>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation. They are vital for DNA/RNA synthesis, cell division, macromolecular metabolism and growth. The enzymes generate NTPs or their deoxy derivatives by terminal (gamma) phosphotransfer from an NTP such as ATP or GTP to any nucleoside diphosphate (NDP) or its deoxy derivative. The sequence of NDPk has been highly conserved through evolution. There is a single histidine residue conserved in all known NDK isozymes, which is involved in the catalytic mechanism. The first confirmed metastasis suppressor gene was the NDP kinase protein encoded by the nm23 gene. Unicellular organisms generally possess only one gene encoding NDP kinase, while most multicellular organisms possess not only an ortholog that provides most of the NDP kinase enzymatic a

Probab=100.00 E-value=0 Score=343.86 Aligned_cols=130 Identities=45% Similarity=0.806 Sum_probs=128.3 Q ss_pred CEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCEEEEECCCCCHH Q ss_conf 10230455237718987999999972555892100112699999999888514742100122100111577111164017 Q gi|254780390|r 4 EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEAI 83 (140) Q Consensus 4 e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~~k~ff~~lv~~m~sGpv~alvl~g~naV 83 (140) T Consensus 1 ErTl~iIKPdav~~~~~g~Ii~~i~~~Gf~I~~~k~~~lt~~~a~~~Y~~~~~k~ff~~lv~~mtsGpv~~lvl~g~naV 80 (133) T cd00595 1 ERTLALIKPDAVAEGLLGEIIMRIEDAGFEIVAMKELHLTEEQAEEFYVEHKGRPFFPDLVQFMSSGPVVAMILEKDNAV 80 (133) T ss_pred CCEEEEECCCHHCCCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHCCCHHHHHHHHHCCCCEEEEEEECCCHH T ss_conf 91799989315405889999999998799899875022889999999999846341778999963798499998427699 Q ss_pred HHHHHHCCCCCHHHCC---CCCCCHHCCCCHHHEEEEECCCHHHHHHHHHHHC Q ss_conf 8999661889977768---9970001011522100440699899999998726 Q gi|254780390|r 84 SKNREVMGDTDPKKAL---KGTIRNKYGISIGENSIHGSDSLKTALEEISYWF 133 (140) Q Consensus 84 ~~~R~l~Gptdp~~a~---p~tiR~~fg~~~~~N~vH~Sds~e~a~rEi~~fF 133 (140) T Consensus 81 ~~~R~l~Gpt~p~~A~~~~P~siR~~yg~~~~~N~vHgSds~e~A~~Ei~~fF 133 (133) T cd00595 81 GEWREMLGPTNPEIARHLAPGSLRADFGTDVLRNAVHGSDSVESAAREIAFFF 133 (133) T ss_pred HHHHHHHCCCCHHHHHHHCCCCHHHHHCCCCCCCCEECCCCHHHHHHHHHHHC T ss_conf 99998738998278887589865777367777608447899999999998529

HHsearch alignment for GI: 254780390 and conserved domain: cd00595