BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780390|ref|YP_003064803.1| nucleoside diphosphate kinase
[Candidatus Liberibacter asiaticus str. psy62]
         (140 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|154343455|ref|XP_001567673.1| nucleoside diphosphate kinase b [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134065005|emb|CAM43116.1| nucleoside diphosphate kinase b [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 151

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 78/138 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K      +QA+  Y     +PFF
Sbjct: 1   MSSERTFIAIKPDGVQRGLVGEIISRFERKGFKLVALKMLQPTTEQAQGHYKDLASKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+   SGP+   V +G+  +   R ++G T+P  +  GTIR  Y + +G N  HGSD
Sbjct: 61  EGLVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDYAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  E+++WF   EI
Sbjct: 121 SVESAQREVAFWFKVEEI 138


>gi|5726483|gb|AAD48446.1|AF164200_2 nucleoside diphosphate kinase [Trypanosoma brucei]
          Length = 153

 Score =  190 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+RNL+G I+K  E+ G  +V  K      +QA+  Y+    +PF+
Sbjct: 1   MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV    SGP+   V +G   +   R ++G T+P  +L GTIR  + + +G N  HGSD
Sbjct: 61  SGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI++WF   E++
Sbjct: 121 SVESAKREIAFWFKAEELV 139


>gi|74026208|ref|XP_829670.1| nucleoside diphosphate kinase [Trypanosoma brucei TREU927]
 gi|70835056|gb|EAN80558.1| nucleoside diphosphate kinase [Trypanosoma brucei]
          Length = 153

 Score =  190 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+RNL+G I+K  E+ G  +V  K      +QA+  Y+    +PF+
Sbjct: 1   MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV    SGP+   V +G   +   R ++G T+P  +L GTIR  + + +G N  HGSD
Sbjct: 61  SGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI++WF   E++
Sbjct: 121 SVESAKREIAFWFKAEELV 139


>gi|261335695|emb|CBH18689.1| nucleoside diphosphate kinase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 153

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+RNL+G I+K  E+ G  +V  K      +QA+  Y+    +PF+
Sbjct: 1   MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV    SGP+   V +G   +   R ++G T+P  +L GTIR  + + +G N  HGSD
Sbjct: 61  SGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI++WF   E++
Sbjct: 121 SVESAKREIAFWFKTEELV 139


>gi|289743407|gb|ADD20451.1| nucleoside diphosphate kinase [Glossina morsitans morsitans]
          Length = 153

 Score =  189 bits (481), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+RNL+G I+K  E+ G  +V  K      +QA+  Y+    +PF+
Sbjct: 1   MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV    SGP+   V +G   +   R ++G T+P  +L GTIR  + + +G N  HGSD
Sbjct: 61  SGLVSYFSSGPIVGMVWEGLXVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI++WF   E++
Sbjct: 121 SVESAKREIAFWFKTEELV 139


>gi|157874264|ref|XP_001685619.1| nucleoside diphosphate kinase b [Leishmania major]
 gi|330689466|pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate
           Kinase B With Unordered Nucleotide-Binding Loop.
 gi|330689467|pdb|3NGS|A Chain A, Structure Of Leishmania Nucleoside Diphosphate Kinase B
           With Ordered Nucleotide-Binding Loop
 gi|330689468|pdb|3NGS|B Chain B, Structure Of Leishmania Nucleoside Diphosphate Kinase B
           With Ordered Nucleotide-Binding Loop
 gi|330689469|pdb|3NGS|C Chain C, Structure Of Leishmania Nucleoside Diphosphate Kinase B
           With Ordered Nucleotide-Binding Loop
 gi|330689470|pdb|3NGT|A Chain A, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689471|pdb|3NGT|B Chain B, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689472|pdb|3NGT|C Chain C, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689473|pdb|3NGT|D Chain D, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689474|pdb|3NGT|E Chain E, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689475|pdb|3NGT|F Chain F, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689476|pdb|3NGT|G Chain G, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689477|pdb|3NGT|H Chain H, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689478|pdb|3NGT|I Chain I, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689479|pdb|3NGT|J Chain J, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689480|pdb|3NGT|K Chain K, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689481|pdb|3NGT|L Chain L, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689482|pdb|3NGT|M Chain M, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689483|pdb|3NGT|N Chain N, Structure Of Leishmania Ndkb Complexed With Amp.
 gi|330689484|pdb|3NGU|A Chain A, Structure Of Leishmania Ndkb Complexed With Adp.
 gi|330689485|pdb|3NGU|B Chain B, Structure Of Leishmania Ndkb Complexed With Adp.
 gi|5852124|emb|CAB55369.1| nucleoside diphosphate kinase B [Leishmania major]
 gi|68128691|emb|CAJ08823.1| nucleoside diphosphate kinase b [Leishmania major strain Friedlin]
          Length = 151

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I+   E  G  +VA K      +QA+  Y     +PFF
Sbjct: 1   MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLCSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+   SGP+   V +G+  +   R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI++WF  +EI
Sbjct: 121 SVESAEREIAFWFKADEI 138


>gi|154343453|ref|XP_001567672.1| nucleoside diphosphate kinase b [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134065004|emb|CAM43115.1| nucleoside diphosphate kinase b [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 239

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 78/138 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K      +QA+  Y     +PFF
Sbjct: 89  MSSERTFIAIKPDGVQRGLVGEIISRFERKGFKLVALKMLQPTTEQAQGHYKDLASKPFF 148

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+   SGP+   V +G+  +   R ++G T+P  +  GTIR  Y + +G N  HGSD
Sbjct: 149 EGLVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDYAVDVGRNVCHGSD 208

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  E+++WF   EI
Sbjct: 209 SVESAQREVAFWFKVEEI 226


>gi|322822136|gb|EFZ28277.1| nucleoside diphosphate kinase, putative [Trypanosoma cruzi]
          Length = 153

