|13421839|gb|AAK22613.1| sodium:dicarboxylate symporter family protein [Caulobacter
           crescentus CB15]
 gi|220962773|gb|ACL94129.1| C4-dicarboxylate transport protein [Caulobacter crescentus NA1000]
          Length = 420

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 206/411 (50%), Positives = 294/411 (71%), Gaps = 2/411 (0%)

Query: 17  KILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKD 76
           K +Y+QVL+AI  G+ +G   PQIGV ++PLGD F+K  K++I PVIF TV+ GIARM D
Sbjct: 5   KSIYVQVLIAIVLGVLVGAIWPQIGVALKPLGDGFIKLIKLVIAPVIFCTVAGGIARMGD 64

Query: 77  MKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI--KSSH 134
           MK  G++  KA+  F V S  ALVIGL+VG + +PG G N+D  +L+    A    K+ H
Sbjct: 65  MKAFGRVGVKALIYFEVVSTLALVIGLVVGRLIQPGAGFNIDPATLDASIAAGYVEKAQH 124

Query: 135 AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPV 194
            +  + ++  +IPDT + A   GN+LQ L++A+L G +   +G+  + +   L+E +   
Sbjct: 125 GEGMVAYLLHLIPDTFIGAFADGNLLQVLVIAILTGFACVRMGDFGEKVAHVLDETSKLF 184

Query: 195 FRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFC 254
           F ++ IV+R+AP+GAFGAM FTIGKYG+ ++  L  LV   Y TS  F+L VLG +A   
Sbjct: 185 FGIIHIVVRLAPIGAFGAMGFTIGKYGVEALVQLGALVATFYVTSLLFVLVVLGGIAWVS 244

Query: 255 RFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGS 314
            FSI + + +++EE+L+VL TSSSES LP +M+K+E AG  RS+V +V+PTGYSFNLDG+
Sbjct: 245 GFSIFRFLAYIREELLIVLGTSSSESVLPQMMEKLENAGARRSVVGLVIPTGYSFNLDGT 304

Query: 315 NIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLP 374
           NIY+TLATLF++QATN PLSL  +L+LL +AM++SKGA+GVTG+ FITLAAT+ +VP +P
Sbjct: 305 NIYMTLATLFLAQATNTPLSLGQELALLGVAMLTSKGASGVTGAGFITLAATLAVVPDIP 364

Query: 375 IAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           IA + +++GVDRFMSECR++TN +GN V T+VV+RWE  LD +  ++ +  
Sbjct: 365 IAALAILVGVDRFMSECRALTNLVGNGVATLVVARWEGALDRQRLDRVLRG 415


>gi|196034057|ref|ZP_03101467.1| C4-dicarboxylate transporter [Bacillus cereus W]
 gi|195993131|gb|EDX57089.1| C4-dicarboxylate transporter [Bacillus cereus W]
          Length = 420

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGSIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVLE 411


>gi|229111010|ref|ZP_04240569.1| C4-dicarboxylate transport protein [Bacillus cereus Rock1-15]
 gi|228672373|gb|EEL27658.1| C4-dicarboxylate transport protein [Bacillus cereus Rock1-15]
          Length = 420

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
               ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFINILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K + ++KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAYIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|196044497|ref|ZP_03111732.1| C4-dicarboxylate transporter [Bacillus cereus 03BB108]
 gi|225865568|ref|YP_002750946.1| C4-dicarboxylate transporter [Bacillus cereus 03BB102]
 gi|196024532|gb|EDX63204.1| C4-dicarboxylate transporter [Bacillus cereus 03BB108]
 gi|225789763|gb|ACO29980.1| C4-dicarboxylate transporter [Bacillus cereus 03BB102]
          Length = 420

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIIKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLSHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMRVLE 411


>gi|229174247|ref|ZP_04301780.1| C4-dicarboxylate transport protein [Bacillus cereus MM3]
 gi|228609104|gb|EEK66393.1| C4-dicarboxylate transport protein [Bacillus cereus MM3]
          Length = 420

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 273/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+I+ N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIIANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMQWVDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG MSFTIGKYGLS++  L  L+ C+Y T A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMSFTIGKYGLSTLIPLGKLMICVYTTMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDEEKYTRVIE 411


>gi|170722333|ref|YP_001750021.1| sodium:dicarboxylate symporter [Pseudomonas putida W619]
 gi|169760336|gb|ACA73652.1| sodium:dicarboxylate symporter [Pseudomonas putida W619]
          Length = 438

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 186/415 (44%), Positives = 279/415 (67%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K LY Q+L A+  G+ +GHF  Q  V ++PLGD F+K  KM+I PV+F T+ TGIA
Sbjct: 1   MKIAKSLYFQILCAVVLGVVVGHFWAQEAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D + +G++  K + LF   ++ +L+IGL    + +PG GMN+D  +L+TE ++   +
Sbjct: 61  GMTDKRSLGRLMSKTLLLFLGLTVVSLIIGLAAVYLFRPGEGMNIDPATLSTEGLSQYAA 120

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           S AK S + F   +IPDT + A   G +L  L +A+L G +LS +GEK   +   LE  +
Sbjct: 121 SAAKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLDVLESAS 180

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFR+   +MR AP+GAFGA++FT+G+YG+SS+  L  LV  LY   AFF++ VLG + 
Sbjct: 181 AMVFRIFGYLMRFAPIGAFGALAFTVGQYGISSLGALAKLVGTLYIACAFFVIVVLGGIC 240

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KL+ + +EE L+VL TSS+E  LP +++K+E+ GC + +V +V+PTGYSFNL
Sbjct: 241 RAHGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL 300

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+ IY++LA +FI+QA N+ L+L   +++L I ++SSKGAAGVTGS F+ LA+T+T++ 
Sbjct: 301 DGTAIYLSLAAIFIAQACNIDLTLGQTITMLAIMLLSSKGAAGVTGSGFVALASTLTVIH 360

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ L++GVDRFMSE R++T+   NAV TVVVS  E   +     + +  E
Sbjct: 361 DIPLAGLALLIGVDRFMSEARALTSLASNAVATVVVSLSENACERDTLMRTLNGE 415


>gi|218530553|ref|YP_002421369.1| sodium:dicarboxylate symporter [Methylobacterium chloromethanicum
           CM4]
 gi|218522856|gb|ACK83441.1| sodium:dicarboxylate symporter [Methylobacterium chloromethanicum
           CM4]
          Length = 465

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 189/414 (45%), Positives = 287/414 (69%), Gaps = 3/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y++LYIQVL+AI  G+ LG   P+ G  ++ LGD F+   KMLI P+IF T+  GIA 
Sbjct: 20  PWYRVLYIQVLIAIVLGVLLGWLQPEWGKSLKWLGDGFIALIKMLIAPIIFCTIVHGIAS 79

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           + D+K +G++  KA+  F V S  AL+IG+IVG + +PG G   D+  L+ +++  +   
Sbjct: 80  IGDLKKVGRVGLKALIYFEVVSSLALLIGIIVGEVVQPGAGFGADVSKLDAKAVEGYASK 139

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           + A S +  +  +IP +   A  +G++LQ L++++L G+ L+ +G+K ++I   ++    
Sbjct: 140 AAADSTVAHLLGIIPKSFFDAFATGDLLQVLLISVLTGVVLTGMGKKGESITHGIDAAGQ 199

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             FR++ +++++AP+GAFGAM+FT+G+YG+  + +L +LV   Y TS  FI  VLG +A 
Sbjct: 200 VFFRIIGLIVKLAPIGAFGAMAFTVGQYGIGKVIDLAWLVGTFYTTSLLFIFVVLGGIAA 259

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSIIK + ++K+E+L+VL TSSSE+ LP +M KM+  G   S+V +V+PTGYSFNLD
Sbjct: 260 FAGFSIIKFLAYIKDELLIVLGTSSSETVLPHMMTKMKRLGASDSVVGLVIPTGYSFNLD 319

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TL TLF++QA    LS+    ++ L+AM++SKGA+GVTG+ FITLAAT+  +P 
Sbjct: 320 GTNIYMTLTTLFLAQAVGADLSVGQYATIFLVAMLTSKGASGVTGAGFITLAATLAAIPG 379

Query: 373 --LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+A MTL+LGVD+FMSECR++TN IGN V T+VVSRWE +LD K   + + 
Sbjct: 380 APVPVAAMTLVLGVDKFMSECRALTNLIGNGVATIVVSRWEGELDRKKLAEVMA 433


>gi|224826173|ref|ZP_03699276.1| sodium:dicarboxylate symporter [Lutiella nitroferrum 2002]
 gi|224601810|gb|EEG07990.1| sodium:dicarboxylate symporter [Lutiella nitroferrum 2002]
          Length = 443

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 172/420 (40%), Positives = 277/420 (65%), Gaps = 4/420 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +    +K L+ QV++A+  G+ +G   P    +++P+GD F+K  KML+ P++F  V  G
Sbjct: 1   MYKRFHKTLFGQVVIALILGVIVGIVWPDFATKLKPMGDGFIKLIKMLVAPLVFCVVVHG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           I    D+K +G++  KA+  F + + FAL +G+++    +PG GMN+D  +L+  ++A  
Sbjct: 61  ICSTGDLKKVGRVGVKALLYFEIVTTFALALGVLLAETLRPGAGMNIDPHTLDASALADY 120

Query: 131 KSSHAK----SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
               ++    + + F+  +IP T   A   G+ILQ L++A+LFG +++ +GE+   +   
Sbjct: 121 SERVSQVGHLTAVDFIMKLIPATFGDAFAKGDILQVLLIAILFGCAVAALGERGRPVTVA 180

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
           ++ +    F+++  ++++APLG  GA++FT+GKYG+ S+  L  LV   Y T + F++G+
Sbjct: 181 IDHLGQVFFKLIGFIVKLAPLGVMGAIAFTVGKYGIGSLKQLGLLVALFYLTCSIFVVGI 240

Query: 247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTG 306
           LGI+ R   F+I KL+ +L+EE+L+VL T+SS++ LP +M+K+E  G   S V +V+PTG
Sbjct: 241 LGIILRLAGFNIFKLLGYLREELLIVLGTASSDAVLPQVMRKLELMGVKDSTVGLVIPTG 300

Query: 307 YSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAAT 366
           YSFNLDG +IY+TLA +FI+QATN PLSLTD L++L I++V+SKGA GV GSA + LAAT
Sbjct: 301 YSFNLDGFSIYLTLAAVFIAQATNTPLSLTDLLTILAISLVTSKGAHGVPGSAIVILAAT 360

Query: 367 ITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++ +P++P  G+ L+L VD FM   R++TN IGN V TVVV  WEK +D K   + +  E
Sbjct: 361 LSAIPAIPAIGLVLVLSVDWFMGMARALTNMIGNCVATVVVGVWEKDIDRKRATQVLNGE 420


>gi|49186385|ref|YP_029637.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str. Sterne]
 gi|165871079|ref|ZP_02215730.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0488]
 gi|167636287|ref|ZP_02394589.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0442]
 gi|167640557|ref|ZP_02398819.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0193]
 gi|170688446|ref|ZP_02879654.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0465]
 gi|170708107|ref|ZP_02898554.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0389]
 gi|177652500|ref|ZP_02934967.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0174]
 gi|190564477|ref|ZP_03017398.1| C4-dicarboxylate transporter [Bacillus anthracis Tsiankovskii-I]
 gi|227813583|ref|YP_002813592.1| C4-dicarboxylate transporter [Bacillus anthracis str. CDC 684]
 gi|254686152|ref|ZP_05150011.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str.
           CNEVA-9066]
 gi|254723550|ref|ZP_05185338.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str. A1055]
 gi|254738625|ref|ZP_05196328.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str. Western
           North America USA6153]
 gi|254744817|ref|ZP_05202495.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str. Kruger
           B]
 gi|254752943|ref|ZP_05204979.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str. Vollum]
 gi|254759215|ref|ZP_05211241.1| C4-dicarboxylate transporter DctA [Bacillus anthracis str.
           Australia 94]
 gi|49180312|gb|AAT55688.1| sodium:dicarboxylate symporter [Bacillus anthracis str. Sterne]
 gi|164713290|gb|EDR18816.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0488]
 gi|167511425|gb|EDR86809.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0193]
 gi|167528310|gb|EDR91082.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0442]
 gi|170126915|gb|EDS95795.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0389]
 gi|170667616|gb|EDT18371.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0465]
 gi|172082174|gb|EDT67241.1| C4-dicarboxylate transporter [Bacillus anthracis str. A0174]
 gi|190563794|gb|EDV17758.1| C4-dicarboxylate transporter [Bacillus anthracis Tsiankovskii-I]
 gi|227003646|gb|ACP13389.1| C4-dicarboxylate transporter [Bacillus anthracis str. CDC 684]
          Length = 420

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 177/412 (42%), Positives = 275/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 FYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVVE 411


>gi|118478830|ref|YP_895981.1| C4-dicarboxylate transporter DctA [Bacillus thuringiensis str. Al
           Hakam]
 gi|196038253|ref|ZP_03105562.1| C4-dicarboxylate transporter [Bacillus cereus NVH0597-99]
 gi|218904713|ref|YP_002452547.1| C4-dicarboxylate transporter [Bacillus cereus AH820]
 gi|301055073|ref|YP_003793284.1| C4-dicarboxylate transport protein [Bacillus anthracis CI]
 gi|118418055|gb|ABK86474.1| C4-dicarboxylate transport protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|196030661|gb|EDX69259.1| C4-dicarboxylate transporter [Bacillus cereus NVH0597-99]
 gi|218538035|gb|ACK90433.1| C4-dicarboxylate transporter [Bacillus cereus AH820]
 gi|300377242|gb|ADK06146.1| C4-dicarboxylate transport protein [Bacillus cereus biovar
           anthracis str. CI]
          Length = 420

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVLE 411


>gi|167622767|ref|YP_001673061.1| sodium:dicarboxylate symporter [Shewanella halifaxensis HAW-EB4]
 gi|167352789|gb|ABZ75402.1| sodium:dicarboxylate symporter [Shewanella halifaxensis HAW-EB4]
          Length = 432

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 123/427 (28%), Positives = 228/427 (53%), Gaps = 13/427 (3%)

Query: 4   SVQVHGDIRPPLYKI----LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLI 59
           S+Q    ++          L++Q+++ +  G+  G  + +    ++P+G +FV T KMLI
Sbjct: 2   SIQQPSLVKKVWSSWMSVPLWLQIMIGMLLGILTGIGLGEQATYLKPIGTLFVNTIKMLI 61

Query: 60  TPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDL 119
            P++F ++  G+  M+D   +G+I +K+   +   +  A+ +GL VG   +PG G+++  
Sbjct: 62  VPLVFCSLIVGVTSMQDTAKMGRIGFKSFAFYLGTTSIAITLGLAVGQFMQPGAGLDM-- 119

Query: 120 KSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
                          A S +  + D++P   ++AL SG ILQ ++ A+  GI+L L+GE 
Sbjct: 120 ----VPHETAEVIKQAPSVMQTLIDIVPTNPIAALASGQILQVIVFAVALGIALVLIGEH 175

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
                K  E +   ++++  +VM++AP G FG M++  G+YG+  +  LI ++  +Y   
Sbjct: 176 GKPAIKVFESLAEAMYKLTDLVMKLAPYGVFGLMAWVAGEYGVDMLMPLIKVIVAVYIGC 235

Query: 240 AFFILGVL-GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRS 297
              ++G    +L  F + + I+    +   + +  +TSSS   LP  MK   E  G ++ 
Sbjct: 236 FLHVVGFYSFVLVVFAKLNPIQFFKGISNAIAVAYTTSSSAGTLPASMKCASEYLGVNKK 295

Query: 298 IVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTG 357
           I S V+P G + N+DG+ +Y  +  LF++QA  + L+  D ++++L A ++S G AGV G
Sbjct: 296 ISSFVLPLGTTINMDGTALYQGVTALFVAQAFGIDLTWVDYITIILTATLASIGTAGVPG 355

Query: 358 SAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPK 417
           +  + L   +T V  LP+ G+ LI G+DR +   R+V N  G+ V T V+++ E ++D +
Sbjct: 356 AGLVMLTLVLTTV-GLPLEGVALIAGIDRILDMARTVVNVSGDLVATTVIAKSEGEIDVE 414

Query: 418 LFNKYIG 424
            +N    
Sbjct: 415 HYNANAE 421


>gi|330993825|ref|ZP_08317757.1| C4-dicarboxylate transport protein [Gluconacetobacter sp. SXCC-1]
 gi|329759093|gb|EGG75605.1| C4-dicarboxylate transport protein [Gluconacetobacter sp. SXCC-1]
          Length = 457

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 218/426 (51%), Positives = 304/426 (71%), Gaps = 1/426 (0%)

Query: 1   MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLIT 60
           M E  Q        +++ LY QV++A+ +GMALGHF P + V ++PLGD F++  KM+I 
Sbjct: 7   MPEQPQARPAPGRSIFRSLYGQVVIAVVAGMALGHFCPHVAVSLKPLGDAFIRLVKMVIP 66

Query: 61  PVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLK 120
           PVIFLTV TG+A + ++   G++  +AM  F  FS  ALV+G++V NI +PG  ++    
Sbjct: 67  PVIFLTVVTGVAGLGNLGQAGRLAGRAMVYFLTFSSLALVVGMVVANIVRPGAHIHASPA 126

Query: 121 SLNTESIAHIKS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEK 179
           +L+  ++A   + + A SF  F+ ++IPDT +SA  SG+ILQ L+VA+LF ISLS +G K
Sbjct: 127 TLDAHAVAAYTARAQAHSFSDFLLNIIPDTVVSAFVSGDILQVLLVAILFSISLSHMGAK 186

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
              I   L ++   VF +V +VM  AP+GA GAM+FTIG++G+ ++ NL FLV   YAT+
Sbjct: 187 GHAILALLRQLTQLVFGVVRLVMYAAPIGALGAMAFTIGRFGVGAVLNLAFLVLTFYATA 246

Query: 240 AFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIV 299
           A F+L +LG +AR+  F I+ L+ +L+EE+L+VL TSSSESALP LM ++E AGC  S+V
Sbjct: 247 AVFVLVILGAVARWNGFRILPLLAYLREELLIVLGTSSSESALPSLMTRLENAGCAPSVV 306

Query: 300 SMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSA 359
            +VVP GYSFNLDG+NIY+ L+ LFI+QAT+V L L  Q+SLLL+AM+SSKGAAGVTG+ 
Sbjct: 307 GLVVPMGYSFNLDGTNIYMALSALFIAQATDVHLGLGQQVSLLLVAMISSKGAAGVTGAG 366

Query: 360 FITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           F+TLAAT+ +VP +P+AGM LILG+DRFMSECRS+TN IGNAV T+V++RWE  LD    
Sbjct: 367 FVTLAATLAVVPDVPVAGMGLILGIDRFMSECRSLTNIIGNAVATIVLARWEGALDTDRL 426

Query: 420 NKYIGI 425
              +  
Sbjct: 427 AAALSG 432


>gi|91976913|ref|YP_569572.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris BisB5]
 gi|123762758|sp|Q137R8|DCTA_RHOPS RecName: Full=C4-dicarboxylate transport protein
 gi|91683369|gb|ABE39671.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris BisB5]
          Length = 445

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 194/420 (46%), Positives = 287/420 (68%), Gaps = 4/420 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIF 64
           +H     P YK+LY+QVL+AI  G+ LG   P +     ++ LGD FVK  KM+I P+IF
Sbjct: 13  LHRTRSKPWYKVLYVQVLIAIVLGVLLGWVSPHLATNPWIKALGDGFVKLIKMVIAPIIF 72

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            TV +GIA ++D + +G++  KA+  F V S FAL++GLIVGN+   G G+    K    
Sbjct: 73  CTVVSGIAHIQDARKVGRVGVKALLYFEVVSSFALILGLIVGNLVPVGHGLAA--KPDAG 130

Query: 125 ESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIR 184
               ++  +   S + F  ++IP++ + A   G+ILQ L+ A+LFG +L  +GE+   +R
Sbjct: 131 AVAKYVDQASHMSSVDFFLNIIPESVVGAFAKGDILQVLLFAILFGFALMALGERGHRLR 190

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
             +++    VF +++IVM+ AP+GAFGAM+FTIGKYG +++ NLI LV   YAT+A F+ 
Sbjct: 191 DVIDDTAHAVFGVIAIVMKAAPVGAFGAMAFTIGKYGPAALGNLIGLVALFYATAALFVF 250

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLG++A+F  F+I + + ++K+E+L+VL TSSSESALP LM+K+E  GC +S+V +VVP
Sbjct: 251 VVLGLIAKFVGFNIFRFVGYIKDELLIVLGTSSSESALPQLMEKLERLGCSKSVVGLVVP 310

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDG+NIY+TLATLFI+QA  + L+ T+Q+++LL+AM++SKGA+GVTG+ F+TLA
Sbjct: 311 TGYSFNLDGTNIYMTLATLFIAQALGIELTFTEQVTILLVAMLTSKGASGVTGAGFVTLA 370

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
            T+  V    + GM ++  +D+FMSE R++TN  GN V TV VS WE +LD       + 
Sbjct: 371 GTLAAVNPALVPGMAIVFSIDKFMSEVRALTNITGNGVATVFVSWWEGELDHDRLQANLN 430


>gi|42782654|ref|NP_979901.1| C4-dicarboxylate transporter DctA [Bacillus cereus ATCC 10987]
 gi|42738580|gb|AAS42509.1| C4-dicarboxylate transport protein [Bacillus cereus ATCC 10987]
          Length = 420

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 175/412 (42%), Positives = 273/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+I+ N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIIANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWVDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPIGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS  K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSFWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGEGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + I 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDEEKYTRVIE 411


>gi|119961452|ref|YP_949082.1| C4-dicarboxylate transport protein [Arthrobacter aurescens TC1]
 gi|119948311|gb|ABM07222.1| C4-dicarboxylate transport protein [Arthrobacter aurescens TC1]
          Length = 495

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 162/417 (38%), Positives = 267/417 (64%), Gaps = 2/417 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +  LY+ L+ Q+L+A+ +G+ +GHF P IG  ++PLGD F++  KM+I P+IFL + TGI
Sbjct: 18  KKRLYQSLFFQILIAVVAGVLIGHFWPTIGSALRPLGDGFIQLIKMIIAPLIFLVIVTGI 77

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           + + D+K +G++  KA+  F   ++FALV GLIVGNI +PG G+N+D  +L+ +++ A  
Sbjct: 78  SAVGDVKAVGRVGVKALLYFTGATLFALVFGLIVGNIVQPGAGLNIDPATLSQDALNAKT 137

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVG-EKSDTIRKCLEE 189
            ++  K    F+ D+IP + + A  + ++LQ L  ++ FG ++ ++G E+   +   +E 
Sbjct: 138 GNAPPKDAAAFILDVIPVSVIGAFANNSLLQVLFFSVFFGAAIVVIGRERCMPVISLMET 197

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +   +F+++S +M++AP+GAFGAM+F IG+YGL ++S    L+   Y  +  FI  +  +
Sbjct: 198 VLELIFKIMSWIMKVAPIGAFGAMAFIIGQYGLGTLSTYALLIAACYGAAIVFIALLFLV 257

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
              F R  +   + + +EE LL L T+S+E+ +P +M K+  AGC R+   +VVPTGYSF
Sbjct: 258 AWSFARVPLWSFLKYTREEFLLALGTASTEAVMPRIMTKLTNAGCSRATTGLVVPTGYSF 317

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+ IY++++ LF++QA    L L  QL+ L + +++SKG AGV GS+F+ L+AT   
Sbjct: 318 NLDGAAIYLSISLLFLAQAFGHNLDLGQQLAALGVLLLTSKGMAGVPGSSFLALSATAAA 377

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +   P+AG+ L+LG DR M   R V N +GN V T VV++WE + D  +  +    E
Sbjct: 378 LGIFPVAGVALLLGADRLMDSMRVVVNLLGNCVATFVVAKWEGQFDRSVMVRAFNGE 434


>gi|148255583|ref|YP_001240168.1| C4-dicarboxylate transport protein [Bradyrhizobium sp. BTAi1]
 gi|146407756|gb|ABQ36262.1| C4-dicarboxylate transport protein [Bradyrhizobium sp. BTAi1]
          Length = 445

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 197/417 (47%), Positives = 289/417 (69%), Gaps = 4/417 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVST 69
           + P Y ILYIQVL+AI  G+ +G   P +     ++ LGD F+K  KM+I P+IF TV +
Sbjct: 18  KKPWYGILYIQVLIAIVIGVLVGWLFPNLATNDWIKALGDGFIKLIKMVIAPIIFCTVVS 77

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA ++    +G++  KA+  F + S FAL+IGLIVGN+A  G G+    K        +
Sbjct: 78  GIAHIESASKVGRVGIKALIYFEIVSTFALLIGLIVGNLAPIGHGL--AEKQDAAAVAGY 135

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           +K + A+  + F+ ++IPD+ + AL  G+ILQ L+ A+LFG +L  +GE+   +R  +++
Sbjct: 136 VKQAQAQKSVDFVLNIIPDSVVGALARGDILQVLLFAILFGFALMALGERGHRLRDVIDD 195

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
               VF +++IVM+ AP+GAFGAM++TIGKYG S++ +LI L+   Y ++A F++ VLG+
Sbjct: 196 TAHAVFGVIAIVMKAAPVGAFGAMAYTIGKYGPSALGDLIGLIVVFYVSAALFVVIVLGL 255

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +ARF  FSI K I ++K+E+L+VL TSSSESALP LM+K+E  GC + +V +VVPTGYSF
Sbjct: 256 IARFVGFSIFKFISYIKDELLIVLGTSSSESALPQLMEKLERLGCSKPVVGLVVPTGYSF 315

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+TLATLFI+ A  V L+   QL++LL+AM++SKGA+GVTG+ FITLAAT+++
Sbjct: 316 NLDGTNIYMTLATLFIAHALGVELTWGQQLTILLVAMLTSKGASGVTGAGFITLAATLSV 375

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           V    + GM ++  +D+FMSE R++TN  GN +  V VS WE +LD  L  K +  E
Sbjct: 376 VNPALVPGMAIVFSIDKFMSEVRALTNITGNGIAAVFVSWWEGELDHDLLQKRLNRE 432


>gi|242238733|ref|YP_002986914.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech703]
 gi|242130790|gb|ACS85092.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech703]
          Length = 443

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 153/418 (36%), Positives = 247/418 (59%), Gaps = 14/418 (3%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQ--------IGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            L  Q+L+A+  G+A+G F+ +        I   + P GDIF++  KM++ P++  T+  
Sbjct: 11  SLAWQILIALILGIAVGAFLHEYPADKQWLISNILSPAGDIFIRLIKMIVVPIVITTLVV 70

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKS----LNTE 125
           GIA + D K +G+I  K +  F + +  A+V+G+ + NI +PG G+++ + +       E
Sbjct: 71  GIAGVGDAKKLGRIGLKTILYFEIITTLAIVLGVTLANIFQPGHGIDMSMLTRVDISQYE 130

Query: 126 SIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEKSDTIR 184
                  S + S I  +  +IP    +AL  G++L  +  A+LFG+   SL  E+ D + 
Sbjct: 131 KTTEQVQSGSHSLITTIMSLIPPNIFAALAKGDMLPVIFFAVLFGLGLSSLPREQRDPLL 190

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
                 +  +FR+ +++MR AP+G F  +S T+  +G +S+  L  LV  +Y +  FF L
Sbjct: 191 NVFRSASETMFRVTNMIMRYAPVGVFALISVTVANFGFASLWPLAKLVVMVYVSILFFAL 250

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLG +AR CR  I+ LI  LK+E++L  ST+SSE+ LP +++KME  G  ++I S VVP
Sbjct: 251 VVLGTVARICRLRIMTLIRILKDELVLAYSTASSETVLPRIIEKMEAYGAPKAITSFVVP 310

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDGS +Y ++A +FI+Q   + LSL  +L L+L  M++SKG AGV G +F+ L 
Sbjct: 311 TGYSFNLDGSTLYQSIAAIFIAQLYGIDLSLWQELMLVLTLMITSKGIAGVPGVSFVVLL 370

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+++WE + D +    Y
Sbjct: 371 ATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEGQFDTEKARAY 427


>gi|170691232|ref|ZP_02882397.1| sodium:dicarboxylate symporter [Burkholderia graminis C4D1M]
 gi|170143437|gb|EDT11600.1| sodium:dicarboxylate symporter [Burkholderia graminis C4D1M]
          Length = 445

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 201/418 (48%), Positives = 299/418 (71%), Gaps = 2/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             R P+Y+ILY+QVL AI +G+ LGHF PQ  V ++ LGD+F+K  +M+I PVIF TV T
Sbjct: 1   MKRKPIYQILYVQVLAAIAAGVLLGHFAPQTAVALKLLGDLFIKLVRMIIGPVIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA- 128
           GIA M+DMK +G++  KA+  F   S FAL IGL+  ++  PG G NVD  +L+  +++ 
Sbjct: 61  GIAGMQDMKKVGRVGGKALLYFEAASTFALAIGLLAAHVLAPGAGFNVDPSTLDARAVSG 120

