HHsearch alignment of GI: 254780390 and MMDB domain: 2az3_A_

>2az3_A (A:) Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum}
Probab=100.00  E-value=0  Score=342.50  Aligned_cols=138  Identities=44%  Similarity=0.743  Sum_probs=135.3

Q ss_pred             CCCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCEEEEECCCCC
Q ss_conf             63102304552377189879999999725558921001126999999998885147421001221001115771111640
Q gi|254780390|r    2 VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEE   81 (140)
Q Consensus         2 ~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~~k~ff~~lv~~m~sGpv~alvl~g~n   81 (140)
                      ++|+||+|||||||+++++|+|+++|+++||.|+++|++++|+++|++||++|++||||+.|++||+||||++|+|+|+|
T Consensus         7 ~~e~Tl~iIKPdav~~~~~geIi~~i~~~Gf~I~~~k~~~ls~e~a~~~Y~~~~~k~ff~~lv~~m~sgp~v~lvl~g~n   86 (164)
T 2az3_A            7 HDERTFVMVKPDGVQRGLIGDIVTRLETKGLKMVGGKFMRIDEELAHEHYAEHEDKPFFDGLVSFITSGPVFAMVWEGAD   86 (164)
T ss_dssp             CCCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTT
T ss_pred             CCCEEEEEECCCHHHCCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHCCCCCHHCCEEECCCCCEEEEEECCCC
T ss_conf             87548999992443047789999999987998998465337999999999985477201011110366888999832557


Q ss_pred             HHHHHHHHCCCCCHHHCCCCCCCHHCCCCHHHEEEEECCCHHHH--HHHHHHHCCHHHCC
Q ss_conf             17899966188997776899700010115221004406998999--99998726856506
Q gi|254780390|r   82 AISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTA--LEEISYWFARNEII  139 (140)
Q Consensus        82 aV~~~R~l~Gptdp~~a~p~tiR~~fg~~~~~N~vH~Sds~e~a--~rEi~~fF~~~ei~  139 (140)
                      ||.+||+++|||||++++|+|||++||.+.++|++|||||+|+|  +||++||||+++++
T Consensus        87 aV~~~r~l~Gptdp~~~~p~slRa~fg~~~~~N~vH~SDs~e~A~~erEi~~fFp~~~~~  146 (164)
T 2az3_A           87 ATRQVRQLMGATDAQDAAPGTIRGDYGNDLGHNLIHGSDHEDEGANEREIALFFDDDELV  146 (164)
T ss_dssp             HHHHHHHHHCCSSGGGSCTTSHHHHHCCCSSSCSEEECCTTSTTHHHHHHHHHCCTTSSC
T ss_pred             HHHHHHHHHCCCCHHHCCCCCCCCCEEEEECCCCEECCCCHHHHHHHHHHHHCCCHHHHC
T ss_conf             789999985689843469975024324761367266789946733451887514945600