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 51/139 (36%), Positives = 83/139 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I++  E  G  +VA K    + +QA+  Y+    +PF+
Sbjct: 1   MTSERTFIAVKPDGVQRCLVGEIIQRFEKKGYKLVALKMLQPSAEQAQQHYIDLASKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV    SGP+   V +G+  +   R ++G T+P ++L GTIR  + + +G N  HGSD
Sbjct: 61  KDLVAYFSSGPIVGMVWEGKGVVKGGRVLLGATNPAESLPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI++WF   E++
Sbjct: 121 SVDSAKREIAFWFKPEELV 139


>gi|146096937|ref|XP_001467985.1| nucleoside diphosphate kinase b [Leishmania infantum JPCM5]
 gi|146096940|ref|XP_001467986.1| nucleoside diphosphate kinase b [Leishmania infantum JPCM5]
 gi|12055485|emb|CAC20613.1| nucleoside diphosphate kinase [Leishmania infantum]
 gi|134072351|emb|CAM71058.1| nucleoside diphosphate kinase b [Leishmania infantum JPCM5]
 gi|134072352|emb|CAM71059.1| nucleoside diphosphate kinase b [Leishmania infantum JPCM5]
 gi|322501956|emb|CBZ37039.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 151

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I+   E  G  +VA K      +QA+  Y     +PFF
Sbjct: 1   MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKILQPTTEQAQGHYKDLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+   SGP+   V +G+  +   R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PALVKYFSSGPIVCMVWEGKNVVKSGRVLLGATNPADSQPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI++WF  +EI
Sbjct: 121 SVESAEREIAFWFKADEI 138


>gi|297272588|ref|XP_001096144.2| PREDICTED: hypothetical protein LOC707717 [Macaca mulatta]
          Length = 381

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 230 MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPF 289

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 290 FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 349

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 350 DSVKSAEKEISLWFKPEELV 369



 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 63/110 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 119 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYIDLKDRPFFAGL 178

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 179 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 228


>gi|71667532|ref|XP_820714.1| nucleoside diphosphate kinase [Trypanosoma cruzi strain CL Brener]
 gi|70886070|gb|EAN98863.1| nucleoside diphosphate kinase, putative [Trypanosoma cruzi]
          Length = 153

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 51/139 (36%), Positives = 82/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I++  E  G  +VA K    + +QA+  Y+    +PF+
Sbjct: 1   MTSERTFIAVKPDGVQRCLVGEIIQRFEKKGYKLVALKMLQPSAEQAQQHYIDLASKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV    SGP+   V +G+  +   R ++G T+P  +L GTIR  + + +G N  HGSD
Sbjct: 61  KDLVAYFSSGPIVGMVWEGKGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI++WF   E++
Sbjct: 121 SVDSAKREIAFWFKPEELV 139


>gi|260893889|ref|YP_003239986.1| Nucleoside-diphosphate kinase [Ammonifex degensii KC4]
 gi|260866030|gb|ACX53136.1| Nucleoside-diphosphate kinase [Ammonifex degensii KC4]
          Length = 149

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I+  LE  G  ++  K   +  + AE  Y  H+ +PFFP 
Sbjct: 1   MERTFVMVKPDGVQRGLVGEIISRLEKRGYKLIGLKMLRLTPEMAEKHYAEHRGKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV   V +G+  ++  RE+MG TDP+KAL GTIR  YGI IG N +HGSDS 
Sbjct: 61  LISYITSGPVVAMVWEGKNVVAAVREMMGATDPQKALPGTIRGTYGIDIGRNVVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
            TA  EI+ +F+  E++
Sbjct: 121 ATAEREINLFFSPEELV 137


>gi|322494390|emb|CBZ29691.1| nucleoside diphosphate kinase b [Leishmania mexicana
           MHOM/GT/2001/U1103]
 gi|322494391|emb|CBZ29692.1| nucleoside diphosphate kinase b [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 151

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 79/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L G I+   E  G  +VA K      +QAE  Y     +PFF
Sbjct: 1   MSSERTFIAVKPDGVQRGLAGEIICRFERKGYKLVALKMLQPTTEQAEGHYKDLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+   SGP+   V +G+  +   R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PALVKYFSSGPIVCMVWEGKNVVKGGRMLLGATNPADSHPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI++WF  +E+
Sbjct: 121 SVESAEREIAFWFKADEL 138


>gi|239827500|ref|YP_002950124.1| nucleoside diphosphate kinase [Geobacillus sp. WCH70]
 gi|239807793|gb|ACS24858.1| Nucleoside-diphosphate kinase [Geobacillus sp. WCH70]
          Length = 149

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 94/138 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           ++++TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 1   MMQRTFIMVKPDGVQRNLIGEIVARFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P++A  GTIR  YG+++G+N IHGSDS
Sbjct: 61  ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDYGLTVGKNVIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EI  +F   E++
Sbjct: 121 PESAEREIRLFFKEEELV 138


>gi|225181027|ref|ZP_03734474.1| Nucleoside-diphosphate kinase [Dethiobacter alkaliphilus AHT 1]
 gi|225168224|gb|EEG77028.1| Nucleoside-diphosphate kinase [Dethiobacter alkaliphilus AHT 1]
          Length = 150

 Score =  188 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 53/137 (38%), Positives = 83/137 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+RNL G I+   E  G  +V  K   +  + A   Y  H+ +PF+ E
Sbjct: 1   MERTYVMVKPDGVQRNLAGEIISRFEKKGFQLVGLKLMQITPELAGKHYGEHEGKPFYGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV   V +G+  +S  R +MG T+P +A  GTIR  Y + +G N +HGSDS 
Sbjct: 61  LIDFITSGPVVAMVWQGQNVVSVIRNMMGKTNPAEAAPGTIRGDYAVFMGNNVVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F+  E++
Sbjct: 121 ESAEREINLFFSPEELV 137