Query: 129 -HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              +++H +   GF+  +IP+T L AL  G+IL  L++A+LFG +L+L+G  +  + + +
Sbjct: 121 YAAQAAHGEGITGFIAHVIPETFLGALVQGDILPVLLIAMLFGTALALMGAPAAPVTQLV 180

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E ++   FR+V +V  +AP+GAFGAM+FTIG+YG+ S+  ++ L+   Y T+  F+   L
Sbjct: 181 ETLSKAFFRIVRMVTSLAPIGAFGAMAFTIGRYGIVSLVPMLKLIGAFYLTAFLFVAVGL 240

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+AR C FS+ + + ++++E+L+VL TS+SE+ALP LM K+E  GC R +V +VVPTGY
Sbjct: 241 GIVARLCGFSLWRFLAYIRDELLIVLGTSTSEAALPQLMDKLERLGCPRGVVGLVVPTGY 300

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFN DG+NIY+TLA LF++QATN  LS   +++LLL+ M++SKG+ GVTG+ FITLAA++
Sbjct: 301 SFNFDGTNIYMTLAVLFLAQATNTHLSFAQEITLLLVTMLTSKGSTGVTGAGFITLAASL 360

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           ++VP++P++ M LILG+DRFMSECR++TN +GN V  +VVS WE  LD K     +G 
Sbjct: 361 SVVPTVPVSAMVLILGIDRFMSECRALTNIVGNGVAAIVVSAWEGGLDRKKLETALGG 418


>gi|229092551|ref|ZP_04223707.1| C4-dicarboxylate transport protein [Bacillus cereus Rock3-42]
 gi|228690838|gb|EEL44613.1| C4-dicarboxylate transport protein [Bacillus cereus Rock3-42]
          Length = 420

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGKPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNEKYMKVVE 411


>gi|157691212|ref|YP_001485674.1| C4-dicarboxylate transporter DctA [Bacillus pumilus SAFR-032]
 gi|157679970|gb|ABV61114.1| DAACS family dicarboxylate/amino acid:cation symporter [Bacillus
           pumilus SAFR-032]
          Length = 422

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 178/411 (43%), Positives = 270/411 (65%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L K L  QV+ A+  G+ +G   P +G +M+PLGD F+   KM+I P+IFLT+  GIA
Sbjct: 2   KRLLKNLTFQVVAAVIIGIIVGMVWPNVGKEMKPLGDTFINAVKMVIAPIIFLTIVLGIA 61

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
           +M DMK +G++  KA   F V +  ALVIGL V NI KPG G++         S      
Sbjct: 62  KMGDMKKVGKVGGKAFIYFEVVTTLALVIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNG 121

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F+  ++P   + A   G+ILQ L  ++LFG++L+ +G+K   I + L++++ 
Sbjct: 122 GQGIDWMEFVTHIVPSNMVDAFAKGDILQVLFFSILFGVALAALGDKGKGIIEWLDKLSL 181

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F+++  +MR APLGAFGAM++TIG +GL+SI  L  L+  +Y T   FI  VL I+ +
Sbjct: 182 VFFKIIGYIMRAAPLGAFGAMAYTIGHFGLASIKPLASLMLSVYLTMFLFIFVVLNIICK 241

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS++  + F+K+E+L+VL TSSSES LP +M KME  GC +S+V +V+PTGYSFNLD
Sbjct: 242 MYGFSLLGYLRFIKDEILIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD 301

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G++IY+++A +F++Q   V LS+  Q++++L+ M++SKGAAGVTGS FI LA+T+  +  
Sbjct: 302 GTSIYLSMAVVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLAALQV 361

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           +P+ G+ L+LGVDRFMSE R++TN IGN + T+VV++ E + D       +
Sbjct: 362 IPLEGLALLLGVDRFMSEGRAITNLIGNGIATIVVAKSEGEFDEAKSKTAL 412


>gi|167032585|ref|YP_001667816.1| sodium:dicarboxylate symporter [Pseudomonas putida GB-1]
 gi|166859073|gb|ABY97480.1| sodium:dicarboxylate symporter [Pseudomonas putida GB-1]
          Length = 438

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 186/415 (44%), Positives = 279/415 (67%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L K LY Q+L A+  G+ +GHF  Q  V ++PLGD F+K  KM+I PV+F T+ TGIA
Sbjct: 1   MKLAKSLYFQILCAVLLGVLVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D + +G++  K + LF   ++ +LVIGL    + KPG+GMN+D  +L+TE ++   +
Sbjct: 61  GMTDKRSLGRLMSKTLLLFLGLTVVSLVIGLAAVYLFKPGVGMNIDPATLSTEGLSQYTA 120

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           S AK   + F   +IPDT + A   G +L  L +A+L G +LS +G+K   +   LE  +
Sbjct: 121 SAAKLGVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGDKGKPVLDVLESAS 180

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFR+   +MR AP+GAFGA++FT+G+YG++S+  L  LV  LY   AFF+L VLG + 
Sbjct: 181 TMVFRIFGYLMRFAPVGAFGALAFTVGQYGITSLGALAKLVGTLYIACAFFVLVVLGGIC 240

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KL+ + +EE L+VL TSS+E  LP +++K+E+ GC + +V +V+PTGYSFNL
Sbjct: 241 RAHGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL 300

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+ IY++LA +FI+QA N+ ++L   L++L I ++SSKGAAGVTGS F+ LA+T+T++ 
Sbjct: 301 DGTAIYLSLAAIFIAQACNIDITLGQTLTMLAIMLLSSKGAAGVTGSGFVALASTLTVIH 360

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
            +P+AG+ L++GVDRFMSE R++T+   NAV TVV+S  E   +     + +  E
Sbjct: 361 DIPLAGLALLIGVDRFMSEARALTSLASNAVATVVISLSENACERDTLLRTLNGE 415


>gi|319765639|ref|YP_004131140.1| sodium:dicarboxylate symporter [Geobacillus sp. Y412MC52]
 gi|317110505|gb|ADU92997.1| sodium:dicarboxylate symporter [Geobacillus sp. Y412MC52]
          Length = 480

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 184/399 (46%), Positives = 277/399 (69%), Gaps = 1/399 (0%)

Query: 17  KILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKD 76
           K L +QV++ I  G+ +G   P+ G +++ L D F+K  KM+I P+IF TV  GI  M D
Sbjct: 66  KNLTVQVIIGIILGIIVGFVFPEFGAKLKVLADGFIKLIKMVIAPIIFFTVVIGIGNMGD 125

Query: 77  MKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD-LKSLNTESIAHIKSSHA 135
           +K +G+I  KA+  F + + FAL IG++V N+ KPG+G + D +K  +           +
Sbjct: 126 LKKVGRIGGKALIYFEIVTTFALAIGIVVVNLVKPGVGFHTDAVKGGDISQYTKQAEETS 185

Query: 136 KSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVF 195
             F+ F+  +IPD  ++A+ SG +L  L  A+LFG++ + +GEK+  +    E +    F
Sbjct: 186 HGFVDFILSIIPDNVVAAMASGQLLPVLFFAVLFGLAAAALGEKAKPVISLFERLAEIFF 245

Query: 196 RMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCR 255
            +V++VM+++P+ AFGAM++TIG +GL S+ +L  L+  +Y T A FI  VLG +A+F  
Sbjct: 246 GVVNMVMKVSPIAAFGAMAYTIGTFGLGSLVSLGKLMGSVYITMALFIFVVLGGIAKFYG 305

Query: 256 FSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSN 315
           F+I K + ++KEE+LLVL TSSSESALP LM+++E+ GC +S+V +VVPTGYSFNLDG++
Sbjct: 306 FNIFKFLAYIKEELLLVLGTSSSESALPRLMERLEKYGCSKSVVGLVVPTGYSFNLDGTS 365

Query: 316 IYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI 375
           IY+++A +FI+QA  + L++  +L+LL + M++SKGAAGVTGS FITLAAT+   P +P+
Sbjct: 366 IYLSMAAIFIAQAYGIDLTIWQELTLLGVLMLTSKGAAGVTGSGFITLAATLAAFPMIPV 425

Query: 376 AGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKL 414
            G+ L+LGVDRFMSE R++TN IGNAV TVVVS+ E + 
Sbjct: 426 EGIALLLGVDRFMSEARAITNIIGNAVATVVVSKMENEF 464


>gi|86750127|ref|YP_486623.1| Sodium:dicarboxylate symporter [Rhodopseudomonas palustris HaA2]
 gi|123407944|sp|Q2IVP8|DCTA_RHOP2 RecName: Full=C4-dicarboxylate transport protein
 gi|86573155|gb|ABD07712.1| Sodium:dicarboxylate symporter [Rhodopseudomonas palustris HaA2]
          Length = 445

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 192/414 (46%), Positives = 285/414 (68%), Gaps = 4/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            P YK+LYIQVL+AI  G+ +G   P +     ++ LGD FVK  KM+I P+IF TV +G
Sbjct: 19  KPWYKVLYIQVLIAIVLGVLVGWLSPHLATNPWIKALGDGFVKLIKMVIAPIIFCTVVSG 78

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA ++D + +G++  KA+  F V S FAL++GL+VGN+   G G+    K        ++
Sbjct: 79  IAHIQDARKVGRVGIKALVYFEVVSSFALILGLVVGNLLPVGHGLAA--KPDAGAVAKYV 136

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +     + F  ++IP++ + A   G+ILQ L+ A+LFG +L  +GE+   +R  +++ 
Sbjct: 137 DQASHMHAVDFFLNIIPESVVGAFAKGDILQVLLFAILFGFALMALGERGHRLRDVIDDT 196

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              VF +++IVM+ AP+GAFGAM+FTIGKYG +++ NLI LV   YAT+A F+  VLG++
Sbjct: 197 AHAVFGVIAIVMKAAPVGAFGAMAFTIGKYGPAALGNLIGLVALFYATAALFVFVVLGVI 256

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           A+F  F+I K + ++K+E+L+VL TSSSESALP LM+K+E  GC +S+V +VVPTGYSFN
Sbjct: 257 AKFVGFNIFKFLGYIKDELLIVLGTSSSESALPQLMEKLERLGCSKSVVGLVVPTGYSFN 316

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLATLFI+QA  + LS ++Q+++LL+AM++SKGA+GVTG+ F+TLA T+  V
Sbjct: 317 LDGTNIYMTLATLFIAQALGIELSFSEQVTILLVAMLTSKGASGVTGAGFVTLAGTLAAV 376

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
               + GM ++  +D+FMSE R++TN  GN V TV VS WE +LD    +  + 
Sbjct: 377 NPALVPGMAIVFSIDKFMSEVRALTNITGNGVATVFVSWWEGELDHDRLHANLD 430


>gi|229146155|ref|ZP_04274530.1| C4-dicarboxylate transport protein [Bacillus cereus BDRD-ST24]
 gi|228637214|gb|EEK93669.1| C4-dicarboxylate transport protein [Bacillus cereus BDRD-ST24]
          Length = 420

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 176/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMTFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K + ++KEE+L+VL TSSSES LP +M KME  GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLAYIKEELLIVLGTSSSESVLPRMMTKMEGFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D + + + + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDDEKYTRVVE 411


>gi|251791634|ref|YP_003006355.1| C4-dicarboxylate transporter DctA [Dickeya zeae Ech1591]
 gi|247540255|gb|ACT08876.1| sodium:dicarboxylate symporter [Dickeya zeae Ech1591]
          Length = 428

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 210/416 (50%), Positives = 298/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVLVAI  G+ LGHF P +G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKSIFKSLYFQVLVAITIGILLGHFYPALGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V NI +PG GMNV+  +LN  +I A+
Sbjct: 61  IAGMESMKSVGRTGAVALLYFEIVSTLALIIGLVVVNILQPGAGMNVNPAALNASAISAY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  I F+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   +E 
Sbjct: 121 TSEAGKQGVIPFLMDVIPSSVIGAFASGNILQVLLFAVMFGFALHRLGPKGVVIFDVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI K I +++EE+L+VL TSSSES LP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  +  
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKELDSKQMDDVLSG 416


>gi|157374001|ref|YP_001472601.1| sodium:dicarboxylate symporter [Shewanella sediminis HAW-EB3]
 gi|157316375|gb|ABV35473.1| sodium:dicarboxylate symporter [Shewanella sediminis HAW-EB3]
          Length = 449

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 119/408 (29%), Positives = 227/408 (55%), Gaps = 9/408 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+L+ +  G+A G  + +  V ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQILIGMLLGIATGLGLGEQAVVLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMQDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG+  +PG G+ +          +   +    S 
Sbjct: 81  KMGRIGFKSFVFYLGTTSIAITLGLAVGHFMQPGSGLGMQ------ADASLTVAKEVPSV 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + +++P   ++AL SG ILQ ++ A+  GISL L+G+      K  E +   ++++ 
Sbjct: 135 METLINIVPTNPIAALASGQILQVIVFAVALGISLVLIGDHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA-RFCRFS 257
            ++M++AP G FG M++  G+YG+  +  LI ++  +Y      ++G   ++   F + +
Sbjct: 195 DMIMKLAPYGVFGLMAWVAGEYGIEMLLPLIKVIIAVYIGCFIHVVGFYSVVLSVFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   + +  +TSSS  +LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PVQFFKGISNALAVAYTTSSSAGSLPASMKCASESLGINKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D ++++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLTWVDYITIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +L+   +N  + 
Sbjct: 374 GVALIAGIDRVLDMARTVVNVSGDLVATTVIAKSEGELNVAHYNADME 421


>gi|307729457|ref|YP_003906681.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1003]
 gi|307583992|gb|ADN57390.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1003]
          Length = 445

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 202/417 (48%), Positives = 296/417 (70%), Gaps = 2/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             R P Y ILY+QVL AI +G+ LGHF P   V ++PLGD+F+K  +M+I PVIF TV T
Sbjct: 1   MKRKPFYTILYVQVLAAIVAGVLLGHFAPHAAVALKPLGDLFIKLVRMIIGPVIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F   S  AL IGL+  ++  PG G NVD  +L+  +++ 
Sbjct: 61  GIASMQDMKKVGRVGGKALLYFEAASTLALAIGLLAAHVLAPGKGFNVDPSTLDARAVSG 120

Query: 130 --IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              +++H     GF+  +IP+T + AL  G+IL  L++A+LFG +L+L+GE    +   +
Sbjct: 121 YVAQAAHGDGITGFIAHVIPETFVGALVQGDILPVLLIAMLFGTALALMGEPGAPVAHLI 180

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E ++   FR+V +V  +AP+GAFGAM+FTIG+YG+ S+  ++ L+   Y T+  F+  VL
Sbjct: 181 ETLSKAFFRIVRMVTSLAPIGAFGAMAFTIGRYGIVSLLPMLKLIGAFYFTAFLFVAVVL 240

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+AR C FSI + + ++++E+L+VL TS+SE+ALP LM K+E  GC R +V +VVPTGY
Sbjct: 241 GIVARLCGFSIWRFLGYIRDELLIVLGTSTSEAALPQLMDKLERLGCPRGVVGLVVPTGY 300

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+N+Y+TLA LF++QATN  LS   +++LLL+ M++SKG+ GVTG+ FITLAA++
Sbjct: 301 SFNLDGTNVYMTLAVLFLAQATNTHLSFAQEITLLLVTMLTSKGSTGVTGAGFITLAASL 360

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           ++VP++P++ M LILGVDRFMSECR++TN +GN V T+V+S WE  LD       +G
Sbjct: 361 SVVPTVPVSAMVLILGVDRFMSECRALTNIVGNGVATIVISAWEGGLDRTKLAMALG 417


>gi|302549781|ref|ZP_07302123.1| sodium/dicarboxylate symporter family protein [Streptomyces
           viridochromogenes DSM 40736]
 gi|302467399|gb|EFL30492.1| sodium/dicarboxylate symporter family protein [Streptomyces
           viridochromogenes DSM 40736]
          Length = 468

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 160/414 (38%), Positives = 241/414 (58%), Gaps = 2/414 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
           L   L+ QVL A+  G+ +G   P      QPLGD F +  K +I+P++F  V  GIA+ 
Sbjct: 9   LRTSLFAQVLCALVLGIVVGKLWPDTATAFQPLGDGFTRLIKTVISPLVFCVVVVGIAKA 68

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSH 134
            D+K  G+I  KA+  F V S  ALVIGL+  N+  PG GMNVD  SL+  ++       
Sbjct: 69  GDLKAFGRIGVKALIWFEVASTAALVIGLVAANVVGPGRGMNVDPSSLDAAAVDETTGGG 128

Query: 135 -AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT-IRKCLEEINF 192
              S   F+ + +P + + A     +LQ LI+A L G +L  +G      I   +++   
Sbjct: 129 RLPSTTDFLLNALPQSFVGAFAENELLQVLILACLVGAALLHLGHTRVPKILPAIDQAQD 188

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +F +V  +MR+APL  FGAM+  +G YGL  +     L+   Y  +A FI  +   L  
Sbjct: 189 VIFTVVGFIMRLAPLAVFGAMAHLVGNYGLGVMKTYAKLIVLCYVAAALFIALLSIALRL 248

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
               S+ K + +++EE+LL L T+S+E+ +P +M+K+  AG     V +V+PTGYSFNLD
Sbjct: 249 VTGLSLWKFLRYIREEMLLALGTASTEAVMPRVMQKLRRAGARDDAVGLVLPTGYSFNLD 308

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+++Y+++ TLFI+QA  V LSL  Q++++L+ M++SKG AG+ GSAF+ L+AT + + +
Sbjct: 309 GASLYLSIGTLFIAQAVGVDLSLGQQVTVVLVLMLTSKGMAGIPGSAFLALSATASSLGA 368

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P   + L+LGVDR M   R VTN +GN V    VSRWE  LD +   K +  E
Sbjct: 369 IPAGAVALLLGVDRIMDSMRVVTNLLGNCVAVFAVSRWEGALDIERAKKALDGE 422


>gi|316934394|ref|YP_004109376.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris DX-1]
 gi|315602108|gb|ADU44643.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris DX-1]
          Length = 445

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 192/414 (46%), Positives = 282/414 (68%), Gaps = 4/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            P YK+LY+QVL AI  G+ +G   P       ++ LGD FVK  KM+I P+IF TV +G
Sbjct: 19  KPFYKVLYVQVLFAIVVGVLVGWLSPHFATNEWIKALGDGFVKLIKMVIAPIIFCTVVSG 78

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA ++D + +G++  KA+  F + S FAL++GL+VGN+   G G+    +        ++
Sbjct: 79  IAHIQDARKVGRVGIKALLYFEIVSSFALILGLVVGNLFPVGHGLAA--RPDAGAVAKYV 136

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +   S + F+  +IPD+ + A   G+ILQ L+ A+LFG +L  +GE+   +R  +++ 
Sbjct: 137 DQASHMSSVDFVLHIIPDSVVGAFARGDILQVLLFAVLFGFALMALGERGHRLRDVIDDA 196

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              VF +++IVM+ AP+GAFGAM++TIGKYG +++ NLI LV   YAT+A F++ VLG +
Sbjct: 197 AHAVFGVIAIVMKAAPIGAFGAMAYTIGKYGPAALGNLIGLVALFYATAALFVVLVLGTI 256

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           ARF  F+I K I ++K+E+L+VL TSSSESALP LM+K+E  GC +S+V +VVPTGYSFN
Sbjct: 257 ARFVGFNIFKFIGYIKDELLIVLGTSSSESALPQLMEKLERLGCSKSVVGLVVPTGYSFN 316

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLATLFI+QA  + LS +DQ+++LL+AM++SKGA+GVTG+ F+TLA T+  V
Sbjct: 317 LDGTNIYMTLATLFIAQALGIELSFSDQVAILLVAMLTSKGASGVTGAGFVTLAGTLAAV 376

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
               + GM ++  +D+FMSE R++TN  GN V  V VS WE +LD       + 
Sbjct: 377 NPALVPGMAIVFSIDKFMSEVRALTNITGNGVAAVFVSWWEGELDKDRLRASLD 430


>gi|103486941|ref|YP_616502.1| sodium:dicarboxylate symporter [Sphingopyxis alaskensis RB2256]
 gi|123078357|sp|Q1GT53|DCTA_SPHAL RecName: Full=C4-dicarboxylate transport protein
 gi|98977018|gb|ABF53169.1| sodium:dicarboxylate symporter [Sphingopyxis alaskensis RB2256]
          Length = 446

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 226/414 (54%), Positives = 312/414 (75%), Gaps = 2/414 (0%)

Query: 15  LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
            +  LY+QVL AI +G+ LGHF P IG +++PLGD F+K  KM+I PVIFLTV+TGIA +
Sbjct: 19  WWSHLYVQVLAAIVAGVLLGHFWPAIGTELKPLGDGFIKLVKMIIAPVIFLTVATGIASI 78

Query: 75  K-DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS- 132
             + K +G++  KA   F  FS  AL++GL+V N+ +PG GMN+D  +L+  ++A  ++ 
Sbjct: 79  GGETKALGRVVGKAFAYFLFFSTLALIVGLVVANVVQPGAGMNIDPATLDAGAVAQYQAK 138

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +H  +   F+ D+IP T +SALT G+ILQ L VA+LFG++LS  GE    +   LE+++ 
Sbjct: 139 AHEATLTAFLLDIIPVTFVSALTEGSILQALFVAILFGLALSHAGEPGRQVLGLLEKVST 198

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F +V ++M+ AP+GAFGAM+FTIGKYG+ S++NL  L+   Y TS FF++ +LG +A 
Sbjct: 199 VFFGLVGMLMKFAPIGAFGAMAFTIGKYGVESLANLGLLIATFYLTSLFFVIVILGAVAH 258

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSI +LI +LK E+LLVL TSSSE+ALP L++K+E+AGC + IV +VVPTGYSFNLD
Sbjct: 259 FSGFSIFRLIAYLKAELLLVLGTSSSEAALPSLIEKLEKAGCAKPIVGLVVPTGYSFNLD 318

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QA  V LSL DQ++LLL+AMVSSKGAAGVTG+ FITLAAT+++VPS
Sbjct: 319 GTNIYMTLAALFIAQAVGVDLSLGDQIALLLVAMVSSKGAAGVTGAGFITLAATLSIVPS 378

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           +P+AG+ LILG+DRFMSECR++TNFIGNA+  +VV+ WEK LD +   + +  E
Sbjct: 379 VPVAGLALILGIDRFMSECRALTNFIGNALAAIVVAGWEKGLDREALARALAGE 432


>gi|300691180|ref|YP_003752175.1| C4-dicarboxylate transport protein [Ralstonia solanacearum PSI07]
 gi|299078240|emb|CBJ50887.1| C4-dicarboxylate transport protein [Ralstonia solanacearum PSI07]
          Length = 443

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 172/410 (41%), Positives = 281/410 (68%), Gaps = 1/410 (0%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDM 77
            LY+QVL+ I +G+ LGHF P IG Q++PLGD+F+K  +ML+ P+IF +V  GIARM D+
Sbjct: 12  KLYVQVLIGIIAGILLGHFAPDIGTQLKPLGDLFIKLIRMLLAPIIFASVVVGIARMHDI 71

Query: 78  KVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHIKSSHAK 136
              G++  KA+  F + S  AL IGL+V N+ KPG GMN+D   L++ +I A+  ++   
Sbjct: 72  HEAGRVGVKAVIYFEIASTLALGIGLVVVNVFKPGHGMNIDPTHLDSGAIKAYTTAAQHH 131

Query: 137 SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFR 196
           + + F   ++P+T + A  +G +L  +  ++L  I+L+ +G ++      L+     +F 
Sbjct: 132 NVMDFFMSIVPNTIVGAFANGEMLPIIFFSILLAIALARLGPRTAPFVDMLDMFLHAMFG 191

Query: 197 MVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRF 256
           +V IVM +AP+GAFG M+FTI KYG+ ++++   L+ CLY TS  F++ VLG++ R C  
Sbjct: 192 VVRIVMHVAPIGAFGGMAFTIAKYGIGTLASYGELMLCLYLTSIAFVVIVLGVVMRMCGL 251

Query: 257 SIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNI 316
           S+ K + ++K+E+ + L T+S+E+ LP ++ K+E+ GC R +V MV+PTGY+FN DG+ I
Sbjct: 252 SLWKFLRYIKDEIFVTLGTASTEAVLPQMLVKLEKLGCSRPVVGMVLPTGYTFNADGTAI 311

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y+T+AT+F++QA N+ LS+ DQL +L + +++SKG+AGV G+ F+ LAAT+  +  +P++
Sbjct: 312 YLTMATIFVAQAMNIDLSIWDQLIVLGVLLLTSKGSAGVAGAGFVALAATLASMNKIPVS 371

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           G+ L+LG+DRF++E R+VTN IGN + T+ V+RWE+ +D +     +  E
Sbjct: 372 GLVLLLGIDRFLNEARAVTNLIGNGIATIAVARWERAIDMRTARAVLNGE 421


>gi|127511677|ref|YP_001092874.1| sodium:dicarboxylate symporter [Shewanella loihica PV-4]
 gi|126636972|gb|ABO22615.1| sodium:dicarboxylate symporter [Shewanella loihica PV-4]
          Length = 433

 Score =  276 bits (707), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 123/408 (30%), Positives = 228/408 (55%), Gaps = 9/408 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+L+ +  G+  G  + +  V ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 22  LWLQILIGMLLGICAGLGLGEQAVLLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMQDTA 81

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG+I +PG G+        T + +H       S 
Sbjct: 82  KMGRIGFKSFAFYLGTTSIAITLGLAVGHIMQPGAGL------AMTSAESHNAVKEVPSI 135

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + +++P   ++AL SG ILQ ++ A+  GI+L L+G+      K  E +   ++++ 
Sbjct: 136 METLINIVPTNPIAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLT 195

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF-CRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y   A  I+G   ++  F  + +
Sbjct: 196 DMVMKLAPYGVFGLMAWVAGEYGMDMLMPLIKVILAVYIGCALHIIGFYSLVLTFVAKLN 255

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKM-EEAGCHRSIVSMVVPTGYSFNLDGSNI 316
            ++    +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 256 PMQFFKGISNALAVAYTTSSSAGTLPASMKCASESLGINKKISSFVLPLGTTINMDGTAL 315

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + L+  D ++++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 316 YQGVTALFVAQAFGIDLTWVDYITIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 374

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ +I G+DR +   R+V N  G+ V T V+++ E +LD + +N    
Sbjct: 375 GVAIIAGIDRILDMARTVVNVSGDLVATTVIAKSEDELDLEHYNADAE 422


>gi|315122200|ref|YP_004062689.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495602|gb|ADR52201.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 426

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 344/415 (82%), Positives = 381/415 (91%), Gaps = 1/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           PPLYK LYIQVLVAI  G+ALGHF PQIGVQMQPLG+IF+K TKMLITP+IFLTVSTG+A
Sbjct: 12  PPLYKRLYIQVLVAISIGIALGHFFPQIGVQMQPLGEIFIKITKMLITPIIFLTVSTGMA 71

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIK 131
           RM DMKVIG+IFWK+M LF +FS+ ALVIGL+VGNIA PG+GMNVDLKSLN   I+  I 
Sbjct: 72  RMTDMKVIGRIFWKSMVLFTIFSLLALVIGLVVGNIAGPGVGMNVDLKSLNQTGISMPIG 131

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           SSH+KSF+ F++DMIP TALSALTSGNILQTL+VALLFGISLSLVG+KS TI KCLEEIN
Sbjct: 132 SSHSKSFVHFLEDMIPHTALSALTSGNILQTLVVALLFGISLSLVGKKSSTITKCLEEIN 191

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
           FPVF+MVSIVMR AP+GAFGAMSFTIGKYGLSS+ NLIFLV CLY TSAFFIL +LG LA
Sbjct: 192 FPVFKMVSIVMRAAPVGAFGAMSFTIGKYGLSSVYNLIFLVACLYMTSAFFILVILGSLA 251

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           RF +FS+IKLI+FLKEE+LLVLSTSSSESALPGLMKKMEEAGC RSIVSMVVPTGYSFNL
Sbjct: 252 RFFKFSVIKLILFLKEEILLVLSTSSSESALPGLMKKMEEAGCDRSIVSMVVPTGYSFNL 311

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DGSNIY+TLATLFI+QATN+P+SL +Q+SL+LIAMVSSKGAAGVTGSAFITLAATI+L P
Sbjct: 312 DGSNIYMTLATLFIAQATNIPMSLEEQISLVLIAMVSSKGAAGVTGSAFITLAATISLFP 371

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           SLPIAGMTLILGVDRFMSECRSVTNFIGNA+MTVVVS+WE KLD K F K+IGIE
Sbjct: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAIMTVVVSKWENKLDQKEFKKHIGIE 426


