HHsearch alignment of GI: 254780390 and MMDB domain: 1ehw_A_

>1ehw_A (A:) NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer- OF-prune, transferase; 2.40A {Homo sapiens}
Probab=100.00  E-value=0  Score=333.48  Aligned_cols=138  Identities=34%  Similarity=0.645  Sum_probs=136.3

Q ss_pred             CCCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCEEEEECCCCC
Q ss_conf             63102304552377189879999999725558921001126999999998885147421001221001115771111640
Q gi|254780390|r    2 VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEE   81 (140)
Q Consensus         2 ~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~~k~ff~~lv~~m~sGpv~alvl~g~n   81 (140)
                      ++|+||+||||||++++++|+|+++|+++||.|+++|++++|+++|++||++|+|+|||++|+++|+|||++||+|+|+|
T Consensus        23 ~~e~Tl~iIKPdav~~~~~g~Il~~i~~~Gf~I~~~k~~~lt~~~a~~~y~~~~g~~~f~~lv~~m~sgp~val~l~g~n  102 (162)
T 1ehw_A           23 TRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYN  102 (162)
T ss_dssp             GGCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTT
T ss_pred             CCCEEEEEECCHHHCCCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             44879999892464047799999999986997998774258999999999997488508889998707987999996766


Q ss_pred             HHHHHHHHCCCCCHHHCCCCCCCHHCCCCHHHEEEEECCCHHHHHHHHHHHCCHHHCC
Q ss_conf             1789996618899777689970001011522100440699899999998726856506
Q gi|254780390|r   82 AISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEII  139 (140)
Q Consensus        82 aV~~~R~l~Gptdp~~a~p~tiR~~fg~~~~~N~vH~Sds~e~a~rEi~~fF~~~ei~  139 (140)
                      ||.+||+++|||||++++|+|||++||.+.++|++|||||+++|+||++||||++|++
T Consensus       103 av~~~r~l~Gp~dp~~~~p~slR~~~g~~~~~N~vH~Sds~e~a~rEi~~fF~~~e~~  160 (162)
T 1ehw_A          103 VVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELV  160 (162)
T ss_dssp             HHHHHHHHHCCSSGGGSCTTSHHHHHCCCSSCCSEEECSSHHHHHHHHHHHCCGGGCC
T ss_pred             HHHHHHHHCCCCCHHHCCCCCCHHHHCCCCCCCCEECCCCHHHHHHHHHHCCCHHHCC
T ss_conf             8999874328999112699981244327657618688999999999999739933325