>gi|22297811|ref|NP_681058.1| nucleoside diphosphate kinase [Thermosynechococcus elongatus BP-1]
 gi|34222690|sp|Q8DM56|NDK_THEEB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|22293988|dbj|BAC07820.1| nucleoside diphosphate kinase [Thermosynechococcus elongatus BP-1]
          Length = 150

 Score =  188 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 85/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G+I++  E  G  +V  K   ++R+ AE  Y  HKD+PFFP 
Sbjct: 1   MERTFLAIKPDGVQRGLVGTIIQRFEQKGYTLVGLKLMRVSRELAEQHYGEHKDKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V +G   I+  R+++G T+P  A  GT+R  + + +G N IHGSDS 
Sbjct: 61  LVNFITSGPVVAMVWEGRGVIANARKLIGATNPLNAEPGTLRGDFAVDVGRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+ WF   E++
Sbjct: 121 ENAEREINLWFQTQELV 137


>gi|321476694|gb|EFX87654.1| hypothetical protein DAPPUDRAFT_306467 [Daphnia pulex]
          Length = 154

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T+ MIKPD V+R L+G I+K  E  G  +VA KF     +  +  Y     RPFF  L
Sbjct: 6   ERTYLMIKPDGVQRGLVGEILKRFEQKGFKLVALKFLQPTEELLQKHYADLSGRPFFAGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R+++G+T+P  +  GTIR  + + +G N +HGSDS++
Sbjct: 66  VKYMASGPVVAMVWEGLNIVKTGRQMLGETNPADSKPGTIRGDFCVQVGRNIMHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFKDEELV 141


>gi|332246346|ref|XP_003272315.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 1 [Nomascus
           leucogenys]
          Length = 196

 Score =  187 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 49  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 108

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 109 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 168

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 169 SAEKEIGLWFHPEELV 184


>gi|78044290|ref|YP_359087.1| nucleoside diphosphate kinase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|90110368|sp|Q3AFJ7|NDK_CARHZ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|77996405|gb|ABB15304.1| nucleoside diphosphate kinase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 149

 Score =  187 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I+   E  G  +V  K   ++R+ AE  Y  HK +PFF  
Sbjct: 1   MERTFIMVKPDGVQRGLVGEIISRFEKRGFKLVGLKLMQISRELAETHYGEHKGKPFFEG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV   V +G+E I+  RE+MG T+P KA  GTIR  YGI +G N IHGSDS 
Sbjct: 61  LLNFITSGPVVAMVWEGKEVIATAREMMGATNPLKAQPGTIRGTYGIDVGRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F   E++
Sbjct: 121 ESAAREIALFFKEEELL 137


>gi|327301623|ref|XP_003235504.1| nucleoside-diphosphate kinase [Trichophyton rubrum CBS 118892]
 gi|326462856|gb|EGD88309.1| nucleoside-diphosphate kinase [Trichophyton rubrum CBS 118892]
          Length = 153

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E+ G  +VA K    +++  E  Y     +PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLVTPSKEHLETHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  NGLVSYMLSGPICAMVWEGRDAVKTGRVLLGATNPADSAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKEGEVL 139


>gi|295398946|ref|ZP_06808928.1| Nucleoside-diphosphate kinase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110447|ref|YP_003988763.1| nucleoside-diphosphate kinase [Geobacillus sp. Y4.1MC1]
 gi|294978412|gb|EFG54008.1| Nucleoside-diphosphate kinase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215548|gb|ADP74152.1| Nucleoside-diphosphate kinase [Geobacillus sp. Y4.1MC1]
          Length = 148

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 93/137 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF E
Sbjct: 1   MERTFIMVKPDGVQRNLIGEIVARFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+P++A  GTIR  YG+++G+N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGENVIATARQMMGKTNPQEAAPGTIRGDYGLTVGKNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F   E++
Sbjct: 121 ESAEREIRLFFKEEELV 137


>gi|59859083|gb|AAX09326.1| nucleoside diphosphate kinase Nm23-SD1 [Suberites domuncula]
          Length = 151

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 87/139 (62%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R L+G I+K  E  G  +VA KF   + K   + Y     +PFF
Sbjct: 1   MTTERTYIMIKPDGVQRGLMGDIIKRFEQKGFKMVAMKFMQPSEKLLSEHYADLSKKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+ M + PV   V +G+ A++  R+++G+TDP K+  GTIR  + I IG N  HGSD
Sbjct: 61  PGLVKFMATSPVCCMVWEGQGAVATGRQMLGETDPAKSKPGTIRGDFCIHIGRNICHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI+ WF   E++
Sbjct: 121 SVESANKEIALWFKPEELV 139


>gi|195445928|ref|XP_002070547.1| GK10972 [Drosophila willistoni]
 gi|194166632|gb|EDW81533.1| GK10972 [Drosophila willistoni]
          Length = 153

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 66  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAEKEIALWFNEKELV 141


>gi|326480667|gb|EGE04677.1| nucleoside diphosphate kinase A [Trichophyton equinum CBS 127.97]
          Length = 153

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 79/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K    +++  E  Y     +PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLVGPIISRFEARGFKLVAMKLVTPSKEHLETHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G  A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  NGLVSYMLSGPICAMVWEGRNAVKTGRVLLGATNPADSAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKDGEVL 139


>gi|11498373|ref|NP_069601.1| nucleoside diphosphate kinase (ndk) [Archaeoglobus fulgidus DSM
           4304]
 gi|6225755|sp|O29491|NDK_ARCFU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|2649839|gb|AAB90470.1| nucleoside diphosphate kinase (ndk) [Archaeoglobus fulgidus DSM
           4304]
          Length = 151