>gi|189349372|ref|YP_001945000.1| C4-dicarboxylate transporter DctA [Burkholderia multivorans ATCC
           17616]
 gi|221202469|ref|ZP_03575500.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2M]
 gi|221208074|ref|ZP_03581079.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2]
 gi|221213188|ref|ZP_03586163.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD1]
 gi|189333394|dbj|BAG42464.1| DAACS family dicarboxylate/amino acid:cation (Na+ or H+) symporter
           [Burkholderia multivorans ATCC 17616]
 gi|221166640|gb|EED99111.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD1]
 gi|221171977|gb|EEE04419.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2]
 gi|221177642|gb|EEE10058.1| C4-dicarboxylate transport protein [Burkholderia multivorans CGD2M]
          Length = 439

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 182/415 (43%), Positives = 279/415 (67%), Gaps = 2/415 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
                L+ +V++A+  G+ALG F P     ++PLGD F+K  KM+I P++F  V +G+A 
Sbjct: 3   KFLNSLFGRVVIALILGVALGAFFPHFAESLKPLGDGFLKLIKMVIGPIVFCVVVSGMAN 62

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-- 131
             D+K +G++  KA+  F V +  AL IGL++  + +PG GMN++L SL+  S+A     
Sbjct: 63  AGDLKKVGRVGLKAVVYFEVMTTLALGIGLVLAWLTRPGEGMNINLHSLDASSLASYAKN 122

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +   K   GF+  +IPDTA+ A   G+ILQ L+ A+LFG +LSL+G+K+  +   +EE++
Sbjct: 123 AESLKDTAGFLMKIIPDTAIDAFAKGDILQILVFAVLFGSALSLLGDKAKRVNGLIEELS 182

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
              FR++  ++++APLG  GA++FT GKYG++S+  L +LV   Y + A F+  VLGI+ 
Sbjct: 183 HVFFRVIGFIIKLAPLGVLGAIAFTTGKYGVASLKQLGYLVAVFYVSCAVFVTVVLGIVM 242

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KLI +L+EE+ +VL T+SS++ LP +M+K+E  G   S V +V+PTGYSFNL
Sbjct: 243 RLAGFSVFKLIRYLREELSIVLGTASSDAVLPQVMRKLEYMGVKDSTVGLVIPTGYSFNL 302

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG +IY+TLA LFI+QATN PLS  D + +L+++M++SKGA G+ GSA + LAAT++ +P
Sbjct: 303 DGFSIYLTLAVLFIAQATNTPLSAHDLIVVLIVSMITSKGAHGIPGSAIVILAATLSAIP 362

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+ G+ LIL VD F+   R++TN IGN V TVVV+ WE  +D     + +  E
Sbjct: 363 AIPVLGLVLILPVDWFVGIARALTNLIGNCVATVVVAVWENDIDRARAKRVLNRE 417


>gi|56415516|ref|YP_152591.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364442|ref|YP_002144079.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|81599655|sp|Q5PJR1|DCTA_SALPA RecName: Full=C4-dicarboxylate transport protein
 gi|226723851|sp|B5BHQ7|DCTA_SALPK RecName: Full=C4-dicarboxylate transport protein
 gi|56129773|gb|AAV79279.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197095919|emb|CAR61498.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 435

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A  
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAQAVAVY 120

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            +    +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AAQAKEQGIIAFLMDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVTGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKG AGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGVAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD +  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHQKLDDVLN 415


>gi|320105110|ref|YP_004180701.1| sodium:dicarboxylate symporter [Isosphaera pallida ATCC 43644]
 gi|319752392|gb|ADV64152.1| sodium:dicarboxylate symporter [Isosphaera pallida ATCC 43644]
          Length = 456

 Score =  276 bits (706), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 188/419 (44%), Positives = 274/419 (65%), Gaps = 8/419 (1%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
             ++ +  +V+ AI +G+ +G   P +G  + PLG  FV   KMLI PVIF T+  GIA 
Sbjct: 11  RWWRSMSARVVAAIVTGILIGVVSPDLGASLGPLGVGFVNLIKMLIGPVIFCTIVHGIAS 70

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTE-------S 126
           + D++  G++  KA+  F V +  ALVIGL+V N+  PG G+NVD  SL T+        
Sbjct: 71  VGDLRQAGRVGVKALVYFEVVTTLALVIGLVVVNLIWPGAGLNVDPASLTTKGLPIAAVE 130

Query: 127 IAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKC 186
            A       + F+ F+  +IP + ++A   G +LQ ++V+LLFG +L+ +GE    + + 
Sbjct: 131 AAGDHPEGVEGFVDFVMRIIPRSFVAAFVDGELLQVVLVSLLFGAALAGLGEAGRPVLEG 190

Query: 187 LEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV 246
           +E +N   F +V+++M+IAPLGA GAM+FT+G+YGL S+  L +L+   Y T   F+  V
Sbjct: 191 VEHLNRVFFGIVNLIMKIAPLGALGAMAFTVGRYGLGSLVALAWLMGSFYLTCLLFVFLV 250

Query: 247 L-GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           L  IL   CR  I +L+  L EE+ +VL TSSSE+ LP LM+K+   GC R +V + +PT
Sbjct: 251 LGPILWWTCRVRIDRLLRHLSEELWIVLGTSSSETVLPRLMEKLTRLGCARPVVGLTLPT 310

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GYSFNLDG++IY+T+A +F++QA NVPLSL DQL LL + +++SKGAAGVTGS FI LAA
Sbjct: 311 GYSFNLDGTSIYLTMAAVFVAQAVNVPLSLGDQLGLLAVLLITSKGAAGVTGSGFIVLAA 370

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           T+    ++P+A +TLILG+DRFMSE R++TN +GN V T+VV+RWE  LD     + + 
Sbjct: 371 TLQSTSAVPVAALTLILGIDRFMSEARALTNVVGNTVATLVVARWENALDLDTLQRTLN 429


>gi|39935514|ref|NP_947790.1| C4-dicarboxylic acid transport protein [Rhodopseudomonas palustris
           CGA009]
 gi|192291105|ref|YP_001991710.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris TIE-1]
 gi|81562743|sp|Q6N715|DCTA_RHOPA RecName: Full=C4-dicarboxylate transport protein
 gi|39649366|emb|CAE27889.1| C4-dicarboxylic acid transport protein [Rhodopseudomonas palustris
           CGA009]
 gi|192284854|gb|ACF01235.1| sodium:dicarboxylate symporter [Rhodopseudomonas palustris TIE-1]
          Length = 445

 Score =  276 bits (706), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 197/414 (47%), Positives = 281/414 (67%), Gaps = 4/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            P YK+LY+QVL AI  G+ +G   P       ++ LGD FVK  KM+I P+IF TV +G
Sbjct: 19  KPFYKVLYVQVLFAIVVGVLVGWLSPHFATNEWIKALGDGFVKLIKMVIAPIIFCTVVSG 78

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA ++D + +G++  KA+  F V S FALV+GLIVGN+   G G+    K        ++
Sbjct: 79  IAHIQDARKVGRVGIKALLYFEVVSSFALVLGLIVGNLFPVGHGLAA--KPDAGAVAKYV 136

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             +   S + F+  +IPD+ + A   G+ILQ L+ A+LFG +L  +GE+   +R  +++ 
Sbjct: 137 DQASHMSAVDFVLHIIPDSVVGAFAKGDILQVLLFAVLFGFALMALGERGHRLRDVIDDA 196

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              VF +++IVM+ AP+GAFGAM+FTIGKYG +++ NLI LV   YATSA F++ VLG +
Sbjct: 197 AHAVFGVIAIVMKAAPIGAFGAMAFTIGKYGPAALGNLIGLVALFYATSALFVVLVLGTI 256

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           A+F  F+I K I ++K+E+L+VL TSSSESALP LM+K+E  GC +S+V +VVPTGYSFN
Sbjct: 257 AKFVGFNIFKFIGYIKDELLIVLGTSSSESALPQLMEKLERLGCSKSVVGLVVPTGYSFN 316

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLATLFI+QA  + LS  DQ+++LL+AM++SKGA+GVTG+ F+TLA T+  V
Sbjct: 317 LDGTNIYMTLATLFIAQALGIELSFGDQVAILLVAMLTSKGASGVTGAGFVTLAGTLAAV 376

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
               + GM ++  +D+FMSE R++TN  GN V  V VS WE +LD       + 
Sbjct: 377 NPALVPGMAIVFSIDKFMSEVRALTNITGNGVAAVFVSWWEGELDHDRLRANLS 430


>gi|283480330|emb|CAY76246.1| C4-dicarboxylate transport protein [Erwinia pyrifoliae DSM 12163]
          Length = 430

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 7   MKTSLFKSLYFQVLTAIAIGVLLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 66

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GMNVD  +L+ +++A +
Sbjct: 67  IAGMESMKAVGRTGAVALLYFEVVSTLALIIGLVVVNVLQPGAGMNVDPATLDAKAVAMY 126

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A   GNILQ L+ A+LFG +L  +G+K   +   ++ 
Sbjct: 127 AQQAEQQGVVAFLLDVIPASVIGAFAGGNILQVLLFAILFGFALHRMGDKGTLVFNFIDS 186

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F ++S+VMR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG+
Sbjct: 187 FSHVIFGIISMVMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCVLFVVLVLGV 246

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 247 IARVVGFNIFKFIAYIKEELLIVLGTSSSESALPRMLAKMENLGCQKSVVGLVIPTGYSF 306

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 307 NLDGTSIYLTMAAVFIAQATNSHMDIWHQVTLLVVLLLSSKGAAGVTGSGFIVLAATLSA 366

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV++W  +LD K   + + 
Sbjct: 367 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWVGQLDEKQLTETLN 421


>gi|322434151|ref|YP_004216363.1| sodium:dicarboxylate symporter [Acidobacterium sp. MP5ACTX9]
 gi|321161878|gb|ADW67583.1| sodium:dicarboxylate symporter [Acidobacterium sp. MP5ACTX9]
          Length = 438

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 190/415 (45%), Positives = 288/415 (69%), Gaps = 2/415 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
            P YK LY++VLV I +G+  G   P  G+ M+P GD F+K  +M+I P+IFL+V  GIA
Sbjct: 12  KPFYKTLYLRVLVGIIAGVIAGALFPNFGIAMKPFGDGFIKLIRMMIAPIIFLSVVVGIA 71

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            + D++ +G++  KA+  F V +  AL IGL V  + +PG GMN+D K+L+T+SIA   S
Sbjct: 72  GIGDIRKLGRVGVKALLYFEVVTTLALAIGLGVATLFQPGRGMNIDAKTLDTKSIAQYTS 131

Query: 133 SH-AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           ++ A   + F+ ++IPDT  SA T G ILQ L++A+L      +  +K  T+    + + 
Sbjct: 132 ANAAPHGVDFVLNIIPDTFTSAFTKGEILQVLLLAILA-GLALVALDKDKTLTNLADRLA 190

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
              F++++ +M  AP+GAFGAM+FTIGKYGL ++ +L  L+ C+Y TS  F++ VLG++ 
Sbjct: 191 HVSFKIIAYIMEFAPIGAFGAMAFTIGKYGLHTLVSLGKLLACVYLTSILFVVIVLGLIC 250

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
                +I KLI +L+EE+L+VL TSSSE+ALP ++ KME  GC +S+V +V+P+GYSFNL
Sbjct: 251 VSASINIFKLIRYLREELLIVLGTSSSETALPRMIVKMERLGCSKSVVGLVIPSGYSFNL 310

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG++IY+T+A LFI+QATN  L+   Q+ +L + M++SKGAA VTG  FITLAAT++ + 
Sbjct: 311 DGTSIYLTIAALFIAQATNTHLTFGQQIFILFVLMLNSKGAAAVTGGGFITLAATLSALG 370

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+AG+TL+LG+DRFMS+ RS+ N IGN V T++V++WE + +    N+ +  E
Sbjct: 371 TIPVAGITLLLGIDRFMSQMRSLVNLIGNGVATIIVAKWEGEFNTDQCNRALAGE 425


>gi|227114847|ref|ZP_03828503.1| glutamate/aspartate:proton symporter [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 438

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 147/418 (35%), Positives = 247/418 (59%), Gaps = 14/418 (3%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQ--------IGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            L  Q+L+A+  G+ALG  + +        I   + P GDIF++  KM++ P++  T+  
Sbjct: 7   SLAWQILIALVLGIALGAVLHEQQESRQWLISNILSPAGDIFIRLIKMIVVPIVIATLIV 66

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL----NTE 125
           GIA + D K +G+I +K +  F + +  A+++G+ + N+ +PG G+++   +       +
Sbjct: 67  GIAGVGDAKKLGRIGFKTILYFEIITTVAIILGITLANVFQPGHGIDMSTLTAVDISQYQ 126

Query: 126 SIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEKSDTIR 184
                  S + S +G +  +IP    +A+T G++L  +  ++LFG+   SL  +  + + 
Sbjct: 127 KTTEQVQSGSHSLVGTVLSLIPPNIFAAMTHGDMLPIIFFSVLFGLGLSSLPKDHREPLL 186

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
                ++  +F++  ++MR AP+G F  +S T+  +G +S+  L  LV  +YA   FF L
Sbjct: 187 NVFRGVSETMFKVTHMIMRYAPVGVFALISVTVANFGFASLWPLAKLVMLVYAAIFFFAL 246

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLGI+AR C+  I  LI  LK+E++L  ST+SSE+ LP +++KME  G  +SI S VVP
Sbjct: 247 VVLGIVARLCKLRITILIRILKDELILAYSTASSETVLPRIIEKMEAYGAPKSITSFVVP 306

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDGS +Y ++A +FI+Q   + LS+  ++ L+L  M++SKG AGV G +F+ L 
Sbjct: 307 TGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQEIVLVLTLMLTSKGIAGVPGVSFVVLL 366

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+++WE + D K    Y
Sbjct: 367 ATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWENQFDEKKARAY 423


>gi|237728844|ref|ZP_04559325.1| C4-dicarboxylate transporter [Citrobacter sp. 30_2]
 gi|226909466|gb|EEH95384.1| C4-dicarboxylate transporter [Citrobacter sp. 30_2]
          Length = 428

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAIY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  +GF+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGIVGFLMDIIPASVIGAFASGNILQVLLFAVMFGFALHRLGSKGQMIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWVKELDTKKLDDTLN 415


>gi|167586107|ref|ZP_02378495.1| sodium:dicarboxylate symporter [Burkholderia ubonensis Bu]
          Length = 442

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 185/415 (44%), Positives = 279/415 (67%), Gaps = 2/415 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
                L+ +V+VA+  G+ALG F P     ++PLGD F+K  KM+I P++F  V +G+A 
Sbjct: 3   KFLNSLFGRVVVALILGVALGAFFPHFAESLRPLGDGFLKLIKMVIGPIVFCVVVSGMAN 62

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-- 131
             D+K +G++  KA+  F V +  AL IGL++  + +PG+GMN+DL SL+  S+A     
Sbjct: 63  AGDLKKVGRVGLKAVVYFEVMTTLALGIGLVLAWLTRPGVGMNIDLHSLDAASLASYAKN 122

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +   K   G++  +IPDTAL A   G+ILQ L+ A+LFG +LSL+G+K   +   +EE++
Sbjct: 123 AESLKDTAGYLMKIIPDTALDAFAKGDILQILVFAVLFGSALSLLGDKGKRVNSLIEELS 182

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
              FR++  ++++APLG  GA++FT GKYG++S+  L +LV   Y +   F+  VLGI+ 
Sbjct: 183 HVFFRVIGFIIKLAPLGVLGAIAFTTGKYGVASLKQLGYLVAVFYLSCIVFVTVVLGIVM 242

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           RF  FS+ KLI +L+EE+ +VL T+SS++ LP +M+K+E  G   S V +V+PTGYSFNL
Sbjct: 243 RFAGFSVFKLIRYLREELSIVLGTASSDAVLPQVMRKLEYLGIKDSTVGLVIPTGYSFNL 302

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG +IY+TLA LFI+QATN PLS  D + +LL+++V+SKGA G+ GSA + LAAT++ +P
Sbjct: 303 DGFSIYLTLAVLFIAQATNTPLSTHDMIVVLLVSLVTSKGAHGIPGSAIVILAATLSAIP 362

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           ++P+ G+ LIL VD F+   R++TN IGN V TVVV+ WE  +D     + +  E
Sbjct: 363 AIPVLGLVLILPVDWFVGIARALTNLIGNCVATVVVAVWENDIDKARAKRVLNRE 417


>gi|254254468|ref|ZP_04947785.1| Na+/H+-dicarboxylate symporter [Burkholderia dolosa AUO158]
 gi|124899113|gb|EAY70956.1| Na+/H+-dicarboxylate symporter [Burkholderia dolosa AUO158]
          Length = 440

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 199/412 (48%), Positives = 293/412 (71%), Gaps = 2/412 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             R P Y+ILY+QVL AI  G+ LGHF P   V ++PLGD+F+K  +M+I PVIF TV T
Sbjct: 1   MQRKPFYRILYVQVLAAIVGGVLLGHFAPDAAVLLKPLGDLFIKLVRMVIGPVIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M+DMK +G++  KA+  F V S  AL IGL+  ++  PG G NVD  +L+  +++ 
Sbjct: 61  GIAGMQDMKKVGRVGGKALIYFEVASTLALAIGLLAAHVIAPGEGFNVDPSTLDARAVSS 120

Query: 130 --IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              +++H     GF+  +IP+T + AL  G+IL  L++A+LFG +L L+GE +  + + +
Sbjct: 121 YAAQAAHGDGLAGFIAHVIPETFVGALVHGDILPVLLIAMLFGTALVLIGEPAAPVTRSI 180

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E ++   FR+V +V  +AP+GAFGAM+FTIG+YG+ S+  ++ L+   Y T+  F+   L
Sbjct: 181 EILSKAFFRIVGMVTSLAPIGAFGAMAFTIGRYGIVSLLPMLKLIGTFYLTAFLFVTVAL 240

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +AR C F +++ + ++++E+L+VL TS+SE+ALP LM K+E  GC R +V +VVPTGY
Sbjct: 241 GAVARLCGFRLLRFLAYIRDELLIVLGTSTSEAALPQLMDKLERLGCPRGVVGLVVPTGY 300

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+NIY+TLA LF++QATN  LS   +++LLL+ M++SKG+ GVTG+ FITLAA++
Sbjct: 301 SFNLDGTNIYMTLAVLFLAQATNTHLSFAQEVTLLLVTMLTSKGSTGVTGAGFITLAASL 360

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           ++VP++P++ M LILG+DRFMSECRS+TN IGN V  +V+S WE  LD    
Sbjct: 361 SVVPTVPVSAMVLILGIDRFMSECRSLTNIIGNGVAAIVISAWEGGLDRTRL 412


>gi|293393858|ref|ZP_06638165.1| aerobic C4-dicarboxylate transporter [Serratia odorifera DSM 4582]
 gi|291423685|gb|EFE96907.1| aerobic C4-dicarboxylate transporter [Serratia odorifera DSM 4582]
          Length = 429

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKSTIFKSLYFQVLTAITLGILLGHFYPDLGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL++ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTLALIIGLVIVNVVQPGAGMNVDPGTLDAKAVAVY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G+K   I   +E 
Sbjct: 121 AEQAQQQGIIPFLLDIIPGSVIGAFASGNILQVLLFAVLFGFALHRLGDKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSNVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLVQLGQLILCFYITCILFVVVVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K + ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARANGFSIFKFVNYIKEELLIVLGTSSSESALPRMLDKMERLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDVMHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDAKQLHATLN 415


>gi|218551511|ref|YP_002385303.1| glutamate/aspartate:proton symporter [Escherichia fergusonii ATCC
           35469]
 gi|218359053|emb|CAQ91714.1| glutamate/aspartate:proton symporter [Escherichia fergusonii ATCC
           35469]
          Length = 498

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 145/419 (34%), Positives = 241/419 (57%), Gaps = 14/419 (3%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQ--------IGVQMQPLGDIFVKTTKMLITPVIF 64
             +   L  Q+L+A+  G+ LG ++          +   + P GDIF+   KM++ P++ 
Sbjct: 64  KNIKISLAWQILIAMVLGILLGSYLHYHSDSRDWLVVNFLSPAGDIFIHLIKMIVVPIVI 123

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            T+  GIA + D K +G+I  K +  F V +  A+++G+ + N+ +PG G+++   +   
Sbjct: 124 STLIVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAGVDMSQLATVD 183

Query: 125 ----ESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVG-EK 179
               +S      S +   +G +  ++P   ++++  G +L  +  ++LFG+ LS +    
Sbjct: 184 ISKYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPATH 243

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
            + +      I+  +F++  +VMR AP+G F  ++ T+  +G SS+  L  LV  ++   
Sbjct: 244 REPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFAI 303

Query: 240 AFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIV 299
            FF L VLGI+AR C  S+  LI  LK+E++L  ST+SSES LP +++KME  G   SI 
Sbjct: 304 LFFALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPASIT 363

Query: 300 SMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSA 359
           S VVPTGYSFNLDGS +Y ++A +FI+Q   + LS+  ++ L+L  MV+SKG AGV G +
Sbjct: 364 SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIVLVLTLMVTSKGIAGVPGVS 423

Query: 360 FITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
           F+ L AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+++WE K D K 
Sbjct: 424 FVVLLATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKK 481


>gi|20138080|sp|Q9X7K6|DCTA_RHIGA RecName: Full=C4-dicarboxylate transport protein
 gi|4584243|emb|CAB40566.1| putative C-4-dicarboxylate carrier [Rhizobium galegae]
          Length = 461

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 218/409 (53%), Positives = 313/409 (76%), Gaps = 1/409 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY+QVL AI +G+ +G+F P +G  ++PLGD F+K   M+I PVIFLTV+TGI
Sbjct: 12  KVPFYRHLYVQVLTAIVAGIMVGNFYPDLGASLKPLGDAFIKLVSMIIAPVIFLTVTTGI 71

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A M D+K +G++  KA+  F VFS  AL +GL+V NI +PG GM+++  +L+ +++A   
Sbjct: 72  AGMADLKKVGRVAGKAILYFTVFSTLALAVGLLVANILRPGAGMHINPATLDPKAVAAYA 131

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H  + + F+  +IP+T + A   GNILQ L +++LFGIS+++VG++   + + L+ +
Sbjct: 132 TNAHGTTAVSFLMKIIPNTIVGAFADGNILQVLFISILFGISIAMVGDRGQPVVRFLDAL 191

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+F++ +++M+ AP+GAFGAM+FT GKYG++S+ NL+ L+   Y TS  F+L VLG +
Sbjct: 192 TEPMFKLTAVLMKAAPIGAFGAMAFTNGKYGIASLINLVMLIGTFYLTSLLFVLVVLGAV 251

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FS+I LI ++KEE+LLVL TSSSE+ALPGLM KME+ GC RS+V +VVPTGYSFN
Sbjct: 252 ARCNGFSVIALIAYIKEEILLVLGTSSSEAALPGLMAKMEQVGCKRSVVGLVVPTGYSFN 311

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA+LFI+QAT+ PL+L DQ+ LLL+AM+SSKG+AG+TG+ FITLAAT++ V
Sbjct: 312 LDGTNIYMTLASLFIAQATDTPLTLADQILLLLVAMLSSKGSAGITGAGFITLAATLSAV 371

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           PS+P+AGM LILG+DRFMSE R++TN IGNA+ T+VV+ WE  LD    
Sbjct: 372 PSVPVAGMALILGIDRFMSESRAITNLIGNAIATLVVANWEGDLDRGRM 420


>gi|310765803|gb|ADP10753.1| C4-dicarboxylate transport protein [Erwinia sp. Ejp617]
          Length = 430

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 7   MKTSLFKSLYFQVLTAIAIGVLLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 66

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GMNVD  +L+ +++A +
Sbjct: 67  IAGMESMKAVGRTGAVALLYFEVVSTLALIIGLVVVNVLQPGAGMNVDPATLDAKAVAMY 126

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A   GNILQ L+ A+LFG +L  +G+K   +   ++ 
Sbjct: 127 AQQAEQQGVVAFLLDVIPASVIGAFAGGNILQVLLFAILFGFALHRMGDKGTLVFNFIDS 186

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F ++++VMR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG+
Sbjct: 187 FSHVIFGIINMVMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCVLFVVLVLGV 246

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 247 IARVVGFNIFKFIAYIKEELLIVLGTSSSESALPRMLAKMENLGCQKSVVGLVIPTGYSF 306

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 307 NLDGTSIYLTMAAVFIAQATNSHMDIWHQVTLLVVLLLSSKGAAGVTGSGFIVLAATLSA 366

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV++W  +LD K   + + 
Sbjct: 367 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWVGQLDEKQLTETLS 421


>gi|319646705|ref|ZP_08000934.1| GltT protein [Bacillus sp. BT1B_CT2]
 gi|317391293|gb|EFV72091.1| GltT protein [Bacillus sp. BT1B_CT2]
          Length = 428

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 147/417 (35%), Positives = 244/417 (58%), Gaps = 6/417 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             L   L  Q+ + +  G+A G      P +   +QP+GD+F++  KM++ P++  ++  
Sbjct: 2   KRLKFGLATQIFLGLILGVAAGAIWFGNPAVATYLQPVGDLFLRLIKMIVIPIVVSSLIV 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESI 127
           G+A     K +G++ ++ +  F + + FA+V+GL++GNI +PG G+N         ++ +
Sbjct: 62  GVAGAGSGKKVGRLGFRTILYFEIITTFAIVLGLLLGNIIQPGHGVNFSGAEKQDISQYV 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              K +  KS       ++P     +L  G++L  +   +LF + +S +GEK   +    
Sbjct: 122 ETEKEASTKSVADTFLHIVPTNFFQSLAEGDLLAIICFTVLFALGVSAIGEKGKPVLSFF 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E  +  +F +V+IVM+ AP G F  +  T+ K+G SS+ +L  LV  +Y   AFF++ + 
Sbjct: 182 EATSQAMFHVVNIVMKFAPFGVFALIGVTVSKFGFSSLLSLGKLVLLVYLALAFFLIVIF 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+ + C  +I K + +LK+E+LL  STSSSE+ LP +M+KME+ GC + IVS V+P GY
Sbjct: 242 GIVGKLCGINIFKFLAYLKDELLLAYSTSSSETVLPRVMEKMEKIGCPKGIVSFVIPIGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FNLDGS +Y  +A LF++Q   + LS+  QL+L+L+ MV+SKG A V G++F+ L AT+
Sbjct: 302 TFNLDGSVLYQAIAALFLAQVYGIDLSIGQQLTLILVLMVTSKGMAAVPGTSFVVLLATL 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +  +P  G+  I GVDR M   R+V N  GNA+  VV+S+WE + D       + 
Sbjct: 362 GTI-GVPAEGLAFIAGVDRIMDMARTVVNLTGNALAAVVMSKWEGEYDAVKGQNVLN 417


>gi|283835909|ref|ZP_06355650.1| aerobic C4-dicarboxylate transport protein [Citrobacter youngae
           ATCC 29220]
 gi|291068081|gb|EFE06190.1| aerobic C4-dicarboxylate transport protein [Citrobacter youngae
           ATCC 29220]
          Length = 428

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSIFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAIY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  +GF+ D+IP + + A  SGNILQ L+ A++FG +L  +G K   I   +E 
Sbjct: 121 AEQAKDQGIVGFLMDIIPASVIGAFASGNILQVLLFAVMFGFALHRLGSKGQMIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV++W K+LD K  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWVKELDTKKLDDTLN 415


>gi|117620377|ref|YP_857644.1| C4-dicarboxylate transporter DctA [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|167012050|sp|A0KMZ3|DCTA_AERHH RecName: Full=C4-dicarboxylate transport protein
 gi|117561784|gb|ABK38732.1| C4-dicarboxylate transport protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 426

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 210/415 (50%), Positives = 295/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  +   LY QVL+AI  G+ LGH  P +G  M+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MQKRIVSSLYFQVLLAITLGVILGHIYPDLGADMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AH 129
           IA M+ MK +G+    A+  F V S  AL+IGL V N+ +PG GMNVD  +L+  +I A+
Sbjct: 61  IAGMESMKAVGKTGAIALLYFEVVSTIALIIGLCVVNLLQPGAGMNVDPATLDASAISAY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + + A+  I F+ D+IP + + A  SGNILQ L+ A+LFG SL  +GEK   I   ++ 
Sbjct: 121 AEQAKAQGIIPFLLDVIPGSVIGAFASGNILQVLLFAVLFGFSLHHIGEKGKVIFNVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   FI  VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPVGAFGAMAFTIGKYGIGSLVQLGQLIACFYMTCLLFIFLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI++ I +++EE+L+VL TSSSES LP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARANGFSILRFISYIREELLIVLGTSSSESVLPRMLVKMEALGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN PL L  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAIFIAQATNTPLDLFQQITLLVVLLISSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV+R+  +L+ +  ++ + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLIGNGVATLVVARYCDQLNEQQMHEALS 415


