HHSEARCH alignment of GI: 254780390 and SCOP domain: d1s57a_

Alignment
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]}
Probab=100.00  E-value=0  Score=357.23  Aligned_cols=138  Identities=34%  Similarity=0.650  Sum_probs=136.0

Q ss_pred             CCCEEEEEECCHHHHCCCHHHHHHHHHHCCCEEEEHHHCCCCHHHHHHHHHHHCCCCCCCHHHHHCCCCCEEEEECCCCC
Q ss_conf             63102304552377189879999999725558921001126999999998885147421001221001115771111640
Q gi|254780390|r    2 VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMISGPVFLQVLKGEE   81 (140)
Q Consensus         2 ~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~fY~~~~~k~ff~~lv~~m~sGpv~alvl~g~n   81 (140)
                      .||+||+|||||||+++++|+|+++|+++||.|+++|++++|+++|++||.+|++||||++|++||+||||+||+|+|+|
T Consensus         4 ~~e~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~I~~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~mtSGPv~amvl~g~n   83 (153)
T d1s57a_           4 DVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVG   83 (153)
T ss_dssp             CCEEEEEEECHHHHHTTCHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHTGGGTTSSSHHHHHHHHTSSCEEEEEEEETT
T ss_pred             HHHEEEEEECHHHHHCCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHCCHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             21242789890354057899999999987998999872417799999999998030467778754067876664313630


Q ss_pred             HHHHHHHHCCCCCHHHCCCCCCCHHCCCCHHHEEEEECCCHHHHHHHHHHHCCHHHCC
Q ss_conf             1789996618899777689970001011522100440699899999998726856506
Q gi|254780390|r   82 AISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEEISYWFARNEII  139 (140)
Q Consensus        82 aV~~~R~l~Gptdp~~a~p~tiR~~fg~~~~~N~vH~Sds~e~a~rEi~~fF~~~ei~  139 (140)
                      ||+.||+++|||||.+|+|+||||+||.+.++|+||||||+++|+||++||||++||+
T Consensus        84 av~~~r~l~Gpt~p~~A~p~tiR~~yg~~~~~N~vHgSds~esA~rEi~~fFp~~ei~  141 (153)
T d1s57a_          84 VVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELC  141 (153)
T ss_dssp             HHHHHHHHHCCSSTTTSCTTSHHHHHCCBTTBCCEEECSSHHHHHHHHHHHSCTTCCC
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCHHHHEEECCCCEEECCCCHHHHHHHHHHCCCHHHCC
T ss_conf             5656777506898020489982034314246712677899899999999716943400


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]