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 92/137 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G ++  LE  GL +VA K  W+ R+ AE+ Y  H+++PFF  
Sbjct: 1   MERTFVMVKPDGVQRGLVGEVIGRLERKGLKIVAMKMLWIAREMAENHYAEHREKPFFSA 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V++G+ AI   R ++G T+P +A  GTIR  +G+ +G N +H SDS 
Sbjct: 61  LVDYITSGPVVAMVVEGKNAIKVVRTLVGATNPAEAAPGTIRGDFGLDVGRNVVHASDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EIS +F+ +EI+
Sbjct: 121 QSAEREISLFFSDDEIV 137


>gi|195931949|gb|ACG56674.1| nucleoside diphosphate kinase b [Leishmania donovani]
          Length = 151

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 79/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I+   E  G  +VA K      +QA+  Y     +PFF
Sbjct: 1   MSSERTFIAVKPDGVQRGLVGEIIARFERKGYKLVALKIPQPTTEQAQGHYGDLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+   SGP+   V +G   +   R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PALVKYFSSGPIVCMVWEGRNVVKSGRVLLGATNPVDSQPGTIRGDFAVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI++WF  +EI
Sbjct: 121 SVESAEREIAFWFKADEI 138


>gi|326469007|gb|EGD93016.1| nucleoside diphosphate kinase [Trichophyton tonsurans CBS 112818]
          Length = 153

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 79/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K    +++  E  Y     +PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLVGPIISRFEARGFKLVAMKLVTPSKEHLETHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G  A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  NGLVSYMLSGPICAMVWEGRNAVKTGRVLLGATNPADSAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKEGEVL 139


>gi|194764911|ref|XP_001964571.1| GF22983 [Drosophila ananassae]
 gi|190614843|gb|EDV30367.1| GF22983 [Drosophila ananassae]
          Length = 152

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 5   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSSRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 65  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFTEKELV 140


>gi|121718351|ref|XP_001276183.1| nucleoside diphosphate kinase [Aspergillus clavatus NRRL 1]
 gi|119404381|gb|EAW14757.1| nucleoside diphosphate kinase [Aspergillus clavatus NRRL 1]
          Length = 153

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E+ G  +VA K     + Q E  Y    D+PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLVGPIISRFENRGFKLVAMKLVSPPKSQLEQHYQDLSDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  AGLVSYMLSGPICAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E+I
Sbjct: 121 SVENAKKEIALWFKPEELI 139


>gi|55583905|sp|Q6XI71|NDKA_DROYA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Abnormal wing disks protein
 gi|38048163|gb|AAR09984.1| similar to Drosophila melanogaster awd [Drosophila yakuba]
          Length = 150

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 3   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 62

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 63  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 122

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 123 SAEKEIALWFNEKELV 138


>gi|315049363|ref|XP_003174056.1| nucleoside diphosphate kinase A [Arthroderma gypseum CBS 118893]
 gi|311342023|gb|EFR01226.1| nucleoside diphosphate kinase A [Arthroderma gypseum CBS 118893]
          Length = 153

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K    +++  E  Y     +PFF
Sbjct: 1   MSTEQTFIAIKPDGVQRGLVGPIISRFESRGFKLVAMKLVTPSKEHLETHYSDLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  KGLVTYMLSGPICAMVWEGRDAVKTGRVLLGATNPADSAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKEGEVL 139


>gi|296817137|ref|XP_002848905.1| nucleoside diphosphate kinase A [Arthroderma otae CBS 113480]
 gi|238839358|gb|EEQ29020.1| nucleoside diphosphate kinase A [Arthroderma otae CBS 113480]
          Length = 153

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K    +++  E  Y     +PFF
Sbjct: 1   MSTEQTFIAIKPDGVQRGLVGPIISRFESRGFKLVAMKLVTPSKEHLETHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  KGLVTYMLSGPICAMVWEGRDAVKTGRTILGATNPLDSAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKEGEVL 139


>gi|295666938|ref|XP_002794019.1| nucleoside diphosphate kinase [Paracoccidioides brasiliensis Pb01]
 gi|226277672|gb|EEH33238.1| nucleoside diphosphate kinase [Paracoccidioides brasiliensis Pb01]
          Length = 152

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 78/138 (56%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  IKPD V+R L+G I+   E+ G  + A K    +++  E  Y     +PFF 
Sbjct: 3   ASEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAIKLVTPSKEHLEKHYEDLSSKPFFN 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M+SGP+   V +G   +   R ++G T+P  +  GTIR  Y I +G N  HGSDS
Sbjct: 63  GLVSYMLSGPICAMVWEGRNVVKTGRAILGATNPADSAPGTIRGDYAIDVGRNVCHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           +++A +EI+ WF   E++
Sbjct: 123 VESAKKEIALWFKPEELV 140


>gi|70984978|ref|XP_747995.1| nucleoside diphosphate kinase [Aspergillus fumigatus Af293]
 gi|74663184|sp|Q7Z8P9|NDK_ASPFU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|32527512|gb|AAP85295.1| nucleoside diphosphate kinase [Aspergillus fumigatus]
 gi|66845623|gb|EAL85957.1| nucleoside diphosphate kinase [Aspergillus fumigatus Af293]
 gi|159126081|gb|EDP51197.1| nucleoside diphosphate kinase [Aspergillus fumigatus A1163]
          Length = 153

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E+ G  +VA K     + Q E  Y    D+PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLVSPPQSQLEQHYADLSDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G + +   R ++G T+P  +  GTIR  + I +G N  HGSD
Sbjct: 61  KGLVSYMLSGPICAMVWEGRDVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E+I
Sbjct: 121 SVENAKKEIALWFKPEELI 139


>gi|321476712|gb|EFX87672.1| hypothetical protein DAPPUDRAFT_306455 [Daphnia pulex]
          Length = 154