>gi|308067073|ref|YP_003868678.1| Proton/sodium-glutamate symport protein (glutamate-aspartate
           carrier protein) [Paenibacillus polymyxa E681]
 gi|305856352|gb|ADM68140.1| Proton/sodium-glutamate symport protein (Glutamate-aspartate
           carrier protein) [Paenibacillus polymyxa E681]
          Length = 417

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 142/411 (34%), Positives = 250/411 (60%), Gaps = 5/411 (1%)

Query: 18  ILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
            L +Q+ + +  G+ +G        + V ++P+GDIF++  KM++ P++  T+  G+A +
Sbjct: 5   NLTMQIFIGLALGIIIGALFYGNSGVEVYLKPIGDIFIRLIKMIVVPIVISTLIIGVAGV 64

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES-IAHIKSS 133
            DMK +G++  K++  F + +  A++ GL+V N+ +PG G+++   + +           
Sbjct: 65  GDMKKLGKLGGKSILYFEIVTTIAILFGLLVANLVRPGDGVDMSHLAKSDIHSYVETAEK 124

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
              SFI  +  ++P   + AL  G++L  +  ++LFG+ ++ +G++   +    E +   
Sbjct: 125 SGHSFIDTIVHIVPTNIIQALGEGDMLAIIFFSVLFGLGVAAIGDRGKPVLNFFEGVADA 184

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VMR+AP G F  +  T+ K+GL+S+  L+ LV  +Y +   FI+ V GI+A+ 
Sbjct: 185 MFWVTNQVMRLAPFGVFALIGTTVAKFGLASLWPLLKLVLSVYGSMILFIVIVFGIIAKL 244

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
           C   +  ++  LK E+LL  ST+SSES LP +M+KME+ GC + I S V+P GYSFNLDG
Sbjct: 245 CGTRLWTMVKILKSELLLAYSTASSESVLPKIMEKMEKFGCPKGITSFVIPIGYSFNLDG 304

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA +FI+Q   + L +T Q++L+L+ ++SSKG AGV G++F+ L AT+  V +L
Sbjct: 305 STLYQALAAIFIAQMYGIDLPITTQITLVLVLIISSKGIAGVPGASFVVLLATLGAV-NL 363

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+  I G+DR +   R+V N +GN++  VV+S+WE + D +   +Y+ 
Sbjct: 364 PLEGLAFIAGIDRILDMARTVVNVLGNSLAAVVMSKWEGQYDKEKGEEYVA 414


>gi|212636973|ref|YP_002313498.1| sodium:dicarboxylate symporter [Shewanella piezotolerans WP3]
 gi|212558457|gb|ACJ30911.1| Sodium:dicarboxylate symporter [Shewanella piezotolerans WP3]
          Length = 432

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 121/408 (29%), Positives = 225/408 (55%), Gaps = 9/408 (2%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           L++Q+++ +  G+  G    +    ++P+G +FV T KMLI P++F ++  G+  M+D  
Sbjct: 21  LWLQIMIGMLLGILTGIGFGEQATVLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSMQDTA 80

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSF 138
            +G+I +K+   +   +  A+ +GL VG+  +PG G+++          A      A S 
Sbjct: 81  KMGRIGFKSFAFYLGTTSIAITVGLAVGHFLQPGKGLDM------VAEPAEQVVKAAPSV 134

Query: 139 IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMV 198
           +  + +++P   ++AL SG ILQ ++ A+  G++L L+G+      K  E +   ++++ 
Sbjct: 135 METLINIVPTNPIAALASGQILQVIVFAVALGVALVLIGDHGKPAIKVFESLAEAMYKLT 194

Query: 199 SIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR-FCRFS 257
            +VM++AP G FG M++  G+YG+  +  LI ++  +Y      I+G   I+   F + +
Sbjct: 195 DMVMKLAPYGVFGLMAWVAGEYGIGMLMPLIKVIAAVYIGCLLHIVGFYSIVLTVFAKLN 254

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEA-GCHRSIVSMVVPTGYSFNLDGSNI 316
            I+    +   + +  +TSSS   LP  MK   E  G ++ I S V+P G + N+DG+ +
Sbjct: 255 PIQFFKGISNAIAVAFTTSSSAGTLPASMKCANEYLGVNKKISSFVLPLGTTINMDGTAL 314

Query: 317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA 376
           Y  +  LF++QA  + LS  D ++++L A ++S G AGV G+  + L   +T V  LP+ 
Sbjct: 315 YQGVTALFVAQAFGIDLSWVDYITIILTATLASIGTAGVPGAGLVMLTLVLTTV-GLPLE 373

Query: 377 GMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           G+ LI G+DR +   R+V N  G+ V T V+++ E +L+ + +N  + 
Sbjct: 374 GVALIAGIDRVLDMARTVVNVSGDLVATTVIAKSEDELNVEHYNAGVE 421


>gi|220919921|ref|YP_002495224.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
 gi|219952341|gb|ACL62732.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
          Length = 466

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 197/413 (47%), Positives = 292/413 (70%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P+YK LY QVL A+ +G+ALGHF P +  QM+P GD F+K  KM+I PVIF+TVS GIA+
Sbjct: 28  PIYKRLYPQVLFALAAGIALGHFYPGLAEQMKPFGDGFIKMIKMMIGPVIFITVSVGIAK 87

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH-IKS 132
           M D+K +G++  KA+  F + +  ALVIGL+VGN+ KPG+G+N D  +L+  SI   + S
Sbjct: 88  MGDLKEVGRVGLKALIYFEILTTLALVIGLVVGNVLKPGVGINADPATLDASSITGFVAS 147

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           S   S + F+  +IP T   A   G ILQ L VA+LFG++LS   + +  + K LEE + 
Sbjct: 148 SQKLSTVDFLLHIIPTTFFDAFAKGEILQVLFVAVLFGVALSHFSQHTKLLVKILEEASH 207

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +F ++  +MRIAPLGAFGAM+FT+GKYG+ S+  +  LV  +Y T   F+  VLG +AR
Sbjct: 208 GLFGIIGFIMRIAPLGAFGAMAFTVGKYGIGSLQQVFLLVVGVYVTCIAFVFLVLGFVAR 267

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
              FS+ + ++++KEE+ +V+ TSSSE+ LP ++ KME+ GC + +V +V+PTGYSFNLD
Sbjct: 268 LTGFSLWRFLVYIKEEIFVVIGTSSSETVLPRMLVKMEKLGCAKPVVGLVLPTGYSFNLD 327

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ +Y+T+A LFI+QA N+ L+L +QLS+L + +++SKGAA V+G+AF+TLAA+++ +  
Sbjct: 328 GTCVYLTMAALFIAQAFNIDLTLGEQLSILGVMLLTSKGAAAVSGAAFVTLAASMSSIHH 387

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           LP++G+ L+LGVDR ++E R+VTN IGN V T+ +S+WE  LD     + +  
Sbjct: 388 LPVSGLALLLGVDRILAEVRAVTNLIGNGVGTLAISKWENALDTARMQQVLSG 440


>gi|71275667|ref|ZP_00651952.1| Sodium:dicarboxylate symporter [Xylella fastidiosa Dixon]
 gi|71897789|ref|ZP_00680015.1| Sodium:dicarboxylate symporter [Xylella fastidiosa Ann-1]
 gi|71163558|gb|EAO13275.1| Sodium:dicarboxylate symporter [Xylella fastidiosa Dixon]
 gi|71732344|gb|EAO34398.1| Sodium:dicarboxylate symporter [Xylella fastidiosa Ann-1]
          Length = 449

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 228/413 (55%), Positives = 304/413 (73%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y  LY  V++AI  G  LGH  P +G Q++PLGD F+K  KM+I+PVIFLT+ TGIA 
Sbjct: 18  PFYLQLYFWVIIAIILGALLGHCYPAVGQQLKPLGDAFIKLVKMIISPVIFLTIVTGIAS 77

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           +  +  + ++F KAM  F  FS  AL++GL+V ++  PG GMN++   L+   IA +++ 
Sbjct: 78  VAHVGTVARVFGKAMVYFLFFSTLALLLGLVVAHVVHPGAGMNINPVDLHQGEIANYVEK 137

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  + +GF+ D+IP T LS     NILQ L VA+LFGI+L+L GE+   +   L+ +  
Sbjct: 138 SHDLTLVGFLMDIIPKTLLSPFVGDNILQVLFVAVLFGIALALAGERGKPVLNLLDALTV 197

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVFR+V ++M++AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F+L +LG ++ 
Sbjct: 198 PVFRLVQMLMKMAPIGAFGAIAFTIGKYGVDSLVNLGWLVGSFYLTSLLFVLVILGAVSW 257

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
            C FSI+KLI +LK E+LLVL TSSSESALP LM+KM +AGC +S+V +VVPTGYSFNLD
Sbjct: 258 LCGFSILKLIRYLKAELLLVLGTSSSESALPSLMEKMVQAGCRKSVVGLVVPTGYSFNLD 317

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN  L+   QL+L L+AM+SSKGAAGV+G+ FITLAAT+ +VP 
Sbjct: 318 GTNIYMTLAALFIAQATNTELTPAHQLALFLVAMLSSKGAAGVSGAGFITLAATLAVVPE 377

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +PIAGM LILGVDRFMSECRS+TNFIGNAV T+VVSRWE  L+ +     +  
Sbjct: 378 VPIAGMALILGVDRFMSECRSLTNFIGNAVATLVVSRWENALNHEQLKIALDG 430


>gi|217978383|ref|YP_002362530.1| sodium:dicarboxylate symporter [Methylocella silvestris BL2]
 gi|217503759|gb|ACK51168.1| sodium:dicarboxylate symporter [Methylocella silvestris BL2]
          Length = 442

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 197/414 (47%), Positives = 280/414 (67%), Gaps = 3/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVSTG 70
            P YK+LY+QVL  I  G   G   P+      ++ LGD F+K  KMLI P+IF TV  G
Sbjct: 15  KPFYKVLYVQVLFGILVGALFGWLWPEYATAPWVKALGDGFIKLIKMLIAPIIFCTVVAG 74

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA + D K +G++  KA+  F + S FAL  GL++GN+ +PG G +          IA  
Sbjct: 75  IAHVSDAKKVGRVAVKALIYFEIVSTFALGFGLLMGNVVRPGAGFSGSHGDAAAA-IAFE 133

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           K     S + F+  +IPD+ + A   G++LQ L+ A+LFG +L  +G++   +   ++E 
Sbjct: 134 KQGEGHSTVDFLLGIIPDSVVGAFAKGDVLQVLLFAILFGFALMALGDRGKVVLHVIDEA 193

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
              +F +++IVM++APLGAFGAM+FT+GKYG  S+ NL  L+   YATSA FI  +LG +
Sbjct: 194 GHAIFGVINIVMKLAPLGAFGAMAFTVGKYGPQSLGNLAGLIATFYATSALFIFLILGTI 253

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   F+I K + ++K E+L+VL TSSSESALP LM+K+E  GC R +V +VVPTGYSFN
Sbjct: 254 ARIAGFNIFKFLNYIKSELLIVLGTSSSESALPALMEKLERLGCSRPVVGLVVPTGYSFN 313

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLATLFI+QA NV L+   Q+++L++AM++SKGA+GVTG+ F+TLAAT+ +V
Sbjct: 314 LDGTNIYMTLATLFIAQALNVDLTFGQQMTILIVAMLTSKGASGVTGAGFVTLAATLAVV 373

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
               + GM ++LG+D+FMSECR++TN IGN V TVV+S  E +LD +  N  +G
Sbjct: 374 NPALVPGMAIVLGIDKFMSECRALTNIIGNGVATVVISWSEGELDREKLNLALG 427


>gi|227327208|ref|ZP_03831232.1| glutamate/aspartate:proton symporter [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 438

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 144/424 (33%), Positives = 248/424 (58%), Gaps = 17/424 (4%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQ--------IGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            L  Q+L+A+  G+ALG  + +        I   + P GDIF++  KM++ P++  T+  
Sbjct: 7   SLAWQILIALVLGIALGAVLHEQQESRQWLISNILSPAGDIFIRLIKMIVVPIVIATLIV 66

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL----NTE 125
           GIA + D K +G+I +K +  F + +  A+++G+ + N+ +PG G+++   +       +
Sbjct: 67  GIAGVGDAKKLGRIGFKTILYFEIITTVAIILGITLANVFQPGHGIDMSTLTAVDISQYQ 126

Query: 126 SIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEKSDTIR 184
                  S + S +G +  +IP    +A+  G++L  +  ++LFG+   SL  +  + + 
Sbjct: 127 KTTEQVQSGSHSLVGTVLSLIPPNIFAAMAHGDMLPIIFFSVLFGLGLSSLPKDHREPLL 186

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
                ++  +F++  ++MR AP+G F  +S T+  +G +S+  L  LV  +YA   FF L
Sbjct: 187 NVFRGVSETMFKVTHMIMRYAPVGVFALISVTVANFGFASLWPLAKLVMLVYAAIFFFGL 246

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLGI+AR C+  I  LI  LK+E++L  ST+SSE+ LP +++KME  G  +SI S VVP
Sbjct: 247 VVLGIVARLCKLRITILIRILKDELILAYSTASSETVLPRIIEKMEAYGAPKSITSFVVP 306

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDGS +Y ++A +FI+Q   + LS+  ++ L+L  M++SKG AGV G +F+ L 
Sbjct: 307 TGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQEIVLVLTLMLTSKGIAGVPGVSFVVLL 366

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL---FNK 421
           AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+++WE + D +    + +
Sbjct: 367 ATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWENQFDEEKALAYER 425

Query: 422 YIGI 425
            +  
Sbjct: 426 ELKG 429


>gi|170729514|ref|YP_001774947.1| C4-dicarboxylate transporter DctA [Xylella fastidiosa M12]
 gi|226723858|sp|B0U1Z0|DCTA_XYLFM RecName: Full=C4-dicarboxylate transport protein
 gi|167964307|gb|ACA11317.1| C4-dicarboxylate transport protein [Xylella fastidiosa M12]
          Length = 449

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 227/413 (54%), Positives = 304/413 (73%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y  LY  V++AI  G  LGH  P +G Q++PLGD F+K  KM+I+PVIFLT+ TGIA 
Sbjct: 18  PFYLQLYFWVIIAIILGALLGHCYPAVGQQLKPLGDAFIKLVKMIISPVIFLTIVTGIAS 77

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           +  +  + ++F KAM  F  FS  AL++GL+V ++  PG GMN++   L+   IA +++ 
Sbjct: 78  VAHVGTVARVFGKAMVYFLFFSTLALLLGLVVAHVVHPGAGMNINPVDLHQGEIANYVEK 137

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  + +GF+ D+IP T LS     NILQ L VA+LFGI+L+L GE+   +   L+ +  
Sbjct: 138 SHDLTLVGFLMDIIPKTLLSPFVGDNILQVLFVAVLFGIALALAGERGKPVLNLLDALTV 197

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V ++M++AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F+L +LG ++ 
Sbjct: 198 PVFKLVQMLMKMAPIGAFGAIAFTIGKYGVDSLVNLGWLVGSFYLTSLLFVLVILGAVSW 257

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
            C FSI+KLI +LK E+LLVL TSSSESALP LM+KM +AGC +S+V +VVPTGYSFNLD
Sbjct: 258 LCGFSILKLIRYLKAELLLVLGTSSSESALPSLMEKMVQAGCRKSVVGLVVPTGYSFNLD 317

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN  L+   QL+L L+AM+SSKGAAGV+G+ FITLAAT+ +VP 
Sbjct: 318 GTNIYMTLAALFIAQATNTELTPAHQLALFLVAMLSSKGAAGVSGAGFITLAATLAVVPE 377

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +PIAGM LILGVDRFMSECRS+TNFIGNAV T+VVSRWE  L+ +     +  
Sbjct: 378 VPIAGMALILGVDRFMSECRSLTNFIGNAVATLVVSRWENALNHEQLKIALDG 430


>gi|161505843|ref|YP_001572955.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189082866|sp|A9MLJ4|DCTA_SALAR RecName: Full=C4-dicarboxylate transport protein
 gi|160867190|gb|ABX23813.1| hypothetical protein SARI_04020 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 428

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A  
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAQAVAVY 120

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            +    +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AAQAKEQGIIAFLMDIIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVTGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD +  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDRQKLDDVLN 415


>gi|220920355|ref|YP_002495656.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
 gi|219944961|gb|ACL55353.1| sodium:dicarboxylate symporter [Methylobacterium nodulans ORS 2060]
          Length = 453

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 192/414 (46%), Positives = 291/414 (70%), Gaps = 3/414 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y++LYIQVL+AI  G+ LG+  P     M+PLGD F+   KM+I P+IF T+  GIA 
Sbjct: 21  PWYRVLYIQVLIAIALGVLLGYLAPDTAKSMKPLGDAFIALIKMMIAPIIFCTIVHGIAS 80

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           + D+K +G++  KA+  F   S  AL++G+IVG + +PG G   D   L+  ++A + + 
Sbjct: 81  IGDLKKVGRVGLKALVYFEAVSTLALLVGVIVGELIRPGAGFGADPAKLDASAVAGYAQK 140

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +  +S IG +  +IP +   AL +G++LQ L++A+L G+ ++ +GE++  +   ++    
Sbjct: 141 AAGESTIGHLMAIIPKSFFDALATGDLLQVLLIAILTGVVVTGLGERAKGVTHAIDVAAE 200

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             FR++ +++++APLGAFGAM+FTIG++G+  + NL  LV   Y TS FF+L VLG++AR
Sbjct: 201 IFFRIIGMIVKLAPLGAFGAMAFTIGQFGIGKLGNLAGLVATFYLTSLFFVLVVLGLIAR 260

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSI+K + ++K+E+L+VL TSSSES LP +M+KM+  G   S+V +V+PTGYSFNLD
Sbjct: 261 FAGFSILKFLAYIKDELLIVLGTSSSESVLPHMMQKMKRLGASDSVVGLVIPTGYSFNLD 320

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLATLF++QA    LS     +++L+AM++SKGA+GVTG+ F+TLAAT+  +P 
Sbjct: 321 GTNIYMTLATLFLAQAVGADLSFGQYATIILVAMLTSKGASGVTGAGFVTLAATLAAIPG 380

Query: 373 --LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+A M LILGVD+FMSECR++TN +GN V T+VVSRWE +LDP    + + 
Sbjct: 381 NPVPVAAMALILGVDKFMSECRALTNLVGNGVATIVVSRWEGELDPVKLREVMA 434


>gi|152975971|ref|YP_001375488.1| C4-dicarboxylate transporter DctA [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152024723|gb|ABS22493.1| sodium:dicarboxylate symporter [Bacillus cytotoxicus NVH 391-98]
          Length = 413

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 176/411 (42%), Positives = 274/411 (66%), Gaps = 1/411 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G QM+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQQMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M +MK +G++  KA+  F + +  AL+IG+IV N  +PG G++        +   +++S
Sbjct: 61  SMGNMKKVGRVGGKALLYFEIVTTLALLIGIIVANAVRPGDGLDPTKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWLDFFLHIVPSNMFEAFVKGDILQVLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++APLGAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + R
Sbjct: 180 VFFNILSIVMKLAPLGAFGGMAFTIGKYGLSTLIPLSKLMVCVYATMALFVFIVLHFICR 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
             +FS+ K + ++KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 LYKFSLWKYLSYIKEELLIVLGTSSSESVLPRMMTKMEQFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  ++ LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHIDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E +   + + + +
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFSEEKYKQVL 410


>gi|52079507|ref|YP_078298.1| proton/sodium-glutamate symport protein [Bacillus licheniformis
           ATCC 14580]
 gi|52784872|ref|YP_090701.1| GltT [Bacillus licheniformis ATCC 14580]
 gi|52002718|gb|AAU22660.1| proton/sodium-glutamate symport protein [Bacillus licheniformis
           ATCC 14580]
 gi|52347374|gb|AAU40008.1| GltT [Bacillus licheniformis ATCC 14580]
          Length = 428

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 148/417 (35%), Positives = 244/417 (58%), Gaps = 6/417 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             L   L  Q+ + +  G+A G      P +   +QP+GD+F++  KM++ P++  ++  
Sbjct: 2   KRLKFGLATQIFLGLILGVAAGAIWFGNPAVATYLQPVGDLFLRLIKMIVIPIVVSSLIV 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESI 127
           G+A     K +G++ ++ +  F + + FA+V+GL++GNI +PG G+N         ++ +
Sbjct: 62  GVAGAGSGKKVGRLGFRTILYFEIITTFAIVLGLLLGNIIQPGHGVNFSGAEKQDISQYV 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              K +  KS       ++P     +L  G++L  +   +LF + +S +GEK   +    
Sbjct: 122 ETEKEASTKSVADTFLHIVPTNFFQSLAEGDLLAIICFTVLFALGVSAIGEKGKPVLSFF 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E  +  +F +V+IVM+ AP G F  +  T+ K+G SS+ +L  LV  +Y   AFF++ + 
Sbjct: 182 EATSQAMFHVVNIVMKFAPFGVFALIGVTVSKFGFSSLLSLGKLVLLVYLALAFFLIVIF 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+ + C  +I K + FLK+E+LL  STSSSE+ LP +M+KME+ GC + IVS V+P GY
Sbjct: 242 GIVGKLCGINIFKFLAFLKDELLLAYSTSSSETVLPRVMEKMEKIGCPKGIVSFVIPIGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FNLDGS +Y  +A LF++Q   + LS+  QL+L+L+ MV+SKG A V G++F+ L AT+
Sbjct: 302 TFNLDGSVLYQAIAALFLAQVYGIDLSIGQQLTLILVLMVTSKGMAAVPGTSFVVLLATL 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +  +P  G+  I GVDR M   R+V N  GNA+  VV+S+WE + D       + 
Sbjct: 362 GTI-GVPAEGLAFIAGVDRIMDMARTVVNLTGNALAAVVMSKWEGEYDAVKGQNVLN 417


>gi|271501135|ref|YP_003334160.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech586]
 gi|270344690|gb|ACZ77455.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech586]
          Length = 439

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 153/418 (36%), Positives = 248/418 (59%), Gaps = 14/418 (3%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQ--------IGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            L  Q+L+A+  G+A+G ++ +        +   + P GDIF++  KM++ P++  T+  
Sbjct: 7   SLAWQILIALIVGIAVGAWLHENPANKLWLVTNVLSPAGDIFIRLIKMIVVPIVITTLVV 66

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKS----LNTE 125
           GIA + D K +G+I +K +  F V +  A+VIG+ + N+  PG G+++ + +       E
Sbjct: 67  GIAGVGDAKKLGRIGFKTIVYFEVITTLAIVIGITLANLFHPGHGIDMSMLTRVDISQYE 126

Query: 126 SIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEKSDTIR 184
                  S + S +G +  +IP    +AL  G++L  +  A+LFG+   SL  E+ D + 
Sbjct: 127 KTTEQVQSGSHSLVGTILSLIPPNIFAALAKGDMLPVIFFAVLFGLGLSSLPREQRDPLL 186

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
                 +  +FR+ +++MR AP+G F  ++ T+  +G +S+  L  LV  +YA   FF L
Sbjct: 187 NVFRSASETMFRVTNMIMRYAPVGVFALIAVTVANFGFASLWPLAKLVIMVYAAILFFAL 246

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLG +AR CR  I+ LI  LK+E++L  ST+SSE+ LP +++KME  G  ++I S VVP
Sbjct: 247 VVLGAVARLCRLRIMTLIRILKDELILAYSTASSETVLPRIIQKMEAYGAPKAITSFVVP 306

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDGS +Y ++A +FI+Q   + LSL  +L L+L  M++SKG AGV G +F+ L 
Sbjct: 307 TGYSFNLDGSTLYQSIAAIFIAQLYGIDLSLWQELVLVLTLMITSKGIAGVPGVSFVVLL 366

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+S+WE + D +    Y
Sbjct: 367 ATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVISKWEGQFDEEKARAY 423


>gi|255524392|ref|ZP_05391349.1| sodium:dicarboxylate symporter [Clostridium carboxidivorans P7]
 gi|255511949|gb|EET88232.1| sodium:dicarboxylate symporter [Clostridium carboxidivorans P7]
          Length = 423

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 144/417 (34%), Positives = 246/417 (58%), Gaps = 6/417 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
                 L  Q+++ +  G+ +G      P +   +QP+GDIF++  KM++ P++F  +  
Sbjct: 2   KKKKLSLATQIVIGLVLGVIVGAVFYGNPAVSTYLQPIGDIFLRLIKMIVVPIVFSALVV 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD--LKSLNTESI 127
           GIA   D+K +G++  K +  F V +  A+++GL++GN+  PG G+++   +KS  +  +
Sbjct: 62  GIAGGGDIKQVGKLGVKTIVYFEVVTTVAIILGLVIGNVIHPGTGIDMHSLIKSNVSSYM 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              ++     F     +++P   + +L  G++L  +  +++FG+ +S +GEK   +    
Sbjct: 122 NTAQTVSHHGFADTFVNIVPTNIVESLAKGDMLAVIFFSVMFGLGVSAIGEKGKPVLAIC 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + I   +F + + +M+ AP G F  +  T+ K+G+ S+  L  L    Y    FF+L VL
Sbjct: 182 QGIADTMFWVTNQIMKTAPFGVFALIGVTVSKFGIKSLIPLGKLAITTYGAMFFFVLVVL 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +A+F   SI  LI  LK+E++L  ST+SSE+ LP +M+KME+ GC ++I + VVPTGY
Sbjct: 242 GCIAKFVGTSIFTLIKVLKDELILAYSTASSETVLPRIMEKMEKFGCPKAIATFVVPTGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDGS +Y  +A LFI+Q   + L +  Q++L+++ M++SKG AGV G +F+ L AT+
Sbjct: 302 SFNLDGSTLYQAIAALFIAQLYGMHLPILTQINLVVVLMLTSKGIAGVPGVSFVVLLATL 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             V  +P+ G+  I G+DR +   R+  N  GN++  VVVS+WE K D +   KY+ 
Sbjct: 362 GSV-GIPVEGIAFIAGIDRILDMARTAVNVCGNSLAVVVVSKWEGKYDSEKGKKYVE 417


>gi|229157158|ref|ZP_04285238.1| C4-dicarboxylate transport protein [Bacillus cereus ATCC 4342]
 gi|228626222|gb|EEK82969.1| C4-dicarboxylate transport protein [Bacillus cereus ATCC 4342]
          Length = 420

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 177/412 (42%), Positives = 274/412 (66%), Gaps = 1/412 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             + K L  QV+VAI  G+A+G   P +G +M+P+G+ F+   KM+I P+IFLT+  GIA
Sbjct: 1   MRIVKNLTFQVIVAIICGIAVGAIWPSVGQEMKPIGETFINMIKMVIAPIIFLTIVLGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M  MK +G++  KA+  F + +  AL+IG+IV N+ +PG G++        +   +++S
Sbjct: 61  SMGSMKKVGRVGGKALLYFEIVTTAALIIGIIVANVVRPGDGLDPSKLK-GGDVSQYVQS 119

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
                ++ F   ++P     A   G+ILQ L  ++LFG  L+++G+    +    E ++ 
Sbjct: 120 GQEMKWMDFFLHIVPSNMFEAFAKGDILQLLFFSILFGAGLTMLGKNGQPVIDFFERLSK 179

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
             F ++SIVM++AP+GAFG M+FTIGKYGLS++  L  L+ C+YAT A F+  VL  + +
Sbjct: 180 VFFNILSIVMKLAPVGAFGGMAFTIGKYGLSTLIPLGKLMICVYATMALFVFIVLNFICK 239

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F +FS+ K +  +KEE+L+VL TSSSES LP +M KME+ GC + +V +V+PTGYSFNLD
Sbjct: 240 FYKFSLWKYLAHIKEELLIVLGTSSSESVLPRMMTKMEDFGCSKPVVGLVIPTGYSFNLD 299

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+ IY+++AT+F++Q  +V LSL  QL+++ I +V+SKGAA VTG  FI LA+T++ +  
Sbjct: 300 GTTIYLSMATIFLAQVFHVDLSLGQQLTIIAILLVTSKGAAAVTGGGFIVLASTLSAMNV 359

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +P+ G+ L+LGVDRFMSE R++ N IGN + TVVV++ E + D   + K + 
Sbjct: 360 IPLEGLALLLGVDRFMSEARAIVNLIGNGIATVVVAKSENEFDNAKYMKVVE 411


>gi|187922525|ref|YP_001894167.1| C4-dicarboxylate transporter DctA [Burkholderia phytofirmans PsJN]
 gi|187713719|gb|ACD14943.1| sodium:dicarboxylate symporter [Burkholderia phytofirmans PsJN]
          Length = 426

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 216/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P++K+LY+QV+VAI  G+ALGHF P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPIHKVLYVQVIVAIIIGIALGHFYPNLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GLI  ++ KPG+G N+D  +L+ +++A  
Sbjct: 61  IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGVGFNIDPATLDGKAVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H ++ + F+  +IPDT +SA   G ILQ L++ALLFG  L+  GEK   +   ++ 
Sbjct: 121 AAKAHGQTTVDFLMHLIPDTLVSAFAQGEILQILLIALLFGAVLATAGEKGKVVTSFIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F +V I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ L+   Y TS  F++ VLGI
Sbjct: 181 LSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGI 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I++ + ++KEE+L+VL TSSSE+ALP LM K+E+ GC RS+V +VVPTGYSF
Sbjct: 241 IARAVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  L+ T QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    N  +  +
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLNAALRGD 417


