RPSBLAST alignment for GI: 254780387 and conserved domain: PRK14695

>gnl|CDD|173158 PRK14695, PRK14695, serine/threonine transporter SstT; Provisional. Length = 319
 Score = 65.5 bits (159), Expect = 3e-11
 Identities = 65/267 (24%), Positives = 124/267 (46%), Gaps = 14/267 (5%)

Query: 148 DTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPL 207
           D+ ++AL + N +  L  A++FGI++    + S  + K + ++     ++V  ++ +AP 
Sbjct: 50  DSPVNALLTANYIGILSWAVIFGIAMREASKNSKELLKTIADVTS---KIVEWIINLAPF 106

Query: 208 GAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARF--CRFSIIKLII-F 264
           G  G +  TI   G+ S++N   L+  L  T+  F+  V+  L  F   R +   L+   
Sbjct: 107 GILGLVFKTISDKGVGSLANYGILLVLL-VTTMLFVAPVVNPLIAFFFMRRNPYPLVWNC 165

Query: 265 LKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLF 324
           L+   +    T SS + +P  MK   + G +    S+ +P G + N+ G  I I L TL 
Sbjct: 166 LRVSGVTAFFTRSSATNIPVNMKLCHDLGLNPDTYSVSIPLGSTINMAGVAITINLLTLV 225

Query: 325 ISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP-----SLPIAGMT 379
                 +P+       L ++A +S+ GA+G+ G + + +    +L       ++ I G+ 
Sbjct: 226 TVNTLGIPVDFATAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQIVGVG 285

Query: 380 LILGVDRFMSECRSVTNFIGNAVMTVV 406
            ++GV      C +  N   + + T V
Sbjct: 286 FVIGV--IQDSCETALNSSTDVLFTAV 310