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T+ MIKPD V+R L+G I+K  E  G  +VA KF     +  +  Y     RPFF  L
Sbjct: 6   ERTYLMIKPDGVQRGLVGEIIKRFEQKGFKLVALKFVQPTEEMLQKHYADLSGRPFFAGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R+++G+T+P  +  GTIR  + I +G N +HGSDS++
Sbjct: 66  VKYMASGPVVAMVWEGLNIVKTGRQMLGETNPADSKPGTIRGDFCIQVGRNIMHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFKDEELV 141


>gi|284161614|ref|YP_003400237.1| nucleoside-diphosphate kinase [Archaeoglobus profundus DSM 5631]
 gi|284011611|gb|ADB57564.1| Nucleoside-diphosphate kinase [Archaeoglobus profundus DSM 5631]
          Length = 149

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG I+  LE  GL +VA K   + R  AE  Y  HK +PFF  
Sbjct: 1   MERTFVMIKPDGVQRCLIGEIISRLEKKGLKIVAMKMMKIERDLAERHYAEHKGKPFFES 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V++G+ AI   R ++G T+P +A  GTIR  +G+ +G N IH SDS 
Sbjct: 61  LVSYVTSGPVVAMVVEGKNAIKIVRTLVGATNPAEAAPGTIRGDFGMEVGRNVIHASDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F  +EI+
Sbjct: 121 ESAEREIALFFKPDEIV 137


>gi|156375296|ref|XP_001630017.1| predicted protein [Nematostella vectensis]
 gi|156217030|gb|EDO37954.1| predicted protein [Nematostella vectensis]
          Length = 165

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E  G  +VA K    + +  +  Y      PF+P L
Sbjct: 17  ERTFIMVKPDGVQRGLVGEIIKRFEQKGFKLVALKMVQESEEHLKKHYADLAHLPFYPGL 76

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + + IG N IHGSDS  
Sbjct: 77  VKFMSSGPVVAMVWEGAGVVKTGRVMLGETNPADSKPGTIRGDFCVHIGRNIIHGSDSTD 136

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF+  E++
Sbjct: 137 SANKEIALWFSPKELV 152


>gi|195354502|ref|XP_002043736.1| GM16421 [Drosophila sechellia]
 gi|127980|sp|P08879|NDKA_DROME RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Abnormal wing disks protein;
           AltName: Full=Killer of prune protein
 gi|515218|pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila
 gi|515219|pdb|1NDL|B Chain B, The Awd Nucleotide Diphosphate Kinase From Drosophila
 gi|515220|pdb|1NDL|C Chain C, The Awd Nucleotide Diphosphate Kinase From Drosophila
 gi|7635|emb|CAA31500.1| unnamed protein product [Drosophila melanogaster]
 gi|21064703|gb|AAM29581.1| RH27794p [Drosophila melanogaster]
 gi|194128936|gb|EDW50979.1| GM16421 [Drosophila sechellia]
          Length = 153

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 66  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAEKEIALWFNEKELV 141


>gi|225683570|gb|EEH21854.1| nucleoside diphosphate kinase [Paracoccidioides brasiliensis Pb03]
 gi|226287191|gb|EEH42704.1| nucleoside diphosphate kinase [Paracoccidioides brasiliensis Pb18]
          Length = 152

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 78/138 (56%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  IKPD V+R L+G I+   E+ G  + A K    +++  E  Y     +PFF 
Sbjct: 3   ASEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAIKLVTPSKEHLEKHYEDLSSKPFFN 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M+SGP+   V +G   +   R ++G T+P  +  GTIR  Y I +G N  HGSDS
Sbjct: 63  GLVSYMLSGPICAMVWEGRNVVKTGRTILGATNPADSAPGTIRGDYAIDVGRNVCHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           +++A +EI+ WF   E++
Sbjct: 123 VESAKKEIALWFKPEELV 140


>gi|307193761|gb|EFN76442.1| Nucleoside diphosphate kinase [Harpegnathos saltator]
          Length = 153

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R LIG I++  ED G  ++A K  W      ++ Y     +PFF  L
Sbjct: 6   ERTFIMIKPDGVQRGLIGKIIQRFEDKGFKLLAMKMVWPTESLLKEHYADLASKPFFSGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +   R ++G+T+PK +  GTIR  Y I +G N IHGSDS++
Sbjct: 66  VKYMSSGPVVPMVWEGLDVVKTGRVMLGETNPKDSAPGTIRGDYCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E+I
Sbjct: 126 SAKKEIKLWFGEKEVI 141


>gi|79160090|gb|AAI07895.1| NME1-NME2 protein [Homo sapiens]
 gi|119614969|gb|EAW94563.1| hCG2001850, isoform CRA_a [Homo sapiens]
          Length = 292

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 141 MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 200

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 201 FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 260

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 261 DSVKSAEKEISLWFKPEELV 280



 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 63/110 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 30  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 89

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 90  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 139


>gi|195144420|ref|XP_002013194.1| GL23527 [Drosophila persimilis]
 gi|198452902|ref|XP_002137559.1| GA27289 [Drosophila pseudoobscura pseudoobscura]
 gi|194102137|gb|EDW24180.1| GL23527 [Drosophila persimilis]
 gi|198132126|gb|EDY68117.1| GA27289 [Drosophila pseudoobscura pseudoobscura]
          Length = 153

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 66  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAEKEIALWFNEKELV 141


>gi|294459457|gb|ADE75591.1| abnormal wing disc protein [Antheraea pernyi]
          Length = 153

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 84/137 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G+I++  E  G  +V  KF W + +  +  Y     RPFFP L
Sbjct: 6   ERTFLMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R+++G T+P  +  GTIR    I +G N IHGSDS++
Sbjct: 66  VKYMSSGPVVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEIIG 140
           +A +EI+ WF   E++G
Sbjct: 126 SANKEIALWFTEKEVVG 142


