RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780389|ref|YP_003064802.1| hypothetical protein
CLIBASIA_01370 [Candidatus Liberibacter asiaticus str. psy62]
         (45 letters)



>gnl|CDD|36123 KOG0905, KOG0905, KOG0905, Phosphoinositide 3-kinase [Signal
            transduction mechanisms].
          Length = 1639

 Score = 26.5 bits (58), Expect = 1.8
 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%)

Query: 15   FLKFN-GEGGYSKYYRNFIISCRTYRVFTAI 44
             +K N  E  Y K   NFI SC  + V T +
Sbjct: 1167 LMKHNPSEFEYEKAVENFIYSCAGWCVATYV 1197


>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine
          Kinases, Receptor tyrosine kinase-like Orphan
          Receptors.  Protein Tyrosine Kinase (PTK) family;
          Receptor tyrosine kinase-like Orphan Receptor (Ror)
          subfamily; catalytic (c) domain. The Ror subfamily
          consists of Ror1, Ror2, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Ror
          proteins are orphan receptor tyr kinases (RTKs)
          containing an extracellular region with
          immunoglobulin-like, cysteine-rich, and kringle
          domains, a transmembrane segment, and an intracellular
          catalytic domain. Ror RTKs are unrelated to the nuclear
          receptor subfamily called retinoid-related orphan
          receptors (RORs). RTKs are usually activated through
          ligand binding, which causes dimerization and
          autophosphorylation of the intracellular tyr kinase
          catalytic domain. Ror kinases are expressed in many
          tissues during development. They play important roles
          in bone and heart formation. Mutations in human Ror2
          result in two different bone development genetic
          disorders, recessive Robinow syndrome and brachydactyly
          type B. Drosophila Ror is expressed only in the
          developing nervous system during neurite outgrowth and
          neuronal differentiation, suggesting a role for
          Drosophila Ror in neural development. More recently,
          mouse Ror1 and Ror2 have also been found to play an
          important role in regulating neurite growth in central
          neurons. Ror1 and Ror2 are believed to have some
          overlapping and redundant functions.
          Length = 283

 Score = 24.7 bits (54), Expect = 5.3
 Identities = 8/20 (40%), Positives = 13/20 (65%)

Query: 10 MGNIRFLKFNGEGGYSKYYR 29
          +  +RFL+  GEG + K Y+
Sbjct: 4  LSAVRFLEELGEGAFGKVYK 23


>gnl|CDD|119426 cd05166, PI3Kc_II, Phosphoinositide 3-kinase (PI3K), class II,
           catalytic domain; The PI3K catalytic domain family is
           part of a larger superfamily that includes the catalytic
           domains of other kinases such as the typical
           serine/threonine/tyrosine protein kinases (PKs),
           aminoglycoside phosphotransferase, choline kinase, and
           RIO kinases. PI3Ks catalyze the transfer of the
           gamma-phosphoryl group from ATP to the 3-hydroxyl of the
           inositol ring of D-myo-phosphatidylinositol (PtdIns) or
           its derivatives. PI3Ks play an important role in a
           variety of fundamental cellular processes, including
           cell motility, the Ras pathway, vesicle trafficking and
           secretion, immune cell activation and apoptosis. They
           can be divided into three main classes (I, II, and III),
           defined by their substrate specificity, regulation, and
           domain structure. Class II PI3Ks preferentially use
           PtdIns as a substrate to produce PtdIns(3)P, but can
           also phosphorylate PtdIns(4)P. They function as monomers
           and do not associate with any regulatory subunits. Class
           II enzymes contain an N-terminal Ras binding domain, a
           lipid binding C2 domain, a PI3K homology domain of
           unknown function, an ATP-binding cataytic domain, a Phox
           homology (PX) domain, and a second C2 domain at the
           C-terminus. They are activated by a variety of stimuli
           including chemokines, cytokines, lysophosphatidic acid
           (LPA), insulin, and tyrosine kinase receptors..
          Length = 353

 Score = 24.7 bits (54), Expect = 6.2
 Identities = 12/31 (38%), Positives = 14/31 (45%), Gaps = 1/31 (3%)

Query: 15  FLKFN-GEGGYSKYYRNFIISCRTYRVFTAI 44
            +K N  E  Y K   NFI SC    V T +
Sbjct: 173 LMKHNPSELEYEKAVENFIYSCAGCCVATYV 203


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.338    0.153    0.503 

Gapped
Lambda     K      H
   0.267   0.0794    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 629,431
Number of extensions: 22151
Number of successful extensions: 110
Number of sequences better than 10.0: 1
Number of HSP's gapped: 110
Number of HSP's successfully gapped: 4
Length of query: 45
Length of database: 6,263,737
Length adjustment: 18
Effective length of query: 27
Effective length of database: 5,874,775
Effective search space: 158618925
Effective search space used: 158618925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 51 (23.3 bits)