>gi|153948613|ref|YP_001403008.1| C4-dicarboxylate transporter DctA [Yersinia pseudotuberculosis IP
           31758]
 gi|167012309|sp|A7FP30|DCTA_YERP3 RecName: Full=C4-dicarboxylate transport protein
 gi|152960108|gb|ABS47569.1| aerobic C4-dicarboxylate transport protein [Yersinia
           pseudotuberculosis IP 31758]
          Length = 429

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 211/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKVSIFKTLYFQVLTAITIGVLLGHFYPEIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+A+PG+GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTLALLIGLVVVNVAQPGVGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGVINMIMRLAPLGAFGAMAFTIGKYGVGSLVQLGQLILCFYLTCILFVVLVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMENAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIMHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCKQLDNDQLQAVLS 415


>gi|16762688|ref|NP_458305.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29144175|ref|NP_807517.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213161200|ref|ZP_03346910.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213420496|ref|ZP_03353562.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213426517|ref|ZP_03359267.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213583814|ref|ZP_03365640.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213650199|ref|ZP_03380252.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213851931|ref|ZP_03381463.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289824316|ref|ZP_06543909.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|20137814|sp|Q8Z287|DCTA_SALTI RecName: Full=Aerobic C4-dicarboxylate transport protein
 gi|25303133|pir||AG0985 C4-dicarboxylate transport protein STY4189 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504994|emb|CAD08011.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139812|gb|AAO71377.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 428

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 208/415 (50%), Positives = 297/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+ GLI+ N+ +PG GMNVD  +L+ +++A  
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALINGLIIVNVVQPGAGMNVDPATLDAQAVAVY 120

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            +    +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AAQAKEQGIIAFLMDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVTGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD +  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHQKLDDVLN 415


>gi|196228629|ref|ZP_03127495.1| sodium:dicarboxylate symporter [Chthoniobacter flavus Ellin428]
 gi|196226910|gb|EDY21414.1| sodium:dicarboxylate symporter [Chthoniobacter flavus Ellin428]
          Length = 437

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 198/415 (47%), Positives = 292/415 (70%), Gaps = 2/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R P Y+ILY+QVL+ +  G+ +GHF P  GV +QPLGD F+K  KM+I P+IF TV+ G
Sbjct: 6   VRLPWYRILYVQVLIGVALGILIGHFFPAQGVALQPLGDGFIKLVKMIIAPIIFCTVTHG 65

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH- 129
           IA M D+K +G+I  KA+  F V S FAL+IGL+V N  KPG G           + A  
Sbjct: 66  IAAMSDLKKLGRIGGKALLYFEVVSTFALLIGLVVVNTLKPGEGFQAGALDPAAVAKAQH 125

Query: 130 -IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLE 188
             + +H  + + F+ ++IP T L A T  ++LQ L+VA+L   ++  +GE+   I   +E
Sbjct: 126 FAQQAHTLNTVDFLLNIIPKTFLGAFTGDDLLQVLLVAVLTAFAIGAMGERGKPILHGIE 185

Query: 189 EINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG 248
             +   F ++ IV+++AP+GA GAM++T+G YGL ++ NL+ L+   Y T+  F++ VLG
Sbjct: 186 LASEVFFGIMRIVVQLAPIGAMGAMAYTVGSYGLGALRNLLELMLGFYFTAGVFVIVVLG 245

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYS 308
            +AR C FSI + I ++KEE+LLVL TSSSE+ALPG+++KM   GC  S V +V+PTGYS
Sbjct: 246 AIARMCGFSIFRFIGYIKEELLLVLGTSSSETALPGMLRKMRALGCAESTVGLVIPTGYS 305

Query: 309 FNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATIT 368
           FNLDG+NIY+T+ATLF++QATN  L+L  QL++L +AM+SSKGA+ VTG+ FITLAAT++
Sbjct: 306 FNLDGTNIYMTMATLFLAQATNTHLNLRQQLTILAVAMLSSKGASAVTGAGFITLAATLS 365

Query: 369 LVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           +V  +P+  + +++G+DRFMSECR++TN +GN V TVV+SRWEK++ P+   + +
Sbjct: 366 VVKEIPLESLAMLVGIDRFMSECRALTNLVGNGVATVVISRWEKEVTPEQLRENL 420


>gi|187924705|ref|YP_001896347.1| sodium:dicarboxylate symporter [Burkholderia phytofirmans PsJN]
 gi|187715899|gb|ACD17123.1| sodium:dicarboxylate symporter [Burkholderia phytofirmans PsJN]
          Length = 461

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 203/417 (48%), Positives = 302/417 (72%), Gaps = 2/417 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             R PLYK+LY+QV+VAI  G+ALGHF+P   V M+PLGD F+K  +M+I+PVIF TV T
Sbjct: 1   MKRKPLYKVLYVQVIVAIIIGVALGHFLPADAVAMKPLGDAFIKLVRMIISPVIFCTVVT 60

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIA M DM+ +G++  KA+  F V S  AL IGL+  ++ KPGIG NVD  +L+  +IA 
Sbjct: 61  GIASMHDMRKVGRVGGKALLYFEVVSTLALAIGLLAAHVLKPGIGFNVDPSTLDAGAIAS 120

Query: 130 IKSS--HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
             +   H +   GF   +IPDT   A T G+IL  L++A+LFG +L+++GE +  +   +
Sbjct: 121 YAAQAAHGEGLAGFFMHIIPDTFAGAFTQGDILPVLLIAMLFGTALAVLGEPAKPLIGLI 180

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + ++   FR+V ++  +AP+GAFGA++FTIGKYG+ S+  ++ L+   Y T+  F+   L
Sbjct: 181 DLLSKTFFRIVRMITSLAPIGAFGAIAFTIGKYGIVSLLPMMKLIGTFYLTAFLFVSCGL 240

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G++AR C FS+ + ++++K+E+L+VL TS+SE+ALP LM+K+E  GC R IV +VVPTGY
Sbjct: 241 GLIARACGFSLWRFVVYIKDELLIVLGTSTSEAALPQLMEKLERLGCSRGIVGLVVPTGY 300

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+NIY+TLA LF++QATN  L++  +++LL + M++SKG+ GVTG+ FITLAA++
Sbjct: 301 SFNLDGTNIYMTLAVLFLAQATNTHLTIAQEITLLAVTMLTSKGSTGVTGAGFITLAASL 360

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           ++VP++P+  M LILG+DRFMSECR++TN +GN V ++V++ WEK+LD    N  + 
Sbjct: 361 SVVPTVPVTAMVLILGIDRFMSECRALTNTMGNGVASIVIAAWEKELDRGKLNAALA 417


>gi|167561664|ref|ZP_02354580.1| Sodium/dicarboxylate symporter [Burkholderia oklahomensis EO147]
 gi|167568901|ref|ZP_02361775.1| Sodium/dicarboxylate symporter [Burkholderia oklahomensis C6786]
          Length = 471

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 174/408 (42%), Positives = 275/408 (67%), Gaps = 1/408 (0%)

Query: 19  LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMK 78
           LY+QVL+ I +G+ +GHF P +G Q++PLGD+F++  +ML+ P++F +V  GIARM D+ 
Sbjct: 17  LYMQVLIGIVAGVLVGHFAPGVGEQLKPLGDLFIRLIRMLLAPIVFASVVVGIARMNDIH 76

Query: 79  VIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS-SHAKS 137
             G++  KA+  F + S  AL IGL+V N+ KPG GMNVD   L+  ++A   S +    
Sbjct: 77  AAGRVGVKAVVYFEIASTLALAIGLVVVNVLKPGAGMNVDPAHLDGAAVATYASHAQRHG 136

Query: 138 FIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRM 197
              F+  ++P + + A  +G +L  +  +LL  ISL+ +G ++      LE     +F +
Sbjct: 137 MADFLLSIVPTSVVGAFANGEMLGVIFFSLLLAISLAQLGPRTAPFVDILEMFLQAMFGV 196

Query: 198 VSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFS 257
           V I MR APLGAFG ++FT+ KYG+ ++++   L+ CLY TSA F++ VLG + R C  S
Sbjct: 197 VRIAMRAAPLGAFGGIAFTVAKYGIGTLASFGQLLACLYLTSACFVVVVLGAVMRLCGLS 256

Query: 258 IIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIY 317
           + + + ++K+E+L+ L T+S+E+ LP ++ K+E  GC R +V MV+PTGY+FN DG+ IY
Sbjct: 257 LWQFLRYIKDEILITLGTASTEAVLPQMLVKLERMGCARPVVGMVLPTGYTFNADGTAIY 316

Query: 318 ITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAG 377
           +T+A+LF++QA NVPL+L DQL +L + + +SKG+AGV G+ F+ LAAT+  +  +P++G
Sbjct: 317 LTMASLFVAQALNVPLTLWDQLLVLGVLLFTSKGSAGVAGAGFVALAATLASLHKIPVSG 376

Query: 378 MTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           + L+LG+DRF++E R+VTN IGN V T+ V+RWE+ LD +     +  
Sbjct: 377 LVLLLGIDRFLNEARAVTNLIGNGVATIAVARWERALDVERARAVLAG 424


>gi|259910220|ref|YP_002650576.1| C4-dicarboxylate transporter DctA [Erwinia pyrifoliae Ep1/96]
 gi|224965842|emb|CAX57375.1| Aerobic C4-dicarboxylate transport protein [Erwinia pyrifoliae
           Ep1/96]
          Length = 424

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 299/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGHF P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGVLLGHFYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GMNVD  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTLALIIGLVVVNVLQPGAGMNVDPATLDAKAVAMY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  + F+ D+IP + + A   GNILQ L+ A+LFG +L  +G+K   +   ++ 
Sbjct: 121 AQQAEQQGVVAFLLDVIPASVIGAFAGGNILQVLLFAILFGFALHRMGDKGTLVFNFIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F ++S+VMR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG+
Sbjct: 181 FSHVIFGIISMVMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCVLFVVLVLGV 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I K I ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+PTGYSF
Sbjct: 241 IARVVGFNIFKFIAYIKEELLIVLGTSSSESALPRMLAKMENLGCQKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAAT++ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQVTLLVVLLLSSKGAAGVTGSGFIVLAATLSA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V TVVV++W  +LD K   + + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWVGQLDEKQLTETLN 415


>gi|22127707|ref|NP_671130.1| C4-dicarboxylate transporter DctA [Yersinia pestis KIM 10]
 gi|45443104|ref|NP_994643.1| C4-dicarboxylate transporter DctA [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51598122|ref|YP_072313.1| C4-dicarboxylate transporter DctA [Yersinia pseudotuberculosis IP
           32953]
 gi|108809811|ref|YP_653727.1| C4-dicarboxylate transporter DctA [Yersinia pestis Antiqua]
 gi|108813802|ref|YP_649569.1| C4-dicarboxylate transporter DctA [Yersinia pestis Nepal516]
 gi|145600610|ref|YP_001164686.1| C4-dicarboxylate transporter DctA [Yersinia pestis Pestoides F]
 gi|150261052|ref|ZP_01917780.1| C4-dicarboxylate transport protein [Yersinia pestis CA88-4125]
 gi|162418786|ref|YP_001608354.1| C4-dicarboxylate transporter DctA [Yersinia pestis Angola]
 gi|165927042|ref|ZP_02222874.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936911|ref|ZP_02225477.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009676|ref|ZP_02230574.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213402|ref|ZP_02239437.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167400695|ref|ZP_02306204.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421132|ref|ZP_02312885.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426636|ref|ZP_02318389.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467300|ref|ZP_02332004.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis FV-1]
 gi|170022359|ref|YP_001718864.1| C4-dicarboxylate transporter DctA [Yersinia pseudotuberculosis
           YPIII]
 gi|186897342|ref|YP_001874454.1| C4-dicarboxylate transporter DctA [Yersinia pseudotuberculosis
           PB1/+]
 gi|218930987|ref|YP_002348862.1| C4-dicarboxylate transporter DctA [Yersinia pestis CO92]
 gi|229836427|ref|ZP_04456594.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis Pestoides A]
 gi|229839693|ref|ZP_04459852.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229841777|ref|ZP_04461933.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229904314|ref|ZP_04519425.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis Nepal516]
 gi|270488077|ref|ZP_06205151.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis KIM
           D27]
 gi|294504284|ref|YP_003568346.1| C4-dicarboxylate transport protein [Yersinia pestis Z176003]
 gi|20137823|sp|Q8ZA28|DCTA_YERPE RecName: Full=C4-dicarboxylate transport protein
 gi|81638155|sp|Q664D7|DCTA_YERPS RecName: Full=C4-dicarboxylate transport protein
 gi|122382528|sp|Q1C190|DCTA_YERPA RecName: Full=C4-dicarboxylate transport protein
 gi|122384079|sp|Q1CDG1|DCTA_YERPN RecName: Full=C4-dicarboxylate transport protein
 gi|167012310|sp|A4TR01|DCTA_YERPP RecName: Full=C4-dicarboxylate transport protein
 gi|226723859|sp|B2K6M5|DCTA_YERPB RecName: Full=C4-dicarboxylate transport protein
 gi|226723860|sp|A9R5H1|DCTA_YERPG RecName: Full=C4-dicarboxylate transport protein
 gi|226723861|sp|B1JH81|DCTA_YERPY RecName: Full=C4-dicarboxylate transport protein
 gi|21960827|gb|AAM87381.1|AE013987_4 C4-dicarboxylic acids symporter [Yersinia pestis KIM 10]
 gi|45437971|gb|AAS63520.1| C4-dicarboxylate transport protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51591404|emb|CAH23070.1| DAACS family C4-dicarboxylate symporter [Yersinia
           pseudotuberculosis IP 32953]
 gi|108777450|gb|ABG19969.1| C4-dicarboxylate transport protein [Yersinia pestis Nepal516]
 gi|108781724|gb|ABG15782.1| C4-dicarboxylate transport protein [Yersinia pestis Antiqua]
 gi|115349598|emb|CAL22572.1| C4-dicarboxylate transport protein [Yersinia pestis CO92]
 gi|145212306|gb|ABP41713.1| C4-dicarboxylate transport protein [Yersinia pestis Pestoides F]
 gi|149290460|gb|EDM40537.1| C4-dicarboxylate transport protein [Yersinia pestis CA88-4125]
 gi|162351601|gb|ABX85549.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis Angola]
 gi|165915153|gb|EDR33764.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921148|gb|EDR38372.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991598|gb|EDR43899.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205343|gb|EDR49823.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166961261|gb|EDR57282.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050063|gb|EDR61471.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054411|gb|EDR64227.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169748893|gb|ACA66411.1| sodium:dicarboxylate symporter [Yersinia pseudotuberculosis YPIII]
 gi|186700368|gb|ACC90997.1| sodium:dicarboxylate symporter [Yersinia pseudotuberculosis PB1/+]
 gi|229678432|gb|EEO74537.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis Nepal516]
 gi|229691116|gb|EEO83169.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696059|gb|EEO86106.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229706495|gb|EEO92502.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis Pestoides A]
 gi|262363695|gb|ACY60416.1| C4-dicarboxylate transport protein [Yersinia pestis D106004]
 gi|270336581|gb|EFA47358.1| aerobic C4-dicarboxylate transport protein [Yersinia pestis KIM
           D27]
 gi|294354743|gb|ADE65084.1| C4-dicarboxylate transport protein [Yersinia pestis Z176003]
 gi|320017320|gb|ADW00892.1| C4-dicarboxylic acid, orotate and citrate transporter [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 429

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 211/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P+IG QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKVSIFKTLYFQVLTAITIGVLLGHFYPEIGAQMKPLGDGFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGL+V N+A+PG+GMN+D  +L+ +++A +
Sbjct: 61  IAGMESMKAVGRTGAIALLYFEIVSTLALLIGLVVVNVAQPGVGMNIDPATLDAKAVALY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   +E 
Sbjct: 121 AEQASQQGIIPFLLDIIPGSVVGAFASGNILQVLLFAVLFGFALHRLGEKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGVINMIMRLAPLGAFGAMAFTIGKYGVGSLVQLGQLILCFYLTCILFVVLVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+F  F+I K I ++KEE+L+VL TSSSES LP ++ KME AGC +S+V +V+PTGYSF
Sbjct: 241 IAKFNGFNIFKFIRYIKEELLIVLGTSSSESVLPRMLDKMENAGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIMHQVTLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V T+VV++W K+LD       + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWCKQLDNDQLQAVLS 415


>gi|307128873|ref|YP_003880889.1| C4-dicarboxylic acid, orotate and citrate transporter [Dickeya
           dadantii 3937]
 gi|306526402|gb|ADM96332.1| C4-dicarboxylic acid, orotate and citrate transporter [Dickeya
           dadantii 3937]
          Length = 428

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 212/416 (50%), Positives = 299/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QMQPLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKSIFKSLYFQVLAAITIGILLGHFYPALGQQMQPLGDGFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GMNVD  +LN  ++A +
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEVVSTLALIIGLVVVNVLQPGAGMNVDPAALNVAAVANY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A++FG +L  +G+K   I   +E 
Sbjct: 121 ATEAGKQGVVPFLMDVIPSSVIGAFASGNILQVLLFAVMFGFALHRLGDKGVLIFDVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSKVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLEKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  N  +  
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDSKQMNDVLSG 416


>gi|319653775|ref|ZP_08007870.1| proton/sodium-glutamate symporter protein [Bacillus sp. 2_A_57_CT2]
 gi|317394501|gb|EFV75244.1| proton/sodium-glutamate symporter protein [Bacillus sp. 2_A_57_CT2]
          Length = 420

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 145/409 (35%), Positives = 244/409 (59%), Gaps = 6/409 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
             +   L  Q+ + +  G+A+G            +QP GD+F++  KM++ P++  T+  
Sbjct: 2   KKIKLSLATQIFIGLILGIAIGGIFYGSETAQSVLQPFGDLFIRLIKMIVVPIVLSTIIV 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESI 127
            IA + D+K +G++  K++  F   ++ A+V+GLI GN+ +PG G+N+D    +  +  +
Sbjct: 62  AIAGVGDLKAVGKLGGKSLTYFIGMTLVAIVVGLIAGNVIQPGAGLNMDSLQQSDISSYV 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              K    KS       ++P   + A+  G++L  +  A++FG+ ++ +GEK   + +  
Sbjct: 122 ETNKEQEGKSIADTFLHIVPTNPVQAMVEGDMLAIIFFAVVFGLGIAAIGEKGKPVLRFF 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           E     +F + ++ M+ AP+G F  +  TI KYG +S+  L  L   +Y    FF+L VL
Sbjct: 182 EGTAKAMFYVTNLFMKYAPIGVFALIGVTISKYGFASLIPLGKLALTVYGAMIFFVLVVL 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           GI+A+   FSI KL+  +KEE++L  ST+SSE+ LP +M KME+AG  + I S V+PTGY
Sbjct: 242 GIMAKVVGFSIFKLLKMIKEELILAFSTASSETVLPRIMDKMEKAGSPKHISSFVIPTGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDGS +Y  +A+LFI+Q   + LS+  Q++L+L+ MV+SKG AGV G +F+ L AT 
Sbjct: 302 SFNLDGSVLYQAIASLFIAQMFGIELSIGQQITLMLVLMVTSKGMAGVPGVSFVVLLATF 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDP 416
           + +  LP  G+  I G+DR +   R+  N +GN++  +V+++WE + +P
Sbjct: 362 STI-GLPAEGLAFIAGIDRILDMGRTAVNVVGNSLAAIVIAKWEGQFNP 409


>gi|253687787|ref|YP_003016977.1| sodium:dicarboxylate symporter [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754365|gb|ACT12441.1| sodium:dicarboxylate symporter [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 438

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 150/418 (35%), Positives = 247/418 (59%), Gaps = 14/418 (3%)

Query: 18  ILYIQVLVAIFSGMALGHFVPQ--------IGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            L  Q+L+A+  G+ALG  + +        I   + P GDIF++  KM++ P++  T+  
Sbjct: 7   SLAWQILIALVLGIALGAVLHEQQESRQWLISNILSPAGDIFIRLIKMIVVPIVIATLIV 66

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL----NTE 125
           GIA + D K +G+I +K +  F + +  A+++G+ + NI +PG G+++   +       +
Sbjct: 67  GIAGVGDAKKLGRIGFKTILYFEIITTVAIILGITLANIFQPGHGIDMSTLTAVDISQYQ 126

Query: 126 SIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEKSDTIR 184
                  S + S +G +  +IP    +A+T G++L  +  ++LFG+   SL  E  D + 
Sbjct: 127 KTTEQVQSGSHSLVGTVLSLIPPNIFAAMTHGDMLPIIFFSVLFGLGLSSLPKEHRDPLL 186

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
                ++  +F++  ++MR AP+G F  +S T+  +G +S+  L  LV  +YA   FF L
Sbjct: 187 NVFRGVSETMFKVTHMIMRYAPVGVFALISVTVANFGFASLWPLAKLVMLVYAAIFFFAL 246

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            VLGI+AR C+  I  LI  LK+E++L  ST+SSE+ LP +++KME  G  +SI S VVP
Sbjct: 247 VVLGIVARLCKLRITMLIRILKDELILAYSTASSETVLPRIIEKMEAYGAPKSITSFVVP 306

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDGS +Y ++A +FI+Q   + LS+  ++ L+L  M++SKG AGV G +F+ L 
Sbjct: 307 TGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQEIVLVLTLMLTSKGIAGVPGVSFVVLL 366

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
           AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+++WE + D K    Y
Sbjct: 367 ATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHQFDEKKAQAY 423


>gi|291615687|ref|YP_003518429.1| DctA [Pantoea ananatis LMG 20103]
 gi|291150717|gb|ADD75301.1| DctA [Pantoea ananatis LMG 20103]
          Length = 470

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 212/421 (50%), Positives = 300/421 (71%), Gaps = 2/421 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           V G +   L+K LY QVLVAI  G+ +GHF P +G QM+PLGD FVK  KM+I PVIF T
Sbjct: 38  VSGYLFMKLFKSLYFQVLVAIAIGVLMGHFYPDLGTQMKPLGDGFVKLIKMIIAPVIFCT 97

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V TGIA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMNVD  +L+ ++
Sbjct: 98  VVTGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIVVNVVQPGVGMNVDPATLDAKA 157

Query: 127 IA-HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           +A + + +  +  + F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G     I  
Sbjct: 158 VAIYAQQAEQQGIVAFLLDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGNTGTLIFN 217

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            +E  +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ 
Sbjct: 218 VIESFSKVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVV 277

Query: 246 VLGILAR-FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
           VLG++AR F  FSI K I ++KEE+L+VL TSSSESALP ++ KME  GC +S+V +V+P
Sbjct: 278 VLGLIARVFGGFSIFKFIAYIKEELLIVLGTSSSESALPRMLDKMERLGCKKSVVGLVIP 337

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
           TGYSFNLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LA
Sbjct: 338 TGYSFNLDGTSIYLTMAAVFIAQATNAHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLA 397

Query: 365 ATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           AT++ V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W  +LD K     + 
Sbjct: 398 ATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVDQLDKKQLGDTLA 457

Query: 425 I 425
            
Sbjct: 458 G 458


>gi|16766900|ref|NP_462515.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62182118|ref|YP_218535.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161616673|ref|YP_001590638.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549159|ref|ZP_02342918.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167990838|ref|ZP_02571937.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232449|ref|ZP_02657507.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168235216|ref|ZP_02660274.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168241776|ref|ZP_02666708.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168260649|ref|ZP_02682622.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465097|ref|ZP_02698989.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|194444654|ref|YP_002042861.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194448617|ref|YP_002047642.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194471600|ref|ZP_03077584.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194735283|ref|YP_002116551.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197248968|ref|YP_002148542.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197261730|ref|ZP_03161804.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198246012|ref|YP_002217574.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200387226|ref|ZP_03213838.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204928824|ref|ZP_03220023.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|207858852|ref|YP_002245503.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|238910358|ref|ZP_04654195.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|1706335|sp|P50334|DCTA_SALTY RecName: Full=Aerobic C4-dicarboxylate transport protein
 gi|75480043|sp|Q57IK8|DCTA_SALCH RecName: Full=C4-dicarboxylate transport protein
 gi|189082867|sp|A9MUP5|DCTA_SALPB RecName: Full=C4-dicarboxylate transport protein
 gi|226723844|sp|B5F9I1|DCTA_SALA4 RecName: Full=C4-dicarboxylate transport protein
 gi|226723846|sp|B5FKN5|DCTA_SALDC RecName: Full=C4-dicarboxylate transport protein
 gi|226723847|sp|B5R415|DCTA_SALEP RecName: Full=C4-dicarboxylate transport protein
 gi|226723849|sp|B4T8F0|DCTA_SALHS RecName: Full=C4-dicarboxylate transport protein
 gi|226723850|sp|B4SWG1|DCTA_SALNS RecName: Full=C4-dicarboxylate transport protein
 gi|226723852|sp|B4TZ13|DCTA_SALSV RecName: Full=C4-dicarboxylate transport protein
 gi|993024|emb|CAA62742.1| DctA [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16422177|gb|AAL22474.1| DAACS family C4-dicarboxylic acids transport protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|62129751|gb|AAX67454.1| DAACS family, C4-dicarboxylic acids transport protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161366037|gb|ABX69805.1| hypothetical protein SPAB_04490 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403317|gb|ACF63539.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194406921|gb|ACF67140.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194457964|gb|EDX46803.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710785|gb|ACF90006.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195632328|gb|EDX50812.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197212671|gb|ACH50068.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197239985|gb|EDY22605.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197291467|gb|EDY30819.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197940528|gb|ACH77861.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199604324|gb|EDZ02869.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204322257|gb|EDZ07455.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205325714|gb|EDZ13553.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205330684|gb|EDZ17448.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333307|gb|EDZ20071.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205338767|gb|EDZ25531.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205350499|gb|EDZ37130.1| aerobic C4-dicarboxylate transport protein [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206710655|emb|CAR35013.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248767|emb|CBG26617.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995854|gb|ACY90739.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160153|emb|CBW19673.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914638|dbj|BAJ38612.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226666|gb|EFX51716.1| Aerobic C4-dicarboxylate transporter for fumarate, L-malate,
           D-malate, succunate [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613993|gb|EFY10929.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322617885|gb|EFY14778.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625500|gb|EFY22326.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629965|gb|EFY26738.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632146|gb|EFY28897.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636504|gb|EFY33211.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643138|gb|EFY39712.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644641|gb|EFY41177.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322651335|gb|EFY47719.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652749|gb|EFY49088.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659050|gb|EFY55302.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663248|gb|EFY59452.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668734|gb|EFY64887.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674462|gb|EFY70555.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678331|gb|EFY74392.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682411|gb|EFY78432.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322684125|gb|EFY80131.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716607|gb|EFZ08178.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323131974|gb|ADX19404.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323192319|gb|EFZ77551.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196253|gb|EFZ81405.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201401|gb|EFZ86467.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206489|gb|EFZ91450.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212081|gb|EFZ96908.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216986|gb|EGA01709.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220351|gb|EGA04805.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224398|gb|EGA08687.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228328|gb|EGA12459.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233405|gb|EGA17498.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237134|gb|EGA21201.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243651|gb|EGA27667.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323246105|gb|EGA30092.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250885|gb|EGA34763.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257622|gb|EGA41308.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261829|gb|EGA45396.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266114|gb|EGA49605.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268658|gb|EGA52125.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625357|gb|EGE31702.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|332990465|gb|AEF09448.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 428

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A  
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAQAVAVY 120

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            +    +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AAQAKEQGIIAFLMDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVTGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD +  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHQKLDDVLN 415


>gi|319941269|ref|ZP_08015600.1| C4-dicarboxylate transporter [Sutterella wadsworthensis 3_1_45B]
 gi|319805190|gb|EFW02013.1| C4-dicarboxylate transporter [Sutterella wadsworthensis 3_1_45B]
          Length = 445

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 191/414 (46%), Positives = 287/414 (69%), Gaps = 1/414 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P+YK+LY QV+ AI  G+ LG   P++G +M+P GD F++  KM+I PVIF TV TGI
Sbjct: 9   KTPIYKVLYFQVICAIVIGIVLGAVWPEVGEKMKPFGDGFIRLIKMIIAPVIFCTVVTGI 68

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M++MK +G+    A+  F V S  AL+IGL++ N+ +PG GM+VD  +L+  ++ A+ 
Sbjct: 69  AGMENMKKVGKTGGLALLYFEVVSTIALIIGLVIVNVVEPGSGMHVDPATLDQSAVSAYT 128

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
                ++   F+ ++IP T + A   G+ILQ L  ++LFG +L   G +   +   +E+ 
Sbjct: 129 GPGKMQTTTQFLMNVIPSTVVGAFAQGDILQVLFFSILFGFALHKFGGRGTLVFDLIEKS 188