>gi|119498855|ref|XP_001266185.1| nucleoside diphosphate kinase [Neosartorya fischeri NRRL 181]
 gi|119414349|gb|EAW24288.1| nucleoside diphosphate kinase [Neosartorya fischeri NRRL 181]
          Length = 153

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E+ G  +VA K     + Q E  Y    D+PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLVSPPQSQLEQHYADLSDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  KGLVSYMLSGPICAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E+I
Sbjct: 121 SVENAKKEIALWFKPEELI 139


>gi|86605758|ref|YP_474521.1| nucleoside diphosphate kinase [Synechococcus sp. JA-3-3Ab]
 gi|109892793|sp|Q2JVI1|NDK_SYNJA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|86554300|gb|ABC99258.1| nucleoside diphosphate kinase [Synechococcus sp. JA-3-3Ab]
          Length = 149

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+GSI++ LE  G  +V  K   ++++ AE  Y  H++RPFFP 
Sbjct: 1   MERTFIAIKPDGVQRGLVGSIIQRLESRGYQLVGLKLVQVSQELAEAHYAEHRERPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V +G+  I+  R+++G T+P  A  GTIR  +GI IG N +HGSD  
Sbjct: 61  LVKFITSGPVVAMVWQGKGVIAAARKLIGKTNPLDAEPGTIRGDFGIDIGRNLVHGSDGP 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF  +E++
Sbjct: 121 ETAQREIALWFQESELV 137


>gi|158286242|ref|XP_308641.4| AGAP007120-PA [Anopheles gambiae str. PEST]
 gi|157020374|gb|EAA04524.4| AGAP007120-PA [Anopheles gambiae str. PEST]
          Length = 168

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 21  ERTFIMIKPDGVQRGLVGQIMQRFEAKGFKLVAMKFMWPSKELLEKHYADLSARPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G  A+   R+++G T+P  +  GTIR    + +G N IHGSD+++
Sbjct: 81  VTYMSSGPVVPMVWEGLNAVKTGRKMLGATNPADSEPGTIRGDLCVQVGRNIIHGSDAVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 141 SANKEIALWFKDEELV 156


>gi|332246350|ref|XP_003272317.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 3 [Nomascus
           leucogenys]
          Length = 267

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 116 MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPF 175

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 176 FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 235

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A  EIS WF   E++
Sbjct: 236 DSVKSAEREISLWFKPEELV 255



 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 63/110 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 114


>gi|217075338|gb|ACJ86029.1| unknown [Medicago truncatula]
          Length = 230

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T+ M+KPD V+R L+G I+   E  G  ++  K    +++ AE+ Y     R FFP+
Sbjct: 82  VDRTYIMVKPDGVQRGLVGEIISRFEKKGFKLIGLKLFQCSKELAEEHYKDLNQRSFFPK 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L + + SGPV     +G   +   R+++G T+P +A  GTIR  + +  G N IHGSDS 
Sbjct: 142 LSEYITSGPVVSMAWEGVGVVPSARKLIGATNPLQAEPGTIRGDFAVETGRNVIHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 202 ENGEREIALWFKEGELC 218


>gi|242012200|ref|XP_002426823.1| Nucleoside diphosphate kinase, putative [Pediculus humanus
           corporis]
 gi|212511030|gb|EEB14085.1| Nucleoside diphosphate kinase, putative [Pediculus humanus
           corporis]
          Length = 160

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 82/135 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPDAV+R L+G +++  E  G  +V  KF W  ++  E  Y     +PFFP +
Sbjct: 12  ERTFIMIKPDAVQRGLVGKVIQRFEQKGFKLVGLKFLWPGKELLEKHYADLSSKPFFPGM 71

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +   R ++G TDPK +  GTIR  + I +G N +HGSDS++
Sbjct: 72  IEYMSSGPVVPMVWEGLNVVKTGRVMLGATDPKDSAPGTIRGDFCIQVGRNGVHGSDSVE 131

Query: 124 TALEEISYWFARNEI 138
           +A +EI  WF   E+
Sbjct: 132 SANKEIKLWFKPEEL 146


>gi|45549037|ref|NP_476761.2| abnormal wing discs [Drosophila melanogaster]
 gi|194904751|ref|XP_001981055.1| GG11858 [Drosophila erecta]
 gi|195505524|ref|XP_002099542.1| awd [Drosophila yakuba]
 gi|45446733|gb|AAF57188.3| abnormal wing discs [Drosophila melanogaster]
 gi|157816348|gb|ABV82168.1| FI01455p [Drosophila melanogaster]
 gi|190655693|gb|EDV52925.1| GG11858 [Drosophila erecta]
 gi|194185643|gb|EDW99254.1| awd [Drosophila yakuba]
          Length = 172

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 25  ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 84

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 85  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 144

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 145 SAEKEIALWFNEKELV 160


>gi|53803002|ref|YP_115279.1| nucleoside diphosphate kinase [Methylococcus capsulatus str. Bath]
 gi|67460644|sp|Q603C1|NDK_METCA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|53756763|gb|AAU91054.1| nucleoside diphosphate kinase [Methylococcus capsulatus str. Bath]
          Length = 143

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAAK   ++R+QAE FY +H++RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEIYSRFEKAGLRIVAAKMAQLSREQAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE AI+KNRE+MG T+P+ A  GTIR  + +SI EN++HGSD
Sbjct: 61  NDLVSFMISGPVMIQVLEGENAIAKNRELMGATNPRDAAPGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
             +TA +EI+Y+F  +E+ 
Sbjct: 121 GPETAAQEIAYFFESDELC 139


>gi|153791847|ref|NP_001093284.1| abnormal wing disc-like protein [Bombyx mori]
 gi|95103130|gb|ABF51506.1| abnormal wing disc-like protein [Bombyx mori]
          Length = 154

