PSIBLAST alignment of GI: 254780390 and protein with PDB id: 2zua

>gi|256599561|pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174
>gi|256599562|pdb|2ZUA|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174
 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/138 (44%), Positives = 88/138 (63%), Gaps = 2/138 (1%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R LIG IV   ED GL +V  KF  ++++ AE+ Y  H+D+PFF  L
Sbjct: 25  ERTFVMVKPDGVQRGLIGDIVSRFEDRGLKMVGGKFMQIDQELAEEHYGEHEDKPFFDGL 84

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPVF  V +G++A  + R +MG+TDP ++  GTIR  YG+ +G N IHGSD   
Sbjct: 85  VDFITSGPVFAMVWEGQDATRQVRTMMGETDPAESAPGTIRGDYGLDLGRNVIHGSDHED 144

Query: 124 TA--LEEISYWFARNEII 139
                 EI  +F  +E++
Sbjct: 145 EGANEREIELFFDEDELV 162