RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] (458 letters) >gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain. VWA domains in extracellular eukaryotic proteins mediate adhesion via metal ion-dependent adhesion sites (MIDAS). Intracellular VWA domains and homologues in prokaryotes have recently been identified. The proposed VWA domains in integrin beta subunits have recently been substantiated using sequence-based methods. Length = 177 Score = 45.9 bits (109), Expect = 2e-05 Identities = 27/132 (20%), Positives = 57/132 (43%), Gaps = 12/132 (9%) Query: 277 ALASVIRSIKKIDNVNDTVRMGATFFND--RVISDPSFSWGVHKLIRTIVKTFAIDENEM 334 A V++ ++++D D R+G F+D V+ + S L+ + ++ Sbjct: 22 AKEFVLKLVEQLDIGPDGDRVGLVTFSDDATVLFPLNDSRSKDALLEAL---ASLSYKLG 78 Query: 335 GSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAK 394 G T + A+Q A + + S + A K ++L+TDGE+ D + + + K Sbjct: 79 GGTNLGAALQYALENLFSK------SAGSRRGAPKVLILITDGESN-DGGDLLKAAKELK 131 Query: 395 SQGIRIMTIAFS 406 G+++ + Sbjct: 132 RSGVKVFVVGVG 143 >gnl|CDD|184242 PRK13685, PRK13685, hypothetical protein; Provisional. Length = 326 Score = 34.7 bits (80), Expect = 0.052 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 29/107 (27%) Query: 371 IVLLTDGENT----QDNEEG-IAICNKAKSQGIRIMTIAF-----SV------------N 408 IVL++DG+ T DN G AK QG+ I TI+F SV + Sbjct: 197 IVLMSDGKETVPTNPDNPRGAYTAARTAKDQGVPISTISFGTPYGSVEINGQRQPVPVDD 256 Query: 409 KTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIR 455 ++ ++ A+ S F+ A S EL ++ + +I I+ Sbjct: 257 ESLKKIAQL------SGGEFYTAASLEELRAVY-ATLQQQIGYETIK 296 >gnl|CDD|180362 PRK06036, PRK06036, translation initiation factor IF-2B subunit alpha; Provisional. Length = 339 Score = 30.1 bits (68), Expect = 1.2 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 12/102 (11%) Query: 277 ALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGS 336 ALA+ + K +D + +++ A + + SWGV ++++ + D E+ Sbjct: 60 ALAARLSKAKDVDELLKDLKVAAETLKSTRPTAVNLSWGVDRVLKAALDAE--DVEEIRD 117 Query: 337 TAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGE 378 A+ +A + A E++V R N L K LL DG+ Sbjct: 118 IALREAERIA--------EEDVAR--NKLIGKHGAKLLEDGD 149 >gnl|CDD|149078 pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues. Length = 43 Score = 29.7 bits (68), Expect = 1.5 Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 26 TALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTA 60 AL++PV+L + +V++ R Y L+ AA+ A Sbjct: 7 FALVLPVLLLLLFGIVELGRLFYARQVLQNAAREA 41 >gnl|CDD|183821 PRK12899, secA, preprotein translocase subunit SecA; Reviewed. Length = 970 Score = 29.8 bits (67), Expect = 1.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 204 FGQPADRTVKSYSSQNGKVGIRDEKLSP 231 FG +R +K + KV DEK S Sbjct: 9 FGSSQERILKRFQKLVEKVNAYDEKFSS 36 >gnl|CDD|129946 TIGR00868, hCaCC, calcium-activated chloride channel protein 1. distributions. found a row in 1A13.INFO that was not parsed out. Length = 863 Score = 28.7 bits (64), Expect = 3.5 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 15/71 (21%) Query: 335 GSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAK 394 G T+I ++ A+ I S ++ + E IVLLTDGE DN I+ C + Sbjct: 381 GGTSICSGLKAAFQVIKKS-----YQSTDGSE----IVLLTDGE---DN--TISSCFEEV 426 Query: 395 SQ-GIRIMTIA 404 Q G I TIA Sbjct: 427 KQSGAIIHTIA 437 >gnl|CDD|179323 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 458 Score = 28.5 bits (64), Expect = 3.5 Identities = 17/87 (19%), Positives = 35/87 (40%), Gaps = 7/87 (8%) Query: 47 SYYEHALKQAAQTAIITASVP----LIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNL 102 S+ + + + A++T P + + +EE KN F + Q + L+ N +N + Sbjct: 175 SFQLMTMDVSPEVAVVTNLSPNHLDVHKDMEEYIDAKKNIFKY--QSENDLLVLNKDNEI 232 Query: 103 KKNFTDREVRDIVRDTAVEMNPRKSAY 129 E + V + + + AY Sbjct: 233 TNGMEK-EAKGDVVKFSRKEKVYEGAY 258 >gnl|CDD|162252 TIGR01210, TIGR01210, conserved hypothetical protein TIGR01210. This family of exclusively archaeal proteins has no characterized close homologs. Several rounds of PSI-BLAST with a stringent cutoff of 1e-8 shows apparent similarity of the central region of this family to the central regions of the oxygen-independent coproporphyrinogen III dehydrogenase HemN and to other enzymes. Length = 313 Score = 27.1 bits (60), Expect = 9.3 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 9/63 (14%) Query: 276 DALASVIRSIKKIDNVNDTVRMGAT---------FFNDRVISDPSFSWGVHKLIRTIVKT 326 +A+A +I SI+K V DTV + T F +R + P + W V ++++ K Sbjct: 186 EAIADMISSIRKCIPVTDTVSINPTNVQKGTLVEFLWNRGLYRPPWLWSVAEVLKEAKKI 245 Query: 327 FAI 329 A Sbjct: 246 GAE 248 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.133 0.378 Gapped Lambda K H 0.267 0.0802 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 7,281,338 Number of extensions: 460531 Number of successful extensions: 943 Number of sequences better than 10.0: 1 Number of HSP's gapped: 942 Number of HSP's successfully gapped: 15 Length of query: 458 Length of database: 5,994,473 Length adjustment: 97 Effective length of query: 361 Effective length of database: 3,898,497 Effective search space: 1407357417 Effective search space used: 1407357417 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (26.4 bits)