HHsearch results for GI: 254780390 and protein with PDBid: 1u8w_A

>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1
Probab=100.00  E-value=0  Score=353.01  Aligned_cols=136  Identities=38%  Similarity=0.700  Sum_probs=134.3

Q ss_pred             CCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCEEEEECCCCCH
Q ss_conf             31023045523771898799999997255589210011269999999988851474210012210011157711116401
Q gi|254780390|r    3 IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEEA   82 (140)
Q Consensus         3 ~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~~k~ff~~lv~~m~sGpv~alvl~g~na   82 (140)
                      |||||+||||||++++++|+|+++|+++||+|+++|++++|+++|++||++|+|||||+.|++||+||||++|+|+|+||
T Consensus         1 mE~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~lt~e~a~~~Y~~~~~k~~f~~lv~~m~sgp~~al~l~g~~a   80 (149)
T 1u8w_A            1 MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNV   80 (149)
T ss_dssp             CCEEEEEECHHHHHTTCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHTCTTSSSTTHHHHHHHHTSSCEEEEEEESTTH
T ss_pred             CCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEEEEEECCHHHHHHHHHHHCCCCCHHHHHHHHCCCCEEEEECCCCCH
T ss_conf             95359998922653478899999999879989998876188999999998705884089898874689889996257408


Q ss_pred             HHHHHHHCCCCCHHHCCCCCCCHHCCCCHHHEEEEECCCHHHHHHHHHHHCCHHHC
Q ss_conf             78999661889977768997000101152210044069989999999872685650
Q gi|254780390|r   83 ISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEI  138 (140)
Q Consensus        83 V~~~R~l~Gptdp~~a~p~tiR~~fg~~~~~N~vH~Sds~e~a~rEi~~fF~~~ei  138 (140)
                      |..||+++|||||++|.|+||||+||++.++|+||||||+++|+||++||||+++|
T Consensus        81 v~~~r~l~Gpt~p~~a~p~tiR~~fg~~~~~N~vH~Sds~e~A~rEi~~fFp~~~i  136 (149)
T 1u8w_A           81 VLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPV  136 (149)
T ss_dssp             HHHHHHHHCCSSTTTCCTTSHHHHHCCSTTSCSEEECSSHHHHHHHHHHHCTTCCC
T ss_pred             HHHHHHHHCCCCCCCCCCCCHHHHHCCCCCCCCEECCCCHHHHHHHHHHCCCCCCC
T ss_conf             99999986669857589997168755866754859999999999999971991015