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 83/137 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G+I++  E  G  +V  KF W + +  +  Y     RPFFP L
Sbjct: 7   ERTFIMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFPGL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R+++G T+P  +  GTIR    I +G N IHGSDS++
Sbjct: 67  VKYMSSGPVVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRNIIHGSDSVE 126

Query: 124 TALEEISYWFARNEIIG 140
           +A +EI  WF   E++G
Sbjct: 127 SAKKEIGLWFTDKEVVG 143


>gi|195575368|ref|XP_002105651.1| GD16337 [Drosophila simulans]
 gi|194201578|gb|EDX15154.1| GD16337 [Drosophila simulans]
          Length = 172

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 25  ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 84

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 85  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 144

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 145 SAEKEIALWFNEKELV 160


>gi|195390425|ref|XP_002053869.1| GJ24119 [Drosophila virilis]
 gi|194151955|gb|EDW67389.1| GJ24119 [Drosophila virilis]
          Length = 153

 Score =  184 bits (467), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W  +   E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVAMKFVWAQKDLLEKHYADLSSRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 66  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAEKEIALWFNEKELV 141


>gi|318086992|gb|ADV40088.1| nucleoside diphosphate kinase [Latrodectus hesperus]
          Length = 153

 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 85/140 (60%), Gaps = 1/140 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M + E+TF MIKPD V+RNL+G I+   E+ G  +VA KF   +++  E  Y      PF
Sbjct: 1   MAVRERTFIMIKPDGVQRNLVGKIISRFEEKGFKLVAMKFMQASQQLLEQHYADLSSLPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LVQ M  GPV   V +G+  +   R+++G T+P  A  GT+R    I++G N IHGS
Sbjct: 61  FPGLVQYMQMGPVVPMVWEGDNVVKTGRDIIGATNPLNAAPGTLRGDLCINVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+ +A +EI+ WF   E++
Sbjct: 121 DSVPSADKEIALWFKDEELV 140


>gi|38045913|ref|NP_937818.1| nucleoside diphosphate kinase A isoform a [Homo sapiens]
 gi|29468184|gb|AAO85436.1|AF487339_1 NM23-H1 [Homo sapiens]
          Length = 177

 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 30  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 89

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 90  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 149

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 150 SAEKEIGLWFHPEELV 165


>gi|307543980|ref|YP_003896459.1| nucleoside diphosphate kinase [Halomonas elongata DSM 2581]
 gi|27597163|dbj|BAC55152.1| nucleoside diphosphate kinase [Halomonas sp. #593]
 gi|307216004|emb|CBV41274.1| nucleoside diphosphate kinase [Halomonas elongata DSM 2581]
          Length = 141

 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E  GL +VAAK   ++++QAE FY  HK+RPFF
Sbjct: 1   MATERTLSIIKPDAVAKNVIGEIESRFEKAGLKIVAAKMLQLSQEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI+ NR++MG T+PK+A  GTIR  Y  SI  N++HGSD
Sbjct: 61  GDLVGFMTSGPVVVQVLEGENAIAANRDLMGATNPKEAEAGTIRADYAQSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SPESAAREIAYFFEESEIC 139


>gi|323701588|ref|ZP_08113260.1| Nucleoside-diphosphate kinase [Desulfotomaculum nigrificans DSM
           574]
 gi|323533361|gb|EGB23228.1| Nucleoside-diphosphate kinase [Desulfotomaculum nigrificans DSM
           574]
          Length = 149

 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L+G I+   E  G  +V  K   ++R+ AE  Y  H  +PFF  
Sbjct: 1   MERTYLMVKPDGVQRGLVGQIISRFEQRGYKIVGLKMMQISREVAEKHYGEHVGKPFFRG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V++G++ +S  RE+MG T+P KA  GTIR  +G+ +G N IHGSDSL
Sbjct: 61  LVDFITSGPVVAMVVEGKDVVSAAREMMGATNPLKAAPGTIRATFGVDVGRNVIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F   E++
Sbjct: 121 ESAQREIALFFRPEELV 137


>gi|284052737|ref|ZP_06382947.1| nucleoside diphosphate kinase [Arthrospira platensis str. Paraca]
 gi|291565897|dbj|BAI88169.1| nucleoside diphosphate kinase [Arthrospira platensis NIES-39]
          Length = 149

 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LIG I+K  E  G  +V  K    +R+ AE  Y +HK+RPFF +
Sbjct: 1   MERTFLAIKPDGVQRGLIGEIIKRFEAKGFTLVGLKMMKASRQLAEQHYDVHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGP+   V +GE  I+  R+++G T+P  A  GT+R  +GIS+G N IHGSD+ 
Sbjct: 61  LVSFIISGPLVAMVWEGEGVIASARKIIGATNPLNAEPGTLRGDFGISVGRNLIHGSDAP 120

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 121 ETAQKEIALWFKDEELV 137


>gi|331005919|ref|ZP_08329267.1| Nucleoside diphosphate kinase [gamma proteobacterium IMCC1989]
 gi|330420275|gb|EGG94593.1| Nucleoside diphosphate kinase [gamma proteobacterium IMCC1989]
          Length = 142

 Score =  183 bits (466), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV +N+IG I+   E   L + AAK   ++++QAE FY  H +RPFF
Sbjct: 1   MTVQRTLSIIKPDAVAKNVIGEIIARFEQANLTITAAKMLHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A+ KNRE+MG T+P++A  GTIR+ +  SI  N++HGSD
Sbjct: 61  GPLVEFMTSGPVVVQVLEGEGAVLKNRELMGATNPQEAEAGTIRSDFAQSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA  E+ 
Sbjct: 121 SPESAAREIAYFFASEELC 139


>gi|289743463|gb|ADD20479.1| nucleoside diphosphate kinase [Glossina morsitans morsitans]
          Length = 168