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
           +  +F++V ++MR+AP+GAFGAM+FTIGKYG++S+  L  L+   YAT   FI  VLG +
Sbjct: 189 SQILFQIVGMIMRVAPIGAFGAMAFTIGKYGIASLLPLAKLMGTFYATCLLFIFIVLGAI 248

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R   FS+++ I ++KEE+L+VL TSSSES LP +M KME AG  RS+V +V+PTGYSFN
Sbjct: 249 CRIHGFSVMRYIAYIKEELLIVLGTSSSESVLPRMMTKMERAGVSRSVVGLVIPTGYSFN 308

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+ IY+T+A +FI+QA +V +++  Q++LL + +++SKGAAGVTGS FI LAAT++ V
Sbjct: 309 LDGTAIYLTMAAVFIAQACDVNMTIMQQVTLLAVLLLTSKGAAGVTGSGFIVLAATLSAV 368

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
             +P+AG+ LILG+DRFMSE R++TN IGN +  VVV  W  ++  +  + Y+ 
Sbjct: 369 GHVPVAGLALILGIDRFMSEARALTNMIGNGIACVVVGHWCGEVKNEALHMYLS 422


>gi|228984611|ref|ZP_04144786.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228775138|gb|EEM23529.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 423

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 138/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTILYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIVKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLGI A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGITAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDDEKGQAYL 414


>gi|271502562|ref|YP_003335588.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech586]
 gi|270346117|gb|ACZ78882.1| sodium:dicarboxylate symporter [Dickeya dadantii Ech586]
          Length = 428

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 212/416 (50%), Positives = 299/416 (71%), Gaps = 1/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  ++K LY QVL AI  G+ LGHF P +G QMQPLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKSIFKSLYFQVLTAITIGILLGHFYPALGQQMQPLGDGFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F V S  AL+IGL+V N+ +PG GMNVD  SLN  ++A +
Sbjct: 61  IAGMESMKAVGRTGAAALLYFEVVSTLALIIGLVVVNVLQPGAGMNVDPSSLNAAAVANY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
              +  +  + F+ D+IP + + A  SGNILQ L+ A++FG +L  +G+K   I   ++ 
Sbjct: 121 ATEAGKQGVVPFLMDIIPSSVIGAFASGNILQVLLFAVMFGFALHHLGDKGVLIFDVIDS 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLIQLGQLIICFYITCILFVVLVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP +++KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLEKMEKLGCKKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           V  LPIAG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD K  +  +  
Sbjct: 361 VGHLPIAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDSKQMSDVLSG 416


>gi|300933651|ref|ZP_07148907.1| putative Na+/H+-dicarboxylate symporter [Corynebacterium resistens
           DSM 45100]
          Length = 507

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 165/415 (39%), Positives = 257/415 (61%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +      LYI V++A+  G+ LG   P     ++PLG  FV   KM+I PVIF T+  GI
Sbjct: 21  KKDNTHWLYIAVIIAVIGGIVLGLVAPDTAKALKPLGSTFVDIIKMIIPPVIFCTIVLGI 80

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
             ++    +G+    A+  F   S FAL IGL VGNI +PG G+++   +   +      
Sbjct: 81  GSVRAAASVGKAGGIALAYFITMSTFALAIGLAVGNIIQPGEGLDIHANAKAVQDALDKN 140

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +      +GF+Q ++PDT  SA TSG++LQ L++ALL G ++  +G+  + I   +  + 
Sbjct: 141 AEQPHGLMGFIQSIVPDTFFSAFTSGSVLQVLVIALLVGFAIQSMGKAGEPILGFVAHLQ 200

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL-GIL 250
             VF+++  ++ +AP+GAFGA++  +G  G+ ++  L  L+   Y T   FI  +L  IL
Sbjct: 201 KLVFKILGWILWLAPIGAFGAIAAVVGATGVKAVVQLGVLMLAFYLTCLIFIFVILGTIL 260

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
             F  F+I KL+ +L +E LL+ +TSSSESALP LM+KME  G  +S V +VVPTGYSFN
Sbjct: 261 KVFTGFNIFKLVKYLGKEFLLIFATSSSESALPNLMRKMEHIGVDKSTVGIVVPTGYSFN 320

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+ IY+T+A++F++ A   P+S+ +Q+SLL+  +++SKGAAGVTG+   TLAA +   
Sbjct: 321 LDGTAIYLTMASIFVADAMGKPMSVGEQISLLVFMIIASKGAAGVTGAGIATLAAGLQSH 380

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
               + G+ +I+G+DRFMSE R++TNF GN+V T++V  W K +D +  ++ +  
Sbjct: 381 RPDLLDGVGVIVGIDRFMSEARALTNFAGNSVATLLVGTWTKTIDKEQVHRVLDG 435


>gi|186474994|ref|YP_001856464.1| C4-dicarboxylate transporter DctA [Burkholderia phymatum STM815]
 gi|226723828|sp|B2JC54|DCTA_BURP8 RecName: Full=C4-dicarboxylate transport protein
 gi|184191453|gb|ACC69418.1| sodium:dicarboxylate symporter [Burkholderia phymatum STM815]
          Length = 426

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 213/417 (51%), Positives = 309/417 (74%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P+YK+LY+QV+VAI  G+ALGHF P +   M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 1   MKKPIYKVLYVQVIVAIIIGIALGHFYPALATDMKPLGDAFIKLIKMVIGPIIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FAL++GL   ++ +PG+G NVD  +LN + +A  
Sbjct: 61  IAGMEDMKKVGRVGGKALLYFEIVSTFALILGLAATHLLRPGVGFNVDPATLNGKEVASY 120

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H ++ + F+  +IPDT +SA + G ILQ L++ALLFG  L+ VGE+   +   +E 
Sbjct: 121 AAKAHGQTTVDFLMHIIPDTLVSAFSQGEILQILLIALLFGAVLAHVGERGKPVTNFIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F MV I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ L+   Y TS  F++ VLG 
Sbjct: 181 LSSILFGMVGIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGF 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   F+I++ + ++KEE+L+VL TSSSE+ALP LM K+E+ GC RS+V +VVPTGYSF
Sbjct: 241 IAKMVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  L+   QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 301 NLDGTNIYMTMAVLFIAQATNTDLTWGQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD       +  +
Sbjct: 361 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRSKLRAALSRD 417


>gi|229069084|ref|ZP_04202376.1| Proton glutamate symport protein [Bacillus cereus F65185]
 gi|228714029|gb|EEL65912.1| Proton glutamate symport protein [Bacillus cereus F65185]
          Length = 424

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 138/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAVFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTILYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A LF++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAALFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|323524613|ref|YP_004226766.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1001]
 gi|323381615|gb|ADX53706.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1001]
          Length = 443

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 217/417 (52%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P++K+LY+QV+VAI  G+ALGHF P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 18  VKKPIHKVLYVQVIVAIIIGIALGHFYPNLAVDMKPLGDAFIKLIKMVIGPIIFCTVVTG 77

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F + S FALV+GL   ++ +PG+G NVD  +LN + +A  
Sbjct: 78  IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLAATHLLRPGVGFNVDPSTLNGKEVASY 137

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H ++ + F+  +IPDT +SA + G ILQ L++ALLFG  L+ +GE+   +   +E 
Sbjct: 138 AAKAHGQTTVDFLMHIIPDTLVSAFSQGEILQILLIALLFGAVLAHIGERGKPVTTFIES 197

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F MV I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ L+   Y TS  F++ VLGI
Sbjct: 198 LSSILFGMVGIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGI 257

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F+I++ + ++KEE+L+VL TSSSE+ALP LM K+E+ GC RS+V +VVPTGYSF
Sbjct: 258 IARAVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSF 317

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  L+ T QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 318 NLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 377

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    N  +  +
Sbjct: 378 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLNAALRGD 434


>gi|37527090|ref|NP_930434.1| C4-dicarboxylate transporter DctA [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81572429|sp|Q7N283|DCTA_PHOLL RecName: Full=C4-dicarboxylate transport protein
 gi|36786523|emb|CAE15579.1| C4-dicarboxylate transport protein [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 417

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 207/415 (49%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L K LY QVL+AI  G+ LGHF P++G +M+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKNLLKSLYFQVLLAITIGILLGHFYPELGTEMKPLGDGFVKLIKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG GMN+D  +L+ ++++ +
Sbjct: 61  IAGMESMKAVGKTGAIALVYFEIVSTIALIIGLIVVNVMQPGAGMNIDPSTLDVKAVSLY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +GEK   I   ++ 
Sbjct: 121 AEKAAEQGIIAFLLDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGEKGKPIFNIIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSHVIFGIINMIMRLAPLGAFGAMAFTIGKYGIGTLVQLGQLIVCFYITCILFVIFVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+   FSI + I ++KEE+L+VL TSSSESALP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IAKATGFSIFRFINYIKEELLIVLGTSSSESALPRMLDKMEKAGCQKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIVHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV++  ++LD    N+ + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLIGNGVATIVVAKRCRQLDEGKLNEVLN 415


>gi|71901156|ref|ZP_00683261.1| Sodium:dicarboxylate symporter [Xylella fastidiosa Ann-1]
 gi|71729078|gb|EAO31204.1| Sodium:dicarboxylate symporter [Xylella fastidiosa Ann-1]
          Length = 449

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 227/413 (54%), Positives = 304/413 (73%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y  LY  V++AI  G  LGH  P +G Q++PLGD F+K  KM+I+PVIFLT+ TGIA 
Sbjct: 18  PFYLQLYFWVIIAIILGALLGHCYPAVGQQLKPLGDAFIKLVKMIISPVIFLTIVTGIAS 77

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           +  +  + ++F KAM  F  FS  AL++GL+V ++  PG GMN++   L+   IA +++ 
Sbjct: 78  VAHVGTVARVFGKAMVYFLFFSTLALLLGLVVAHVVHPGAGMNINPVDLHQGEIANYVEK 137

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  + +GF+ D+IP T LS     NILQ L VA+LFGI+L+L GE+   +   L+ +  
Sbjct: 138 SHDLTLVGFLMDIIPKTLLSPFVGDNILQVLFVAVLFGIALALAGERGKPVLNLLDALTV 197

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V ++M++AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F+L +LG ++ 
Sbjct: 198 PVFKLVQMLMKMAPIGAFGAIAFTIGKYGVDSLVNLGWLVGSFYLTSLLFVLVILGAVSW 257

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
            C FSI+KLI +LK E+LLVL TSSSESALP LM+KM +AGC +S+V +VVPTGYSFNLD
Sbjct: 258 LCGFSILKLIRYLKAELLLVLGTSSSESALPSLMEKMVQAGCRKSVVGLVVPTGYSFNLD 317

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN  L+   QL+L L+AM+SSKGAAGV+G+ FITLAAT+ +VP 
Sbjct: 318 GTNIYMTLAALFIAQATNTELTPAHQLALFLVAMLSSKGAAGVSGAGFITLAATLAVVPE 377

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +PIAGM LILGVDRFMSECRS+TNFIGNAV T+VVSRWE  L+ +     +  
Sbjct: 378 VPIAGMALILGVDRFMSECRSLTNFIGNAVATLVVSRWENALNYEQLKIALDG 430


>gi|307728323|ref|YP_003905547.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1003]
 gi|307582858|gb|ADN56256.1| sodium:dicarboxylate symporter [Burkholderia sp. CCGE1003]
          Length = 443

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 215/417 (51%), Positives = 313/417 (75%), Gaps = 1/417 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++ P++K+LY+QV+VAI  G+ALGH+ P + V M+PLGD F+K  KM+I P+IF TV TG
Sbjct: 18  VKKPIHKVLYVQVIVAIIIGIALGHYYPTLAVDMKPLGDAFIKLIKMVIGPIIFCTVVTG 77

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+DMK +G++  KA+  F V S FAL++GL   ++ +PG+G NVD  +LN + +A  
Sbjct: 78  IAGMEDMKKVGRVGGKALLYFEVVSTFALLLGLAATHLLRPGVGFNVDPATLNGKEVASY 137

Query: 131 KS-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +H ++ + F+  +IPDT +SA + G ILQ L++ALLFG  L+ VG++   +   +E 
Sbjct: 138 AAKAHGQTTVDFLMHIIPDTLVSAFSQGEILQILLIALLFGAVLAHVGDRGKPVTSFIES 197

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F MV I+ ++AP+GAFGAM+FTIGKYG+ S+  ++ L+   Y TS  F++ VLG+
Sbjct: 198 LSSILFGMVGIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGL 257

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   F++++ I ++KEE+L+VL TSSSE+ALP LM K+E+ GC RS+V +VVPTGYSF
Sbjct: 258 IARAVGFNVLRFIAYIKEEMLIVLGTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSF 317

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+NIY+T+A LFI+QATN  L+ T QL+LL + M++SKGA+GVTG+ FITLAAT+ +
Sbjct: 318 NLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV 377

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE 426
           VP++P++GM LILG+DRFMSECR++TN +GN V TVVVS WEK+LD    N  +  +
Sbjct: 378 VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRSKLNAALRGD 434


>gi|20138046|sp|Q9PEQ2|DCTA_XYLFA RecName: Full=C4-dicarboxylate transport protein
          Length = 449

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 227/413 (54%), Positives = 306/413 (74%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
           P Y  LY  V++AI  G  LGH  P +G Q++PLGD F+K  KM+I+PVIFLT+ TGIA 
Sbjct: 18  PFYLQLYFWVIIAIILGALLGHCYPVVGQQLKPLGDAFIKLVKMIISPVIFLTIVTGIAS 77

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HIKS 132
           +  +  + ++F KAM  F  FS  AL++GL+V ++  PG+GMN++   L+   IA +++ 
Sbjct: 78  VAHVGTVARVFGKAMVYFLFFSTLALLLGLVVAHVVHPGVGMNINPADLHQGEIASYVEK 137

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           SH  + +GF+ D+IP T LS     NILQ L VA+LFGI+L+L GE+   +   L+ +  
Sbjct: 138 SHDLTLVGFLMDIIPKTLLSPFVGDNILQVLFVAVLFGIALALAGERGKPVLNLLDALTL 197

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
           PVF++V ++M++AP+GAFGA++FTIGKYG+ S+ NL +LV   Y TS  F+L +LG ++ 
Sbjct: 198 PVFKLVQMLMKMAPIGAFGAIAFTIGKYGVDSLVNLGWLVGSFYLTSLLFVLVILGAVSW 257

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           F  FSI+KLI +LK E+LLVL TSSSE+ALP LM+KM +AGC +S+V +VVPTGYSFNLD
Sbjct: 258 FSGFSILKLIRYLKSELLLVLGTSSSEAALPSLMEKMVQAGCKKSVVGLVVPTGYSFNLD 317

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QATN  L+   QL+L L+AM+SSKGAAGV+G+ FITLAAT+T+VP 
Sbjct: 318 GTNIYMTLAALFIAQATNTELTPAHQLALFLVAMLSSKGAAGVSGAGFITLAATLTVVPE 377

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +PIAGM LILGVDRFMSECRS+TNFIGNAV T+VVSRWE  L+ +     +  
Sbjct: 378 VPIAGMALILGVDRFMSECRSLTNFIGNAVATLVVSRWENALNHEQLKIALDG 430


>gi|299069386|emb|CBJ40652.1| C4-dicarboxylate transport protein 3 [Ralstonia solanacearum CMR15]
          Length = 448

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 194/418 (46%), Positives = 288/418 (68%), Gaps = 3/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            IR  L K LY+QVL+ + +G+ LG   P +G  ++PLGD+F+K  KM+  P+IF TV+ 
Sbjct: 1   MIRKTLGK-LYVQVLIGVAAGIVLGVAAPNLGSDLKPLGDVFIKLIKMVFAPIIFATVTL 59

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIARM++MK +G++  +A+  F V S FAL +GLIV N+ +PG GMNVD   L+T++IA 
Sbjct: 60  GIARMENMKELGRVGVRALVYFEVLSTFALALGLIVVNLVQPGQGMNVDAAHLDTQAIAS 119

Query: 130 IK--SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
               ++  ++F+ F+  ++P + + AL   +ILQ L+ A LFGI+LS +G ++  +   L
Sbjct: 120 YTHAAAKPQTFVDFLLSLVPSSIIDALARNDILQILVFATLFGIALSRMGTRARPVVDFL 179

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           +     VF +V ++MR+AP+ AFGAM+FT+GKYGL SI+ L  L+  +Y T   F+  VL
Sbjct: 180 DVFTQGVFSIVGMIMRLAPIAAFGAMAFTVGKYGLGSIAALGKLMATMYLTCVLFVAIVL 239

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +AR   FS+ K + ++++E+  VL TSSSES +P LM+K+E AG  + +V +VVP G 
Sbjct: 240 GGVARLAGFSLWKFLRYIRDEIFTVLGTSSSESVVPQLMRKLESAGVSKPVVGLVVPAGL 299

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FN DG  IY T+A LF++QATN PL+LTDQL +L + +++SKG+AGVTGS FITLAAT+
Sbjct: 300 TFNPDGQCIYYTMAALFVAQATNTPLTLTDQLVVLGVLLLTSKGSAGVTGSGFITLAATL 359

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
             +  +P+AGM L+LG+DRFMSE R++TN IGNAV T+ ++RW   +D +     +  
Sbjct: 360 ASLGKIPVAGMVLLLGIDRFMSEARAITNTIGNAVGTLAIARWVGAVDREQLQAALDG 417


>gi|307543700|ref|YP_003896179.1| sodium:dicarboxylate symporter [Halomonas elongata DSM 2581]
 gi|307215724|emb|CBV40994.1| sodium:dicarboxylate symporter [Halomonas elongata DSM 2581]
          Length = 418

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 122/415 (29%), Positives = 223/415 (53%), Gaps = 12/415 (2%)

Query: 12  RPPLYKI--LYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
           RP L++   L+ ++L  +  G+  G  + +     +PLGDIF+   KMLI P++F T+  
Sbjct: 9   RPNLWQRIPLWQKILAGLVLGVLAGALMGERASLFKPLGDIFINAIKMLIVPLVFSTLVV 68

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GI  M+D + +G+I  + + L+ + + FA+ IGL+   I +PG+G       L+    + 
Sbjct: 69  GITAMRDPQKMGRIGLRTIALYLLTTAFAIAIGLLASWIFQPGVG-------LDMTFDSS 121

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           ++   A + +  +  ++P   + AL +GNILQ ++ A+  GISL+L+GEK + + K  E 
Sbjct: 122 VEPKEAPTLVEILVGLVPQNPIDALANGNILQIIVFAIGLGISLTLIGEKGEPVVKVFES 181

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLG- 248
               + ++ +IVM  AP G FG ++   G YGL  +  L  ++   Y  S   +L V   
Sbjct: 182 FAEAMVKLTNIVMSFAPFGVFGLIAHVAGSYGLEVLLPLAKVIGVAYLASVLHVLLVYSG 241

Query: 249 ILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEA-GCHRSIVSMVVPTGY 307
           +LA   R + ++ +  + + +++  S++SS   LP  ++      G    +   V+P G 
Sbjct: 242 LLALLGRLNPLRYLQGILDALVVAYSSASSSGTLPVSLRCARNNLGVSEGVAGFVLPVGA 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           + N+DG+ IY  +  +FI+Q   V LS+TD   ++L   ++S G AGV G+  + L+  +
Sbjct: 302 TINMDGTAIYQGVVAVFIAQLLGVDLSMTDYGMIILTGTLASIGTAGVPGAGLVMLSIVM 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
             +  LP+  + +I G+DR +   R+  N  G+ ++T +V + E +LD  ++N  
Sbjct: 362 AQI-GLPLEAIAVIAGIDRILDMARTCVNVAGDLMVTTLVGKSEGELDEDVYNAK 415


>gi|226225442|ref|YP_002759548.1| C4-dicarboxylate transport protein [Gemmatimonas aurantiaca T-27]
 gi|226088633|dbj|BAH37078.1| C4-dicarboxylate transport protein [Gemmatimonas aurantiaca T-27]
          Length = 421

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 174/408 (42%), Positives = 269/408 (65%), Gaps = 1/408 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +   L + L  QVLVA+  G+ +G   P  G  ++P+GD F+   KM+ITP+IFLT+  G
Sbjct: 1   MLSRLARNLTFQVLVAVTIGVLIGVVAPDTGKALKPIGDTFINLVKMVITPIIFLTIVHG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M D++ +G++  KA+  F + S  AL IGL++ N+ KPG G+++       +   + 
Sbjct: 61  IASMADLRKLGRVGGKALLYFEIVSTLALAIGLVIVNVTKPGAGLDIS-AMATGDVSKYT 119

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
            +   +S + F+  ++P   ++A  SG +L  +  ++LFG++L+ VG+    +   L  +
Sbjct: 120 TAGQEQSMLEFLLHIVPSNVVAAFASGELLPVVFFSVLFGVALTAVGDAGRDLIDLLVRL 179

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
               FR+V IVM++APLGA GAM++T+G +GL ++  L  L+  +YAT A FI  VL ++
Sbjct: 180 QAVFFRIVHIVMKVAPLGALGAMAYTVGAFGLKTLLPLGRLMLDVYATMAVFIFVVLALI 239

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
            R   F +   + +++EE+LLVL TSSSE+ALP +++K+E  GC R +V +V+PTGYSFN
Sbjct: 240 CRAFGFRLWPFLRYIREEILLVLGTSSSEAALPRMLEKLERYGCARPVVGLVIPTGYSFN 299

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG++IY+++A +FI+Q   + LS+ +QL+LL I M++SKGAAGVTGS FI LA+T+   
Sbjct: 300 LDGTSIYLSMAAIFIAQVYGIDLSVGEQLTLLGILMLTSKGAAGVTGSGFIVLASTLAAT 359

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKL 418
            ++P+ G+ L+LGVDRFMSE R++TN IGN V T+VVSR E   D   
Sbjct: 360 RTVPVEGVALLLGVDRFMSEARAITNLIGNGVATLVVSRSEGAFDDTK 407


>gi|197104506|ref|YP_002129883.1| C4-dicarboxylate transport protein [Phenylobacterium zucineum HLK1]
 gi|196477926|gb|ACG77454.1| C4-dicarboxylate transport protein [Phenylobacterium zucineum HLK1]
          Length = 444

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 230/415 (55%), Positives = 305/415 (73%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R P++  LY+QVLVAI  G A+GHF P+ G  ++PLGD F+K  KM+I PVIFLTV+TGI
Sbjct: 15  RTPIWNQLYVQVLVAIAVGGAIGHFWPETGEALKPLGDAFIKLVKMIIAPVIFLTVTTGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESI-AHI 130
           A M+D+  +G +  KA   F V S FALV+GL+V N+ +PG GMNVD  +L+  ++  + 
Sbjct: 75  AGMRDIGKVGGVAAKAFGYFIVVSSFALVVGLVVANVVQPGAGMNVDPATLDAGAVQDYA 134

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
             SH  +  GF+ D+IP T   A  SGNILQ L  ++ FG++L+++GE+ +     L  +
Sbjct: 135 AKSHEMTITGFLMDIIPATVAGAFVSGNILQVLFFSIPFGLALAMIGERGEPALAVLNAV 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
               FR+V+I MR AP+GA GA +FT+G+YGL SI NL  LV   YATS  F+L VLG +
Sbjct: 195 AEAFFRLVAIFMRAAPIGALGAFAFTVGRYGLESIVNLAALVGTFYATSLIFVLVVLGAI 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FSI++LI +LKEE+LLVL TSSSE+ALP L++KME AG  +++V +VVPTGYSFN
Sbjct: 255 ARLHGFSILRLIRYLKEELLLVLGTSSSEAALPSLLEKMERAGAPKTVVGLVVPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+QA  + L L +QL LL +AM+SSKGAAGVTG+ FITLAAT+++V
Sbjct: 315 LDGTNIYMTLAALFIAQAVGIDLPLGEQLLLLAVAMLSSKGAAGVTGAGFITLAATLSVV 374

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILGVDRFMSECR++TNF+GNAV T+VVSRWE +LD +     +  
Sbjct: 375 PSVPVAGMALILGVDRFMSECRALTNFVGNAVATLVVSRWEGQLDRQALEDALSG 429


>gi|327438132|dbj|BAK14497.1| Na+/H+-dicarboxylate symporters [Solibacillus silvestris StLB046]
          Length = 421

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 144/415 (34%), Positives = 248/415 (59%), Gaps = 6/415 (1%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
                 L  Q+L+ +  G+ +G        +   +QPLGDIF+   KM++ P+I  T+  
Sbjct: 2   KKFKISLAAQILIGLVLGVIVGAVFFGNENVQSYLQPLGDIFLNLIKMIVVPIIISTLIV 61

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVD--LKSLNTESI 127
           G+A   D+K +G++  K +  F V +  A+ +GL+  N+ +PG G++++   KS  +  +
Sbjct: 62  GVAGTGDIKQLGRLGGKTLIYFEVITTVAIAVGLLAANLFQPGAGIDMNELQKSDISSYV 121

Query: 128 AHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
              ++   K     + D++P   ++A+  G++L  +  +++FG+ ++ +GE+   +    
Sbjct: 122 ETTEAEEDKGTFQIIVDIVPKNIINAMAEGDMLAIIFFSVIFGLGVAAIGERGKPVLAFF 181

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           +     +F + ++VM+ AP+G F  +  T+ K+G+ S+  L  L   +YAT  FF++ VL
Sbjct: 182 QGTADAMFWVTNLVMKFAPVGVFALIGVTVSKFGVESLIPLGKLAILVYATMIFFVVVVL 241

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G+ AR    +I KLI  +K+E+LL  STSSSE+ LP +M K E+ G  + IVS V+PTGY
Sbjct: 242 GLTARIFGINIFKLIRMIKDELLLAFSTSSSETVLPRIMLKTEKMGAPKDIVSFVIPTGY 301

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDGS +Y  +A +FI+Q   + LS+ +Q++L+L+ MV+SKG AGV G +F+ L AT+
Sbjct: 302 SFNLDGSTLYQAIAAIFIAQMYGIDLSIVEQITLMLVLMVTSKGIAGVPGVSFVVLLATL 361

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKY 422
             V  +P+ G+  I G+DR +   R+  N +GN +  +V+++WEK+ D K F +Y
Sbjct: 362 GTV-GIPLEGLAFIAGIDRILDMARTAVNVVGNTLAALVMAKWEKRFDEKQFAEY 415


>gi|310639785|ref|YP_003944543.1| proton/sodium-glutamate/aspartate transport protein gltp
           [Paenibacillus polymyxa SC2]
 gi|309244735|gb|ADO54302.1| Proton/sodium-glutamate/aspartate transport protein GltP
           [Paenibacillus polymyxa SC2]
          Length = 417

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 140/411 (34%), Positives = 249/411 (60%), Gaps = 5/411 (1%)

Query: 18  ILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARM 74
            L +Q+ + +  G+ +G        + V ++P+GDIF++  KM++ P++  T+  G+A +
Sbjct: 5   NLTMQIFIGLALGIIVGALFYGNSGVEVYLKPIGDIFIRLIKMIVVPIVISTLIIGVAGV 64

Query: 75  KDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES-IAHIKSS 133
            DMK +G++  K++  F + +  A++ GL+V N+ +PG G+++   + +           
Sbjct: 65  GDMKKLGKLGGKSILYFEIVTTIAILFGLLVANLVRPGEGVDMSHLAKSDIHSYVETAEK 124

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
              +FI  +  ++P   + AL  G++L  +  ++LFG+ ++ +G K   +    E +   
Sbjct: 125 SGHNFIDTIVHIVPTNVIQALGEGDMLAIIFFSVLFGLGVAAIGNKGKPVLNFFEGVADA 184

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VMR+AP G F  +  T+ K+GL+S+  L+ LV  +Y +   FI+ V GI+A+ 
Sbjct: 185 MFWVTNQVMRLAPFGVFALIGTTVAKFGLASLWPLLKLVLSVYGSMLLFIVIVFGIIAKL 244

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
           C   +  ++  LK E+LL  ST+SSES LP +M+KME+ GC + I S V+P GYSFNLDG
Sbjct: 245 CGTRLWTMVKILKSELLLAYSTASSESVLPKIMEKMEKFGCPKGITSFVIPIGYSFNLDG 304

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA +FI+Q   + + +T Q++L+L+ ++SSKG AGV G++F+ L AT+  V ++
Sbjct: 305 STLYQALAAIFIAQMYGIDMPITTQITLVLVLIISSKGIAGVPGASFVVLLATLGAV-NI 363

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+  I G+DR +   R+V N +GN++  VV+S+WE + D +   +Y+ 
Sbjct: 364 PLEGLAFIAGIDRILDMARTVVNVLGNSLAAVVMSKWEGQYDKEKGEEYVA 414


>gi|167648067|ref|YP_001685730.1| sodium:dicarboxylate symporter [Caulobacter sp. K31]
 gi|167350497|gb|ABZ73232.1| sodium:dicarboxylate symporter [Caulobacter sp. K31]
          Length = 434

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 201/409 (49%), Positives = 290/409 (70%), Gaps = 2/409 (0%)

