RPSBLAST alignment for GI: 254780387 and conserved domain: PRK13027

>gnl|CDD|183850 PRK13027, PRK13027, C4-dicarboxylate transporter DctA; Reviewed. Length = 421
 Score =  458 bits (1181), Expect = e-129
 Identities = 184/404 (45%), Positives = 280/404 (69%), Gaps = 2/404 (0%)

Query: 14  PLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIAR 73
              + L+ QV++A+  G+ALG F P     ++PLGD F+K  KMLI P++F  V +GIA 
Sbjct: 3   KFLRSLFGQVVIALVLGVALGAFFPHFAESLKPLGDGFIKLIKMLIGPIVFCVVVSGIAG 62

Query: 74  MKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHI--K 131
             D+K +G++  KA+  F V +  ALVIGL++  +  PG+GMN+DL+SL+  S+A     
Sbjct: 63  AGDLKKVGRVGLKAVIYFEVMTTIALVIGLVLAYLTGPGVGMNIDLRSLDAASLAGYAKN 122

Query: 132 SSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEIN 191
           +   K   GF+  +IP TA+ A   G+ILQ L+ ++LFG +LSL+GE++  + + ++E++
Sbjct: 123 AQSLKGTAGFLLKLIPTTAVDAFAKGDILQVLLFSVLFGSALSLLGERAKRVNRLIDELS 182

Query: 192 FPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILA 251
             +FR++  ++++APLG  GA++FT GKYG+ S+  L  LV   Y T   F++ VLG + 
Sbjct: 183 HVLFRIMGFIIKLAPLGVLGAIAFTTGKYGVGSLKQLGMLVAVFYLTCFVFVVVVLGAVM 242

Query: 252 RFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNL 311
           R   FS+ KLI +L+EE+L+VL T+SS++ LP +M+K+E  G   S V +V+PTGYSFNL
Sbjct: 243 RLAGFSVFKLIRYLREELLIVLGTASSDAVLPQVMRKLEHMGIKDSTVGLVIPTGYSFNL 302

Query: 312 DGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVP 371
           DG +IY+TLA +FI+QATN PLS+ D +++LL+++V+SKGA G+ GSA + LAAT++ +P
Sbjct: 303 DGFSIYLTLAAVFIAQATNTPLSMHDLITILLVSLVTSKGAHGIPGSAIVILAATLSAIP 362

Query: 372 SLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLD 415
           ++P+ G+ LIL VD FM   R++TN IGN V TVVV+ WE  +D
Sbjct: 363 AIPVLGLVLILPVDWFMGIARALTNLIGNCVATVVVAVWENDID 406