Query: 17  KILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKD 76
           K LY+QVL+ I  G+ +G   P++GV ++PLGD F+K  K++I PVIFLTV++GIA M D
Sbjct: 8   KTLYVQVLIGIALGVLVGALWPEVGVALKPLGDAFIKLVKLVIAPVIFLTVASGIAHMGD 67

Query: 77  MKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI--KSSH 134
           +K  G++  KA+  F V S  AL +GL+VG+I +PG G N+D  +L+ +  A    K+ H
Sbjct: 68  IKAFGRVGVKALLYFEVVSTLALAVGLVVGHILQPGHGFNIDPATLDPKIAAGYLEKAHH 127

Query: 135 AKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPV 194
            +  + ++  +IPDT   A   GN+LQ L++++L G + + +G   D     + ++    
Sbjct: 128 GEGLVPYLLHLIPDTFFGAFAEGNLLQVLVISVLTGFACTRMGPFGDRAAAAMSDMAKLF 187

Query: 195 FRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFC 254
           F ++ +V+++APLGAFGAM FTIGKYGL+S+  L  LV   Y T+  F+L VLG +A  C
Sbjct: 188 FGIIHVVVKLAPLGAFGAMGFTIGKYGLASLVQLGALVATFYITALLFVLVVLGAIAWAC 247

Query: 255 RFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGS 314
            FSI+K + +++EE+L+VL TSSSESALP L++K+E  G  +S+V +VVPTGYSFNLDG+
Sbjct: 248 GFSILKFLAYIREELLIVLGTSSSESALPQLIEKLERLGARKSVVGLVVPTGYSFNLDGT 307

Query: 315 NIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLP 374
           NIY+TLATLF++QATN  LS     SLL +AM++SKGA+GVTG+ FITLAAT+ +VP +P
Sbjct: 308 NIYMTLATLFLAQATNTHLSWIQMASLLGVAMLTSKGASGVTGAGFITLAATLAVVPDIP 367

Query: 375 IAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           IA + +++GVDRFMSECR++TNF+GN V T+VV+RWE  LD     + +
Sbjct: 368 IAALAVLVGVDRFMSECRALTNFVGNGVATLVVARWEGALDRDRLAREL 416


>gi|205354770|ref|YP_002228571.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|226723848|sp|B5RGR2|DCTA_SALG2 RecName: Full=C4-dicarboxylate transport protein
 gi|205274551|emb|CAR39599.1| C4-dicarboxylate transport protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326629911|gb|EGE36254.1| C4-dicarboxylate transporter DctA [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 428

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 298/415 (71%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L+K LY QVL AI  G+ LGH+ P++G QM+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA M+ MK +G+    A+  F + S  AL+IGLI+ N+ +PG GMNVD  +L+ +++A  
Sbjct: 61  IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAQAVAVY 120

Query: 131 KSS-HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            +    +  I F+ D+IP + + A  SGNILQ L+ A+LFG +L  +G K   I   +E 
Sbjct: 121 AAQAKEQGIIAFLMDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+AP+GAFGAM+FTIGKYG+ S+  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGT 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI K I +++EE+L+VL TSSSESALP ++ KME+ GC +S+V +V+PTGYSF
Sbjct: 241 IARVTGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN +GN V TVVV++W K+LD +  +  + 
Sbjct: 361 VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHQKLDDVLN 415


>gi|229078716|ref|ZP_04211270.1| Proton glutamate symport protein [Bacillus cereus Rock4-2]
 gi|228704589|gb|EEL57021.1| Proton glutamate symport protein [Bacillus cereus Rock4-2]
          Length = 424

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 138/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTILYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A LF++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAALFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|325274216|ref|ZP_08140337.1| sodium:dicarboxylate symporter [Pseudomonas sp. TJI-51]
 gi|324100650|gb|EGB98375.1| sodium:dicarboxylate symporter [Pseudomonas sp. TJI-51]
          Length = 437

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 185/414 (44%), Positives = 280/414 (67%), Gaps = 1/414 (0%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
             L K LY Q+L A+  G+ +GHF  Q  V ++PLGD F+K  KM+I PV+F T+ TGIA
Sbjct: 1   MRLAKSLYFQILCAVLLGVVVGHFWAQQAVALKPLGDAFIKLIKMMIAPVVFCTIVTGIA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            M D + +G++  K + LF   ++ +L+IGL   ++ +PG+GMN+D  +L+T  ++   +
Sbjct: 61  GMTDKRSLGRLMSKTLLLFLGLTVVSLMIGLAAVHLFRPGVGMNIDPATLSTAGLSQYAA 120

Query: 133 SHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           S AK S + F   +IPDT + A   G +L  L +A+L G +LS +GEK   +   LE  +
Sbjct: 121 SAAKLSVVDFFMHIIPDTFIGAFNKGEVLPVLFIAVLSGFALSSMGEKGKPVLNVLESAS 180

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VFR+   +MR AP+GAFGA++FT+G+YG++S+  L  LV  LY   AFF+L VLG + 
Sbjct: 181 TMVFRIFGYLMRFAPIGAFGALAFTVGQYGVTSLGALAKLVGTLYIACAFFVLVVLGGIC 240

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KL+ + +EE L+VL TSS+E  LP +++K+E+ GC + +V +V+PTGYSFNL
Sbjct: 241 RAYGFSLWKLLRYFREEFLVVLGTSSTEPVLPRMLEKLEKLGCKKGVVGLVLPTGYSFNL 300

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+ IY++LA +FI+QA N+ L+L   +++L I ++SSKGAAGVTGS F+ LA+T+T++ 
Sbjct: 301 DGTAIYLSLAAVFIAQACNIDLTLGQTVTMLAIMLLSSKGAAGVTGSGFVALASTLTVIH 360

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
            +P+AG+ L++G+DRFMSE R++T+   NAV TVV+S  E   D K   + +  
Sbjct: 361 DIPLAGLALLIGIDRFMSEARALTSLASNAVATVVISLSENACDRKTLLRRLNG 414


>gi|108761343|ref|YP_631179.1| sodium:dicarboxylate symporter family protein [Myxococcus xanthus
           DK 1622]
 gi|108465223|gb|ABF90408.1| sodium:dicarboxylate symporter family protein [Myxococcus xanthus
           DK 1622]
          Length = 431

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 201/416 (48%), Positives = 291/416 (69%), Gaps = 2/416 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           +R    K LY+QVL+AI  G+ LG   P +G  M+PLGD F+K  KM+I PVIFLT+  G
Sbjct: 1   MRMRWLKNLYVQVLLAIAVGVILGWLRPDLGESMKPLGDGFIKLVKMIIAPVIFLTIVAG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI 130
           IA+M D+K +G+I  KA+  F V +  ALV+G++V N  KPG GMN+D   ++T  I   
Sbjct: 61  IAKMGDLKHVGRIGLKALIYFEVLTTLALVVGMVVVNTLKPGAGMNIDPAQIDTSGITQY 120

Query: 131 KSSHAK-SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
           ++S ++   I F+ D+IP   LSA T G +LQ L+VA+L G++L+ +G     +    ++
Sbjct: 121 RASASQQGTIPFLLDIIPHDFLSAFTEGKLLQVLLVAVLTGVALTRLGPMGQRVLDLSDD 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           +    F +V ++M++APLGAFGAM+FT+GK+G+ S+S+L  L+  +Y T A F+  VLG+
Sbjct: 181 LAQVFFGIVGMIMKLAPLGAFGAMAFTVGKFGVESLSSLGRLLIAVYVTCALFVFLVLGL 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FS+ KL+ +++ E+LLVL TSSSESALP L+K++E  GC R  V +V+PTGYSF
Sbjct: 241 VARLSGFSLWKLLRYMRSELLLVLGTSSSESALPRLLKRLETLGCDRGAVGLVLPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG+ IY+T+A +FI+QA NV LSL ++L+LL + +++SKGAAGVTGS FITL AT+  
Sbjct: 301 NLDGTCIYLTMAAIFIAQAVNVDLSLGEELTLLGVLLLTSKGAAGVTGSGFITLMATLAA 360

Query: 370 VPS-LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +   +P+ G+ L+LGVDRFMSE R++TN IGN V T+VVS+WE   D  + +  + 
Sbjct: 361 LNGKVPVEGVALLLGVDRFMSEARAITNVIGNTVATLVVSKWEGVRDDTVMHAELD 416


>gi|229074721|ref|ZP_04207742.1| Proton glutamate symport protein [Bacillus cereus Rock4-18]
 gi|229096023|ref|ZP_04226998.1| Proton glutamate symport protein [Bacillus cereus Rock3-29]
 gi|229102135|ref|ZP_04232846.1| Proton glutamate symport protein [Bacillus cereus Rock3-28]
 gi|229114977|ref|ZP_04244389.1| Proton glutamate symport protein [Bacillus cereus Rock1-3]
 gi|228668489|gb|EEL23919.1| Proton glutamate symport protein [Bacillus cereus Rock1-3]
 gi|228681335|gb|EEL35501.1| Proton glutamate symport protein [Bacillus cereus Rock3-28]
 gi|228687408|gb|EEL41311.1| Proton glutamate symport protein [Bacillus cereus Rock3-29]
 gi|228708464|gb|EEL60616.1| Proton glutamate symport protein [Bacillus cereus Rock4-18]
          Length = 424

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 136/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GD+F++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFDNPAVAKYLQPIGDVFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+V+GL++ NI +PG G+++D  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTIIYFEIITTLAIVVGLLIANIFQPGKGVDMDKLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLADGDMLAIIFFSVLFGLGVAAIGERGKPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS++ Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSISQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PAEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|226311111|ref|YP_002771005.1| glutamate-aspartate carrier protein [Brevibacillus brevis NBRC
           100599]
 gi|226094059|dbj|BAH42501.1| glutamate-aspartate carrier protein [Brevibacillus brevis NBRC
           100599]
          Length = 424

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 155/410 (37%), Positives = 251/410 (61%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L +Q++V +  G+ +G      P +   +QP+GDIF++  KM++ P++  T+  G+A + 
Sbjct: 6   LAMQIVVGLILGILVGAIFYGNPAVATYLQPIGDIFLRLIKMIVVPIVVATLIVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMN--VDLKSLNTESIAHIKSS 133
           DMK +G+I  K +  F + +  A++IGL+  NI +PG+G++  V  K+   + +   +++
Sbjct: 66  DMKKLGKIGGKTILYFEIVTTIAIIIGLLAANIFQPGVGVDRTVLTKTDIHKYVDTAEAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            +   +     ++P     +L  G++L  +  ++LFG+ ++  GEK   +      +   
Sbjct: 126 QSHGMVETFVKIVPTNIFDSLARGDMLAIIFFSVLFGLGVAAAGEKGRPVLNFFNGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F +V+ +MR AP G F  +  T+ K+GLSS+  L  LV  ++    FFIL VLGI+AR 
Sbjct: 186 MFWVVNTIMRFAPFGVFALIGVTVSKFGLSSLIPLGKLVILVHVAMVFFILVVLGIIARI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
               I  L+  LK+E+LL  STSSSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 SGIKITSLLRVLKDELLLAYSTSSSETVLPKIMEKMEKMGCPKAIASFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  LA LFI+Q   + + ++ Q++L+L+ MV+SKG AGV G +F+ L AT+  V  L
Sbjct: 306 STLYQALAALFIAQMYGIHMPISTQITLMLVLMVTSKGIAGVPGVSFVVLLATLGSV-GL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P+ G+  I GVDR M   R+V N +GNA+  +V+SRWE + D K  + Y+
Sbjct: 365 PVEGLAFIAGVDRLMDMARTVVNVVGNALAAIVISRWEGQFDKKKADDYV 414


>gi|301053070|ref|YP_003791281.1| proton/sodium-glutamate symport protein [Bacillus anthracis CI]
 gi|300375239|gb|ADK04143.1| proton/sodium-glutamate symport protein [Bacillus cereus biovar
           anthracis str. CI]
          Length = 423

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 138/411 (33%), Positives = 250/411 (60%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTILYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIVKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLGI A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGITAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+ 
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYLE 415


>gi|229084796|ref|ZP_04217055.1| Proton glutamate symport protein [Bacillus cereus Rock3-44]
 gi|228698510|gb|EEL51236.1| Proton glutamate symport protein [Bacillus cereus Rock3-44]
          Length = 423

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 140/411 (34%), Positives = 241/411 (58%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LATQIFVALVLGVVIGAIFYGNKTALSYIAPVGDIFIHLIKMIVVPIVISALVVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  AL++GLI  N+ +PG G+++     +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIALLMGLIAANVFQPGTGVDMSNLQQSDISSYQETADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     +L  G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFAETIVHIVPTNIFESLAQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G    ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVCALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVIVVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  L+  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLMKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LFI+Q   + +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFIAQMYGIHMSLTEQVTLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D     +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSSVNVLGNALAAIVMSKWEGEFDHDKAKQYVE 415


>gi|229059495|ref|ZP_04196877.1| Proton glutamate symport protein [Bacillus cereus AH603]
 gi|228719778|gb|EEL71372.1| Proton glutamate symport protein [Bacillus cereus AH603]
          Length = 423

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 139/411 (33%), Positives = 244/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LATQIFVALVLGIVVGAVFYGNKTAISYITPIGDIFIHLIKMIVVPIVISALIVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  A+++GL+  NI +PG G+++     +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIAILMGLLAANIFQPGTGVDMSNLQQSDISSYKQTADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     ++T G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFAETIVHIVPKNIFESITQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVFALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVVIVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  L+  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLMKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LF++Q   + +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFVAQMYGIHMSLTEQITLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D +   +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSAVNVLGNALAAIVMSKWEGEFDDEKAKQYVE 415


>gi|229057165|ref|ZP_04196555.1| Proton glutamate symport protein [Bacillus cereus AH603]
 gi|228720171|gb|EEL71752.1| Proton glutamate symport protein [Bacillus cereus AH603]
          Length = 424

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 139/410 (33%), Positives = 251/410 (61%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P++   +QPLGDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFGNPEVVKYLQPLGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+V+GL++ NI +PG G+++D  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTIIYFEIITTLAIVVGLLIANIFQPGKGVDMDKLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLAEGDMLAIIFFSVLFGLGVAAIGERGKPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIELSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PAEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|260662472|ref|ZP_05863367.1| proton/sodium-glutamate symporter protein [Lactobacillus fermentum
           28-3-CHN]
 gi|260553163|gb|EEX26106.1| proton/sodium-glutamate symporter protein [Lactobacillus fermentum
           28-3-CHN]
          Length = 430

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 137/415 (33%), Positives = 241/415 (58%), Gaps = 6/415 (1%)

Query: 15  LYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
               L  Q+++ +  G+  G F          M  LG IF++  +M++ P++   ++ GI
Sbjct: 7   FRLSLGWQIVIGLVLGIVCGAFTYHNQGAITIMSNLGTIFLRLIQMIVLPIVVSCLTVGI 66

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAH 129
           A + D+  +G+I  K +  F V +  A+V+GL+VGN+A PG  +N+     +  ++ +  
Sbjct: 67  ANIGDLHKLGRIGGKTIIYFEVLTTIAIVLGLVVGNLAHPGTFINIHDLQGSDISKYMTT 126

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            KS+        +  +IP     +L  G ++  +  ++ FG+ ++ +GE+   +   L  
Sbjct: 127 AKSASHTGIWDTILAIIPTNVFKSLADGEMMPVIFFSVFFGLGIAAIGERGKVLVDVLNG 186

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F++ + VM+ AP+G FG +  T+ + GLS++  L + +   Y T A F + VLGI
Sbjct: 187 VSEVMFKVTNWVMKFAPIGVFGLIGMTVAQMGLSALLPLGYFILIAYVTMAIFCVVVLGI 246

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+       K +  + EE++L  ST+SSE+ LP LM+K ++ G  + I S V+PTGY+F
Sbjct: 247 VAKMFHLHYWKTMRAVFEEIMLAFSTASSEATLPRLMEKTQKMGVDKGIASFVIPTGYTF 306

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDGS IY +LA LF++QA  + L+   Q +LL++ M++SKG AGV G++F+ L A+++ 
Sbjct: 307 NLDGSAIYQSLAALFLAQAYGLHLTWEHQFTLLVVLMITSKGMAGVPGASFVVLLASVST 366

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +  +P+AG+T I G+DRF+   R+  N +GN V T+V+   EK LD   ++ Y+ 
Sbjct: 367 I-GVPVAGLTFIAGIDRFVDMGRTAVNVVGNTVATLVIGESEKSLDQDKYHHYLD 420


>gi|182677182|ref|YP_001831328.1| sodium:dicarboxylate symporter [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633065|gb|ACB93839.1| sodium:dicarboxylate symporter [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 434

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 232/413 (56%), Positives = 317/413 (76%), Gaps = 1/413 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
            LY  LY QVLVAI +G+ +GHF P +G  ++PLGD+F+K  KM+I PVIFLTV+TGIA 
Sbjct: 15  KLYLHLYAQVLVAIAAGILIGHFYPDLGANLKPLGDVFIKLVKMVIAPVIFLTVTTGIAS 74

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK-S 132
           M+D+  +G++  KAM  F  FS FAL IGL+VGNI +PG G+++D  SL+T ++      
Sbjct: 75  MRDLTKVGRVAGKAMVYFLTFSTFALFIGLLVGNILQPGAGLHIDPASLDTRTVNEYAIK 134

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINF 192
           +H ++ IGF+ +++P T +SAL SG+ILQ L  ++LFGI+L+ VG+  D +   L  ++ 
Sbjct: 135 AHDQTVIGFLTNIVPTTPISALASGDILQVLFFSVLFGIALASVGQHGDPVIVVLNALSH 194

Query: 193 PVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILAR 252
            +FR+VSI+M+ AP+GAFGAM+FTIGKYG+ SI+NL  LV   Y T+  F+  +LGI+A 
Sbjct: 195 AMFRLVSILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLVATFYLTAILFVTVILGIVAY 254

Query: 253 FCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLD 312
           +  FSII L+ +LKEE+LLVL TSSSE+ALP LM+KME AGC +S+V +V+P GYSFNLD
Sbjct: 255 YNGFSIIALLRYLKEELLLVLGTSSSEAALPTLMEKMEYAGCSKSVVGLVIPLGYSFNLD 314

Query: 313 GSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPS 372
           G+NIY+TLA LFI+QAT + LSL DQL LLL+AM+SSKGAAG+TG+ FITLAAT+++VP+
Sbjct: 315 GTNIYMTLAALFIAQATGIHLSLWDQLLLLLVAMLSSKGAAGITGAGFITLAATLSVVPA 374

Query: 373 LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           +P+AGM LILG+DRFMSECR++TN IGN+V T+VV+RWE +LD     + +  
Sbjct: 375 VPVAGMALILGIDRFMSECRALTNLIGNSVATIVVARWEGELDDSRLKQALKG 427


>gi|253990486|ref|YP_003041842.1| C4-dicarboxylate transporter DctA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638943|emb|CAR67558.1| c4-dicarboxylate transport protein [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781936|emb|CAQ85100.1| c4-dicarboxylate transport protein [Photorhabdus asymbiotica]
          Length = 417

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 209/415 (50%), Positives = 301/415 (72%), Gaps = 1/415 (0%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTG 70
           ++  L K LY QVLVAI  G+ LGHF P++G +M+PLGD FVK  KM+I PVIF TV TG
Sbjct: 1   MKKNLLKSLYFQVLVAITVGILLGHFYPELGAEMKPLGDGFVKLVKMVIAPVIFCTVVTG 60

Query: 71  IARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-H 129
           IA M+ MK +G+    A+  F + S  AL+IGLIV N+ +PG+GMN+D  +L+ ++++ +
Sbjct: 61  IAGMESMKAVGKTGAIALIYFEIVSTIALIIGLIVVNVMQPGVGMNIDPSTLDAKAVSMY 120

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            + +  +  I F+ D+IP + + A  SGNILQ L+ A+LFG SL  +GEK   I   ++ 
Sbjct: 121 AEKASEQGIIAFLLDVIPHSVIGAFASGNILQVLLFAVLFGFSLHHLGEKGKPIFNIIDG 180

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
            +  +F +++++MR+APLGAFGAM+FTIGKYG+ ++  L  L+ C Y T   F++ VLG 
Sbjct: 181 FSHVIFGIINMIMRLAPLGAFGAMAFTIGKYGIGTLIQLGQLIVCFYITCILFVIFVLGA 240

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +AR   FSI + I ++KEE+L+VL TSSSES LP ++ KME+AGC +S+V +V+PTGYSF
Sbjct: 241 IARATGFSIFRFINYIKEELLIVLGTSSSESVLPRMLDKMEKAGCQKSVVGLVIPTGYSF 300

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDG++IY+T+A +FI+QATN  + +  Q++LL++ ++SSKGAAGVTGS FI LAATI+ 
Sbjct: 301 NLDGTSIYLTMAAVFIAQATNTHMDIVHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA 360

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           V  LP+AG+ LILG+DRFMSE R++TN IGN V T+VV++  ++LD    N+ + 
Sbjct: 361 VGHLPLAGLALILGIDRFMSEARALTNLIGNGVATIVVAKRCRQLDEGKLNQTLN 415


>gi|299783689|gb|ADJ41687.1| Proton/sodium-glutamate symport protein [Lactobacillus fermentum
           CECT 5716]
          Length = 430

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 137/415 (33%), Positives = 241/415 (58%), Gaps = 6/415 (1%)

Query: 15  LYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
               L  Q+++ +  G+  G F          M  LG IF++  +M++ P++   ++ GI
Sbjct: 7   FRLSLGWQIVIGLVLGIVCGAFTYHNQGAITIMSNLGTIFLRLIQMIVLPIVVSCLTVGI 66

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAH 129
           A + D+  +G+I  K +  F V +  A+V+GL+VGN+A PG  +N+     +  ++ +  
Sbjct: 67  ANIGDLHKLGRIGGKTIIYFEVLTTIAIVLGLVVGNLAHPGTFINIHDLQGSDISKYMTT 126

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            KS+        +  +IP     +L  G ++  +  ++ FG+ ++ +GE+   +   L  
Sbjct: 127 AKSASHTGIWDTILAIIPTNIFKSLADGEMMPVIFFSVFFGLGIAAIGERGKVLVDVLNG 186

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F++ + VM+ AP+G FG +  T+ + GLS++  L + +   Y T A F + VLGI
Sbjct: 187 VSEVMFKVTNWVMKFAPIGVFGLIGMTVAQMGLSALLPLGYFILIAYVTMAIFCVVVLGI 246

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+       K +  + EE++L  ST+SSE+ LP LM+K ++ G  + I S V+PTGY+F
Sbjct: 247 VAKMFHLHYWKTMRAVFEEIMLAFSTASSEATLPRLMEKTQKMGVDKGIASFVIPTGYTF 306

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDGS IY +LA LF++QA  + L+   Q +LL++ M++SKG AGV G++F+ L A+++ 
Sbjct: 307 NLDGSAIYQSLAALFLAQAYGLHLTWEHQFTLLVVLMITSKGMAGVPGASFVVLLASVST 366

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +  +P+AG+T I G+DRF+   R+  N +GN V T+V+   EK LD   ++ Y+ 
Sbjct: 367 I-GVPVAGLTFIAGIDRFVDMGRTAVNVVGNTVATLVIGESEKSLDQDKYHHYLD 420


>gi|169630021|ref|YP_001703670.1| sodium:dicarboxylate symporter [Mycobacterium abscessus ATCC 19977]
 gi|169241988|emb|CAM63016.1| Probable sodium:dicarboxylate symporter [Mycobacterium abscessus]
          Length = 453

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 161/421 (38%), Positives = 269/421 (63%), Gaps = 6/421 (1%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           +PP Y+ L++Q+LVAI +G+ +G   P +G  ++PL D F+K  KMLI P+IF TV  GI
Sbjct: 18  KPPWYRSLFVQLLVAIVAGVVIGWLWPGLGADLRPLADGFIKLIKMLIAPIIFCTVVLGI 77

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A + D+K +G+I  KA+  F   + FAL+ GL+VGN+AKPG G ++D  +L T + A  K
Sbjct: 78  AHVGDLKSVGRIGVKALIYFEAVTTFALLFGLLVGNLAKPGAGFHIDAGTLATGADAIAK 137

Query: 132 SSHAKSF---IGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIR-KCL 187
            ++       + F+  +IP + +SA     +LQ L  A+LFG++L+  GE    +  + +
Sbjct: 138 KTNNGELPHTVEFLLGIIPSSIVSAFAENALLQVLFFAVLFGLALAKFGESGPPVVLEFI 197

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           + ++   F ++  +MR+AP+GA GAM++ +G+YG+ S+S+   L+   YA +  FI  + 
Sbjct: 198 DHLSHIFFTIIGWIMRLAPVGALGAMAYIVGQYGIGSLSSYGKLIAACYAAALLFIGVLA 257

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
            I   F   ++ + ++++K+E+ L L T+S+E  LP +M K+  AGC ++   +V+PTGY
Sbjct: 258 VIARLFAGVNLWRFVVYIKDELFLALGTASTEVVLPRIMTKLNHAGCSKTTTGLVIPTGY 317

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           SFNLDG+ +Y+++  LF++QA  V L+L +Q++ +L+ M++SKG AGV GS+F+ L+AT+
Sbjct: 318 SFNLDGATLYLSICVLFLAQALGVNLTLGEQITAVLVLMLTSKGMAGVPGSSFLALSATV 377

Query: 368 TLV--PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
             +   ++P+A + L+LG DR M   R   N +GN V T+VV++WE +LD     K +  
Sbjct: 378 AAIGHGAIPVAAVALLLGADRIMDSMRVSVNLLGNCVATLVVAQWEGQLDKDRMCKVLAG 437

Query: 426 E 426
           +
Sbjct: 438 Q 438


>gi|206968426|ref|ZP_03229382.1| proton/glutamate symporter family protein [Bacillus cereus AH1134]
 gi|218234135|ref|YP_002366214.1| proton/glutamate symporter family protein [Bacillus cereus B4264]
 gi|228938645|ref|ZP_04101250.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228951910|ref|ZP_04114008.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228971526|ref|ZP_04132150.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228978137|ref|ZP_04138515.1| Proton glutamate symport protein [Bacillus thuringiensis Bt407]
 gi|229149732|ref|ZP_04277962.1| Proton glutamate symport protein [Bacillus cereus m1550]
 gi|229177939|ref|ZP_04305311.1| Proton glutamate symport protein [Bacillus cereus 172560W]
 gi|229189613|ref|ZP_04316628.1| Proton glutamate symport protein [Bacillus cereus ATCC 10876]
 gi|206737346|gb|EDZ54493.1| proton/glutamate symporter family protein [Bacillus cereus AH1134]
 gi|218162092|gb|ACK62084.1| proton/glutamate symporter family protein [Bacillus cereus B4264]
 gi|228593877|gb|EEK51681.1| Proton glutamate symport protein [Bacillus cereus ATCC 10876]
 gi|228605427|gb|EEK62876.1| Proton glutamate symport protein [Bacillus cereus 172560W]
 gi|228633763|gb|EEK90362.1| Proton glutamate symport protein [Bacillus cereus m1550]
 gi|228781609|gb|EEM29809.1| Proton glutamate symport protein [Bacillus thuringiensis Bt407]
 gi|228788185|gb|EEM36140.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228807833|gb|EEM54354.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228821021|gb|EEM67041.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326939153|gb|AEA15049.1| proton/sodium-glutamate symport protein [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 424

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 137/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTILYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|163939649|ref|YP_001644533.1| sodium:dicarboxylate symporter [Bacillus weihenstephanensis KBAB4]
 gi|229132673|ref|ZP_04261520.1| Proton glutamate symport protein [Bacillus cereus BDRD-ST196]
 gi|229166699|ref|ZP_04294449.1| Proton glutamate symport protein [Bacillus cereus AH621]
 gi|163861846|gb|ABY42905.1| sodium:dicarboxylate symporter [Bacillus weihenstephanensis KBAB4]
 gi|228616696|gb|EEK73771.1| Proton glutamate symport protein [Bacillus cereus AH621]
 gi|228650800|gb|EEL06788.1| Proton glutamate symport protein [Bacillus cereus BDRD-ST196]
          Length = 423

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 140/411 (34%), Positives = 244/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LATQIFVALVLGIVVGAIFYGNKTAISYITPVGDIFIHLIKMIVVPIVISALIVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  A+++GL+  NI +PG G+++     +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIAILMGLLAANIFQPGTGVDMSNLQQSDISSYKQTADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     ++T G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFAETIVHIVPKNIFESITQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVFALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVVIVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  L+  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLMKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LF++Q   V +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFVAQMYGVHMSLTEQITLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D +   +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSAVNVLGNALAAIVMSKWEGEFDDEKAKQYVE 415


>gi|163939346|ref|YP_001644230.1| sodium:dicarboxylate symporter [Bacillus weihenstephanensis KBAB4]
 gi|163861543|gb|ABY42602.1| sodium:dicarboxylate symporter [Bacillus weihenstephanensis KBAB4]
          Length = 424

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 138/410 (33%), Positives = 251/410 (61%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+ +G      P++   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGITVGAIFFGNPEVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+V+GL++ NI +PG G+++D  +    ++  A  +  
Sbjct: 66  DVKKLGRLGGKTIIYFEIITTLAIVVGLLIANIFQPGKGVDMDQLTKTDISKYTATTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLAEGDMLAIIFFSVLFGLGVAAIGERGKPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIELSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PAEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|17549216|ref|NP_522556.1| C4-dicarboxylate transport transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|20137799|sp|Q8XR66|DCTA3_RALSO RecName: Full=C4-dicarboxylate transport protein 3
 gi|17431468|emb|CAD18146.1| probable c4-c4-dicarboxylate transport 3. transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 447

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 192/418 (45%), Positives = 288/418 (68%), Gaps = 3/418 (0%)

Query: 10  DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVST 69
            IR  L K LY+QVL+ + +G+  G   P +G  ++PLGD+F+K  KM+  P+IF TV+ 
Sbjct: 1   MIRKTLGK-LYVQVLIGVAAGIVQGVAAPNLGSDLKPLGDVFIKLIKMVFAPIIFATVTL 59

Query: 70  GIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAH 129
           GIARM++MK +G++  +A+  F V S FAL +GLIV N+ +PG GMNVD   L+T++IA 
Sbjct: 60  GIARMENMKELGRVGVRALVYFEVLSTFALALGLIVVNLVQPGQGMNVDAAHLDTKAIAS 119

Query: 130 IK--SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCL 187
               ++  ++F+ F+  ++P + + AL   +ILQ L+ A LFGI+LS +G ++  +   L
Sbjct: 120 YTHAAARPQTFVDFLLSLVPSSIIDALARNDILQILVFATLFGIALSRMGTRARPVVDFL 179

Query: 188 EEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVL 247
           +     VF +V ++MR+AP+ AFGAM+FT+GKYGL SI+ L  L+  +Y T   F+  VL
Sbjct: 180 DVFTQGVFSIVGMIMRLAPIAAFGAMAFTVGKYGLGSIAALGKLMATMYLTCVLFVAIVL 239

Query: 248 GILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGY 307
           G +AR   FS+ K + ++++E+  VL TSSSES +P LM+K+E AG  + +V +VVP+G 
Sbjct: 240 GGVARLAGFSLWKFLRYIRDEIFTVLGTSSSESVVPQLMRKLESAGVSKPVVGLVVPSGL 299

Query: 308 SFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATI 367
           +FN DG  IY T+A +F++QATN PL+LTDQL +L + +++SKG+AGVTGS FITLAAT+
Sbjct: 300 TFNPDGQCIYYTMAAIFVAQATNTPLTLTDQLVVLGVLLLTSKGSAGVTGSGFITLAATL 359

Query: 368 TLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
             +  +P+AGM L+LG+DRFMSE R++TN IGNAV T+ ++RW   +D +     +  
Sbjct: 360 ASLGKIPVAGMVLLLGIDRFMSEARAITNTIGNAVGTLAIARWVGAVDRERLQAALDG 417


>gi|170748547|ref|YP_001754807.1| sodium:dicarboxylate symporter [Methylobacterium radiotolerans JCM
           2831]
 gi|170655069|gb|ACB24124.1| sodium:dicarboxylate symporter [Methylobacterium radiotolerans JCM
           2831]
          Length = 457

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 192/416 (46%), Positives = 292/416 (70%), Gaps = 3/416 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           R P YK+LYIQVL+AI  G+ LG + P  G  M+ LGD F+   KM+I P+IF T+  GI
Sbjct: 15  REPWYKVLYIQVLIAIALGVLLGWYDPATGKSMKWLGDAFIGLIKMMIAPIIFCTIVHGI 74

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A + D+K +G++  KA+  F V S  AL+IG+IVG + +PG G N D   L+   +A   
Sbjct: 75  ASIGDLKKVGRVGLKALVYFEVVSTIALLIGVIVGEVIRPGAGFNADPSKLDASKVATYA 134

Query: 132 S-SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           S + A S +  +  +IP + L    +G++LQ L++++L G+ ++ +G+++ ++   ++  
Sbjct: 135 SKAAADSTVAHILAIIPKSFLDPFATGDLLQVLLISILTGVVVTNLGDRAASVNHAIDTA 194

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
               FR++ IV+++AP+GAFGAM+FTIG+YG+  + +L +LV   Y T+  F+L VLG +
Sbjct: 195 GQIFFRIIGIVVKLAPVGAFGAMAFTIGEYGIQKVYDLAWLVGTFYITALLFVLVVLGAI 254

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR   FSI++ + ++K+E+L+V+ TSSSE+ LP LM KM   G   S+V +VVPTGYSFN
Sbjct: 255 ARVAGFSILRFLAYIKDELLIVVGTSSSETVLPQLMTKMRRLGASDSVVGLVVPTGYSFN 314

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLATLF++QA  V LS++   +++L+AM++SKGA+GVTG+ FITLAAT++ +
Sbjct: 315 LDGTNIYMTLATLFLAQAVGVDLSISQYATIILVAMLTSKGASGVTGAGFITLAATLSAI 374

Query: 371 PS--LPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+  +P+A MTL+LG+D+FMSECR++TN +GN V  VVVSRWE +LD    N+ + 
Sbjct: 375 PNSPVPVAAMTLVLGIDKFMSECRALTNLVGNGVACVVVSRWEGELDVAKLNEVMA 430


>gi|229011141|ref|ZP_04168334.1| Proton glutamate symport protein [Bacillus mycoides DSM 2048]
 gi|228750024|gb|EEL99856.1| Proton glutamate symport protein [Bacillus mycoides DSM 2048]
          Length = 423

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 141/411 (34%), Positives = 244/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LATQIFVALVLGIVVGAVFYGNKTAISYITPIGDIFIHLIKMIVVPIVISALIVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  A+++GL+  NI +PG G+++     +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIAILMGLLAANIFQPGTGVDMSNLQQSDISSYKQTADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     ++T G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFAETIVHIVPKNIFESITQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVFALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVVIVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  LI  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLIKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LF++Q   V +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFVAQMYGVHMSLTEQITLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D +   +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSAVNVLGNALAAIVMSKWEGEFDDEKAKQYVE 415


>gi|184156243|ref|YP_001844583.1| proton/sodium-glutamate symport protein [Lactobacillus fermentum
           IFO 3956]
 gi|227515213|ref|ZP_03945262.1| DAACS family dicarboxylate/amino acid:sodium (Na+) or proton (H+)
           symporter [Lactobacillus fermentum ATCC 14931]
 gi|183227587|dbj|BAG28103.1| proton/sodium-glutamate symport protein [Lactobacillus fermentum
           IFO 3956]
 gi|227086404|gb|EEI21716.1| DAACS family dicarboxylate/amino acid:sodium (Na+) or proton (H+)
           symporter [Lactobacillus fermentum ATCC 14931]
          Length = 430

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 136/415 (32%), Positives = 240/415 (57%), Gaps = 6/415 (1%)

Query: 15  LYKILYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
               L  Q+++ +  G+  G F          M  LG IF++  +M++ P++   ++ GI
Sbjct: 7   FRLSLGWQIVIGLVLGIVCGAFTYHNQGAITIMSNLGTIFLRLIQMIVLPIVVSCLTVGI 66

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAH 129
           A + D+  +G+I  K +  F V +  A+V+GL+VGN+A PG  +N+     +  ++ +  
Sbjct: 67  ANIGDLHKLGRIGGKTIIYFEVLTTIAIVLGLVVGNLAHPGTFINIHDLQGSDISKYMTT 126

Query: 130 IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEE 189
            KS+        +  +IP     +L  G ++  +  ++ FG+ ++ +GE+   +   L  
Sbjct: 127 AKSASHTGIWDTILAIIPTNIFKSLADGEMMPVIFFSVFFGLGIAAIGERGKVLVDVLNG 186

Query: 190 INFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGI 249
           ++  +F++ + VM+ AP+G FG +  T+ + GLS++  L + +   Y T   F + VLGI
Sbjct: 187 VSEVMFKVTNWVMKFAPIGVFGLIGMTVAQMGLSALLPLGYFILIAYVTMVIFCVVVLGI 246

Query: 250 LARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSF 309
           +A+       K +  + EE++L  ST+SSE+ LP LM+K ++ G  + I S V+PTGY+F
Sbjct: 247 VAKMFHLHYWKTMRAVFEEIMLAFSTASSEATLPRLMEKTQKMGVDKGIASFVIPTGYTF 306

Query: 310 NLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITL 369
           NLDGS IY +LA LF++QA  + L+   Q +LL++ M++SKG AGV G++F+ L A+++ 
Sbjct: 307 NLDGSAIYQSLAALFLAQAYGLHLTWEHQFTLLVVLMITSKGMAGVPGASFVVLLASVST 366

Query: 370 VPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           +  +P+AG+T I G+DRF+   R+  N +GN V T+V+   EK LD   ++ Y+ 
Sbjct: 367 I-GVPVAGLTFIAGIDRFVDMGRTAVNVVGNTVATLVIGESEKSLDQDKYHHYLD 420


>gi|324325548|gb|ADY20808.1| proton/glutamate symporter family protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 423

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 137/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLVLGIAVGAIFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTIIYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIVKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|324325868|gb|ADY21128.1| proton/sodium-glutamate symport protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 423

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 139/411 (33%), Positives = 244/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LATQIFVALVLGIVVGAVFYGNKTAISYITPIGDIFIHLIKMIVVPIVISALIVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  A+++GL+  NI +PG G++++    +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIAILMGLLAANIFQPGTGVDMNNLQQSDISSYKQTADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     ++  G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFADTIVHIVPKNVFESIAQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVFALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVVIVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  L+  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLMKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LF++Q   V +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFVAQMYGVHMSLTEQITLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D +   +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSSVNVLGNALAAIVMSKWEGEFDNEKAKQYVE 415


>gi|182679201|ref|YP_001833347.1| sodium:dicarboxylate symporter [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635084|gb|ACB95858.1| sodium:dicarboxylate symporter [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 443

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 192/413 (46%), Positives = 287/413 (69%), Gaps = 6/413 (1%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGV--QMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           P Y+ILY+QVL+ I  G+  G   P       ++ LGD F+K  KM+I P+IF TV +GI
Sbjct: 20  PFYRILYVQVLIGILLGVLFGWLWPATASADWVKALGDGFIKLIKMMIAPIIFCTVVSGI 79

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIK 131
           A +   + +G+I  KA+  F V S FALV+GL++GN+ +PG G+                
Sbjct: 80  AHVSSAQKVGRIGVKALVYFEVVSTFALVLGLVIGNLVQPGRGI----ADKVDAGAVAKY 135

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
                S + F+ D+IPD+ +     G++LQ L+ ++LFG +L  +G + +++ K ++++ 
Sbjct: 136 VGQEHSTVQFLLDLIPDSVVGGFARGDVLQVLLFSILFGFALLGLGSRGESLTKLIDDVA 195

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             VF +++IVMR AP+GAFGAM++T+G+YG  ++ NL+ LV   Y T+  FI+ VLG +A
Sbjct: 196 QAVFGVIAIVMRAAPIGAFGAMAYTVGRYGPQTLGNLLGLVATFYLTAILFIVIVLGTIA 255

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FSI K + ++K+E+L+VL TSSSESALP LM+K+E  GC + +V +VVPTGYSFNL
Sbjct: 256 RLAGFSIFKFLAYIKDELLIVLGTSSSESALPALMEKLERLGCSKPVVGLVVPTGYSFNL 315

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG+NIY+TLATLF++QA  VPL+L +Q+++LL+AMV+SKGA+G++G+ FITLAAT+  V 
Sbjct: 316 DGTNIYMTLATLFVAQALGVPLNLEEQITILLVAMVASKGASGISGAGFITLAATLAAVN 375

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
            + + GM ++LGVD+FMSECR++TN IGN V T++VSRWEK++DP+     + 
Sbjct: 376 PILVPGMAMLLGVDKFMSECRALTNIIGNGVATIIVSRWEKEIDPRALRAALE 428


>gi|250725|gb|AAB22400.1| NGRDCTA1 [Rhizobium leguminosarum]
          Length = 456

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 230/415 (55%), Positives = 318/415 (76%), Gaps = 1/415 (0%)

Query: 12  RPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGI 71
           + P Y+ LY+QVL AI  G+ LG+F P +G +M+PLGD F+   KM+I PVIFLTV+TGI
Sbjct: 27  KTPHYRHLYVQVLAAIAVGILLGYFYPDVGSKMKPLGDAFIMLVKMIIAPVIFLTVATGI 86

Query: 72  ARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIA-HI 130
           A M D+  +G++  KAM  F  FS  AL++GL+V N+ +PG GM++D  SL+ ++IA + 
Sbjct: 87  AGMTDLAKVGRVAGKAMIYFLAFSTLALLVGLVVANVVQPGAGMHIDPASLDAKAIATYA 146

Query: 131 KSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEI 190
           + +H +S  GF+ ++IP T + A   G+ILQ L +++LFGISL++VG+K++ +   L  +
Sbjct: 147 EKAHEQSVTGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKKAEAVVDFLHAL 206

Query: 191 NFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGIL 250
             P+FR+V+I+M+ AP+GAFGAM+FTIGKYG++SI+NL  L+   Y TS  F+  VLG +
Sbjct: 207 TLPIFRLVAILMKAAPIGAFGAMAFTIGKYGVASIANLAMLIGTFYLTSFLFVFMVLGAV 266

Query: 251 ARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFN 310
           AR+  FSI+ LI ++KEE+LLVL TSSSE+ALPGLM KME+AGC RS+V +V+PTGYSFN
Sbjct: 267 ARYNGFSIVALIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 326

Query: 311 LDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLV 370
           LDG+NIY+TLA LFI+Q T+ P+S  DQ+ LLLIAM+SSKGAAG+TG+ FITLAAT++ V
Sbjct: 327 LDGTNIYMTLAALFIAQGTDTPISYGDQILLLLIAMLSSKGAAGITGAGFITLAATLSAV 386

Query: 371 PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           PS+P+AGM LILG+DRFMSECR++TN IGNAV T+VV++WE +L P      +  
Sbjct: 387 PSVPVAGMALILGIDRFMSECRAITNIIGNAVATIVVAKWEGELAPAQLATTLAG 441


>gi|206970551|ref|ZP_03231503.1| proton/sodium-glutamate symporter [Bacillus cereus AH1134]
 gi|206974762|ref|ZP_03235677.1| proton/sodium-glutamate symporter [Bacillus cereus H3081.97]
 gi|217959327|ref|YP_002337875.1| proton/sodium-glutamate symporter [Bacillus cereus AH187]
 gi|222095471|ref|YP_002529531.1| proton/sodium-glutamate symport protein [Bacillus cereus Q1]
 gi|228984936|ref|ZP_04145106.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229138540|ref|ZP_04267127.1| Proton glutamate symport protein [Bacillus cereus BDRD-ST26]
 gi|229155422|ref|ZP_04283532.1| Proton glutamate symport protein [Bacillus cereus ATCC 4342]
 gi|229189946|ref|ZP_04316956.1| Proton glutamate symport protein [Bacillus cereus ATCC 10876]
 gi|206734187|gb|EDZ51357.1| proton/sodium-glutamate symporter [Bacillus cereus AH1134]
 gi|206746781|gb|EDZ58173.1| proton/sodium-glutamate symporter [Bacillus cereus H3081.97]
 gi|217065171|gb|ACJ79421.1| proton/sodium-glutamate symporter [Bacillus cereus AH187]
 gi|221239529|gb|ACM12239.1| proton/sodium-glutamate symport protein [Bacillus cereus Q1]
 gi|228593620|gb|EEK51429.1| Proton glutamate symport protein [Bacillus cereus ATCC 10876]
 gi|228628137|gb|EEK84854.1| Proton glutamate symport protein [Bacillus cereus ATCC 4342]
 gi|228644948|gb|EEL01193.1| Proton glutamate symport protein [Bacillus cereus BDRD-ST26]
 gi|228774886|gb|EEM23282.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 423

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 139/411 (33%), Positives = 243/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LATQIFVALVLGIVVGAVFYGNKTAISYITPIGDIFIHLIKMIVVPIVISALIVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  A+++GL+  NI +PG G+++     +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIAILMGLLAANIFQPGTGVDMSNLQQSDISSYKQTADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     ++  G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFADTIVHIVPKNVFESIAQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVFALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVVIVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  L+  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLMKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LF++Q   V +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFVAQMYGVHMSLTEQITLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D +   +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSSVNVLGNALAAIVMSKWEGEFDNEKAKQYVE 415


>gi|294634288|ref|ZP_06712829.1| proton/sodium-glutamate symport protein GltT [Edwardsiella tarda
           ATCC 23685]
 gi|291092281|gb|EFE24842.1| proton/sodium-glutamate symport protein GltT [Edwardsiella tarda
           ATCC 23685]
          Length = 439

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 153/423 (36%), Positives = 242/423 (57%), Gaps = 14/423 (3%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIGVQ--------MQPLGDIFVKTTKMLITPVIF 64
             L   L  Q+++A+  G+ +G  +   G          + P GDIF++  KM++ P++ 
Sbjct: 2   KRLRLTLAWQIVIALILGIIVGAVLHDQGESRQWLVSNLLSPAGDIFIRLIKMIVLPIVI 61

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL-- 122
            T+  GIA + D K +G+I  K +  F V +  A+++G+ + N+ +PG G+++   +   
Sbjct: 62  STLIVGIAGVGDAKKLGRIGLKTIVYFEVITTLAIIVGITLANLFQPGHGVDMSQLATVD 121

Query: 123 --NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEK 179
               E       S A S +G +  +IP    +AL  G IL  +  ++LFG+   SL  + 
Sbjct: 122 ISQYERTTEQVQSGAHSLVGTLLALIPANLFAALAKGEILPIIFFSVLFGLGLSSLPSDH 181

Query: 180 SDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATS 239
            + + +    I+  +F++  ++MR AP+G FG +S T+  +G SS+  L  LV  +Y   
Sbjct: 182 KEPLLRVFRAISESMFKVTHMIMRYAPIGVFGLISVTVANFGFSSLLPLAKLVVLVYGAI 241

Query: 240 AFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIV 299
            FF L VLG +AR CR  I  LI  LK+E++L  ST+SSE+ LP +M+KME  G  +SI 
Sbjct: 242 LFFGLMVLGAVARLCRLRIWTLITILKDELILAYSTASSETVLPRIMEKMEAYGAPKSIT 301

Query: 300 SMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSA 359
           S VVPTGYSFNLDGS +Y ++A +FI+Q   + LSL  ++ L+L  MV+SKG AGV G +
Sbjct: 302 SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIQLSLGHEIILVLTLMVTSKGIAGVPGVS 361

Query: 360 FITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLF 419
           F+ L AT+  V  +P+ G+  I GVDR +   R+  N +GNA+  +V+++WE + D    
Sbjct: 362 FVVLLATLGSV-GIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHQFDRDKA 420

Query: 420 NKY 422
             Y
Sbjct: 421 RAY 423


>gi|330878486|gb|EGH12635.1| glutamate/aspartate:proton symporter [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 443

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 149/422 (35%), Positives = 245/422 (58%), Gaps = 13/422 (3%)

Query: 13  PPLYKILYIQVLVAIFSGMALGHFVPQIG--------VQMQPLGDIFVKTTKMLITPVIF 64
                 L  Q+L+ +  G+A+G  +   G          +QP GDIF++  KM++ P++ 
Sbjct: 2   KKAKLSLAWQILIGLVLGIAVGALLNHFGDEKAWWITNILQPAGDIFIRLIKMIVIPIVV 61

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKS--- 121
            ++  GIA M D K +G+I  K +  F V +  A+++GL++ N+  PG G+++       
Sbjct: 62  ASLIVGIAGMGDAKKLGRIGLKTILYFEVVTTIAILVGLVLANVFHPGTGIDMSTLGTVD 121

Query: 122 LNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGI-SLSLVGEKS 180
           ++       +  H  +F+  + ++IP    +A+T G +L  +  ++LFG+   SL  E  
Sbjct: 122 ISKYQQTTAEVQHDHAFVATILNLIPSNIFAAMTRGEMLPIIFFSVLFGLGLSSLQAEVR 181

Query: 181 DTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSA 240
           + + K  + ++  +F++  ++M  AP+G F  ++ T+  +G +S+  L  LV  +Y   A
Sbjct: 182 EPLVKLFQGVSETMFKVTHMIMNYAPIGVFALIAVTVANFGFASLLPLAKLVILVYVAIA 241

Query: 241 FFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVS 300
           FF   VLG++AR   FS+IKL+   K+E++L  ST+SSE+ LP +++KME  G  ++I S
Sbjct: 242 FFAFVVLGLIARAFGFSVIKLMRIFKDELILSYSTASSETVLPRVIQKMEAYGAPKAICS 301

Query: 301 MVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAF 360
            VVPTGYSFNLDGS +Y ++A +FI+Q   + LS++ QL L+L  MV+SKG AGV G +F
Sbjct: 302 FVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSISAQLMLVLTLMVTSKGIAGVPGVSF 361

Query: 361 ITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFN 420
           + L AT+     +P+ G+  I GVDR M   R+  N IGNA+  +V+SRWE   D     
Sbjct: 362 VVLLATLGS-AGIPLEGLAFIAGVDRIMDMARTALNVIGNALAVLVISRWEGLYDDAKGE 420

Query: 421 KY 422
           +Y
Sbjct: 421 RY 422


>gi|228920241|ref|ZP_04083589.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228839440|gb|EEM84733.1| Proton glutamate symport protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 424

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 137/410 (33%), Positives = 250/410 (60%), Gaps = 6/410 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L  Q+L+ +  G+A+G      P +   +QP+GDIF++  KM++ P++  ++  G+A + 
Sbjct: 6   LAWQILIGLALGIAVGAIFFDNPAVVKYLQPIGDIFIRLIKMIVVPIVVASIVVGVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           D+K +G++  K +  F + +  A+++GL++ NI +PG G+N++  +    ++     +  
Sbjct: 66  DVKKLGRLGGKTIIYFEIITTIAIIVGLLIANIFQPGKGVNMEQLTKTDISKYTHTTEQV 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
            + SF     +++P   + +L  G++L  +  ++LFG+ ++ +GE+   + +  + +   
Sbjct: 126 QSHSFADTFVNIVPTNIMKSLADGDMLAIIFFSVLFGLGVAAIGERGRPVLQFFQGVADA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  +  T+  +GL+S+  L  L+  +Y    FF++ VLG+ A+ 
Sbjct: 186 MFYVTNQVMKFAPFGVFALIGVTVSTFGLASLIPLGKLLIVVYGAMIFFVVVVLGLTAKI 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I +    LK+E++L  ST+SSE+ LP +M+KME+ GC ++I S V+PTGYSFNLDG
Sbjct: 246 FGINIFQFFKILKDELILAYSTASSETVLPKIMEKMEKFGCPKAITSFVIPTGYSFNLDG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S +Y  +A +F++Q   + LS+T Q++LLL+ MV+SKG AGV G +F+ L AT+  V  +
Sbjct: 306 STLYQAIAAIFLAQMYGIDLSITQQITLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GI 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYI 423
           P  G+  I G+DR +   R+  N +GN++  VV+S+WE + D +    Y+
Sbjct: 365 PPEGLAFIAGIDRILDMARTAVNVVGNSLAAVVMSKWEGQYDAEKGQAYL 414


>gi|186471146|ref|YP_001862464.1| sodium:dicarboxylate symporter [Burkholderia phymatum STM815]
 gi|184197455|gb|ACC75418.1| sodium:dicarboxylate symporter [Burkholderia phymatum STM815]
          Length = 456

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 179/421 (42%), Positives = 282/421 (66%), Gaps = 2/421 (0%)

Query: 7   VHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLT 66
           +    R  L K LY+QVL+ I +G+ +GH  P IG Q++PLGD+F+K  +ML+ P+IF +
Sbjct: 2   LVSRFRKTLSK-LYVQVLIGIVAGIVVGHCYPDIGSQLKPLGDLFIKLIRMLLAPIIFAS 60

Query: 67  VSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTES 126
           V  GIARM D+   G++  KA+  F + S  ALV G++V N+ KPG GMN+D   +++ +
Sbjct: 61  VVVGIARMNDLHEAGRVGVKAVLYFEIASTIALVAGMVVVNMIKPGSGMNIDPAHIDSAA 120

Query: 127 IAHIK-SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRK 185
           I     ++     + F   ++P++ + A  +G +L  +  ++L  ISL+ +G ++     
Sbjct: 121 ITTYTHAAQQHGMLDFFMSIVPNSVVGAFANGEMLPIIFFSVLLAISLARLGPRTAPFVD 180

Query: 186 CLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILG 245
            L+     +F +V IVM +AP+GAFG M+FTIG+YG+ ++++   L+ CLY TS FF++ 
Sbjct: 181 MLDMFLQGMFGVVRIVMYVAPIGAFGGMAFTIGRYGIGTLASFGELMLCLYLTSIFFVVV 240

Query: 246 VLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPT 305
           VLG++ R C  S+ K + ++++E+L+ L T+S+E+ LP ++ KME+ GC R +V MV+PT
Sbjct: 241 VLGLVMRMCGLSLWKYLRYIRDEILITLGTASTEAVLPHMLIKMEKMGCSRPVVGMVLPT 300

Query: 306 GYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAA 365
           GY+FN DG+ IY+T+A LFI+QA NV LS+ DQL +L + +++SKG+AGV G+ F+ LAA
Sbjct: 301 GYTFNADGTAIYLTMAALFIAQAMNVHLSIWDQLLVLGVLLLTSKGSAGVAGAGFVALAA 360

Query: 366 TITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI 425
           T+  +  +P+ G+ L+LGVDRF++E R+VTN IGN V TVVV+RWE +LD       +  
Sbjct: 361 TLASMHKIPVEGLVLLLGVDRFLNEARAVTNLIGNGVATVVVARWEGQLDMTRARAVLNR 420

Query: 426 E 426
           E
Sbjct: 421 E 421


>gi|47565529|ref|ZP_00236570.1| proton/sodium-glutamate symport protein [Bacillus cereus G9241]
 gi|47557519|gb|EAL15846.1| proton/sodium-glutamate symport protein [Bacillus cereus G9241]
          Length = 423

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 140/411 (34%), Positives = 244/411 (59%), Gaps = 6/411 (1%)

Query: 19  LYIQVLVAIFSGMALGHFV---PQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMK 75
           L IQ+ VA+  G+ +G            + P+GDIF+   KM++ P++   +   +A + 
Sbjct: 6   LAIQIFVALVLGIVVGAVFYGNKTAISYITPIGDIFIHLIKMIVVPIVISALIVAVAGVG 65

Query: 76  DMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN--TESIAHIKSS 133
           DMK +G++  K +  F + +  A+++GL+  NI +PG G+++     +  +       ++
Sbjct: 66  DMKKLGKLGGKTILYFEIITTIAILMGLLAANIFQPGTGVDMSNLQQSDISSYKQTADAT 125

Query: 134 HAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFP 193
             K F   +  ++P     ++  G++L  +  ++LFG+ ++ +GEK   +    E +   
Sbjct: 126 EKKGFADTIVHIVPKNVFESIAQGDLLPIIFFSVLFGLGVAAIGEKGKPVFNFFEGVLEA 185

Query: 194 VFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF 253
           +F + + VM+ AP G F  ++ T+ K+G++++  L  LV  +Y T   F++ VLGI AR 
Sbjct: 186 MFWVTNQVMKFAPFGVFALIAVTVAKFGVATLLPLGKLVLAVYVTVILFVVIVLGINARM 245

Query: 254 CRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDG 313
              +I  L+  LKEE++L  +T+SSE+ LP +M+KMEE GC +++ S V+PTGY+FNL G
Sbjct: 246 VGVNIFTLMKILKEELILSFTTASSEAVLPNIMRKMEEFGCPKAVASFVIPTGYTFNLTG 305

Query: 314 SNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSL 373
           S IY  LA LF++Q   V +SLT+Q++LL + M++SKG AGV G++F+ + AT+     L
Sbjct: 306 SAIYQALAALFVAQMYGVHMSLTEQITLLFVLMLTSKGMAGVPGASFVVVLATLGS-MGL 364

Query: 374 PIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIG 424
           P+ G+ LI G+DR +   RS  N +GNA+  +V+S+WE + D +   +Y+ 
Sbjct: 365 PLEGIALIAGIDRILDMIRSSVNVLGNALAAIVMSKWEGEFDNEKAKQYVE 415


>gi|111220845|ref|YP_711639.1| C4-dicarboxylate transport protein [Frankia alni ACN14a]
 gi|111148377|emb|CAJ60049.1| C4-dicarboxylate transport protein [Frankia alni ACN14a]
          Length = 485

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 171/405 (42%), Positives = 276/405 (68%), Gaps = 2/405 (0%)

Qu