 Score =  183 bits (466), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G I++  E  G  +VA KF W ++   E  Y     RPFFP L
Sbjct: 21  ERTFIMIKPDGVQRGLVGKIIERFEQKGFKLVAMKFMWASKDLLEKHYADLSSRPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 81  VSYMNSGPVVPMVWEGLNVVKTGRRMLGETNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 141 SAEKEIALWFDEKELV 156


>gi|119183211|ref|XP_001242666.1| hypothetical protein CIMG_06562 [Coccidioides immitis RS]
 gi|303319681|ref|XP_003069840.1| nucleoside diphosphate kinase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240109526|gb|EER27695.1| nucleoside diphosphate kinase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320034121|gb|EFW16066.1| nucleoside diphosphate kinase [Coccidioides posadasii str.
           Silveira]
          Length = 152

 Score =  183 bits (466), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 84/139 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G I+   E+ G  +VA K    +++  E  Y    D+PFF
Sbjct: 1   MSLEQTFIAIKPDGVQRGLVGPIISRFENRGYKLVAMKLVSPSKEHLEKHYADLSDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  KGLVTYMLSGPICAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF+  E+I
Sbjct: 121 SVENAKKEIALWFSEGELI 139


>gi|35068|emb|CAA35621.1| Nm23 protein [Homo sapiens]
 gi|226527|prf||1516349B nm23 gene
          Length = 180

 Score =  183 bits (466), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 33  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 92

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 93  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 152

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 153 SAEKEIGLWFHPEELV 168


>gi|332376647|gb|AEE63463.1| unknown [Dendroctonus ponderosae]
          Length = 169

 Score =  183 bits (465), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E  G  +VA KF W + +  +  Y     RPFFP L
Sbjct: 21  ERTFIMVKPDGVQRGLVGEILKRFEQKGFKLVALKFVWPSEELLKQHYADLAGRPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G  A+   R ++G T+P  +  GTIR    + +G N IHGSD+++
Sbjct: 81  VKYMSSGPVVPMVWEGLNAVKTGRVLLGATNPADSAPGTIRGDLCVQVGRNIIHGSDAVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 141 SANKEIALWFNEKEVV 156


>gi|138895787|ref|YP_001126240.1| nucleoside diphosphate kinase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267300|gb|ABO67495.1| Nucleoside diphosphate kinase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 194

 Score =  183 bits (465), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 93/138 (67%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 46  MKERTFLMVKPDGVQRNLIGEIVSRFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG 105

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P+ A  GTIR  +G+++G+N IHGSDS
Sbjct: 106 ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQDAAPGTIRGDFGLTVGKNVIHGSDS 165

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EI+ +F   E+I
Sbjct: 166 PQSAEREINLFFKEEELI 183


>gi|327265073|ref|XP_003217333.1| PREDICTED: nucleoside diphosphate kinase A 1-like [Anolis
           carolinensis]
          Length = 150

 Score =  183 bits (465), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 57/138 (41%), Positives = 84/138 (60%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +     + Y+  KDRPF+ 
Sbjct: 1   MSERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKFMHASEDLLREHYIDLKDRPFYA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + + +G N IHGSDS
Sbjct: 61  GLVRYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCVQVGRNIIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
           +++A  EI+ WFA  E++
Sbjct: 121 VESAETEINLWFAPEELV 138


>gi|94966478|dbj|BAE94182.1| nucleoside diphosphate kinase [Geobacillus stearothermophilus]
          Length = 149

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 94/138 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 1   MAERTFLMVKPDGVQRNLIGEIVSRFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P++A  GTIR  +G+++G+N IHGSDS
Sbjct: 61  ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDFGLTVGKNVIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EI+ +F   E++
Sbjct: 121 PQSAEREINLFFKEEELL 138


>gi|66392203|ref|NP_001018146.1| NME1-NME2 protein [Homo sapiens]
 gi|73746297|gb|AAZ82097.1| NM23-LV [Homo sapiens]
 gi|124376250|gb|AAI33032.1| NME1-NME2 readthrough transcript [Homo sapiens]
 gi|124376672|gb|AAI33030.1| NME1-NME2 readthrough transcript [Homo sapiens]
          Length = 267

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 116 MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 175

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 176 FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 235

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 236 DSVKSAEKEISLWFKPEELV 255



 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 63/110 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 114


>gi|195109504|ref|XP_001999324.1| GI24450 [Drosophila mojavensis]
 gi|193915918|gb|EDW14785.1| GI24450 [Drosophila mojavensis]
          Length = 153

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W  ++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVAMKFMWAQKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 66  VNYMSSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAEKEIALWFNEKELV 141


>gi|206580|gb|AAA42017.1| RBL-NDP kinase 18kDa subunit (p18) [Rattus norvegicus]
          Length = 152

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRWMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +EI  WF   E+I
Sbjct: 121 DSVESAEKEIGLWFKPEELI 140


>gi|325297002|ref|NP_001191678.1| nucleoside diphosphate kinase A [Oryctolagus cuniculus]
          Length = 152

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +V+ K    +     + Y+  KDRPF
Sbjct: 1   MANTERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVSLKLMQASEDLLREHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR    + +G N IHGS
Sbjct: 61  FPGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDLCVQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +EIS WF   E++
Sbjct: 121 DSVESAEKEISLWFQPEELV 140


>gi|261417953|ref|YP_003251635.1| nucleoside diphosphate kinase [Geobacillus sp. Y412MC61]
 gi|319767235|ref|YP_004132736.1| nucleoside-diphosphate kinase [Geobacillus sp. Y412MC52]
 gi|261374410|gb|ACX77153.1| Nucleoside-diphosphate kinase [Geobacillus sp. Y412MC61]
 gi|317112101|gb|ADU94593.1| Nucleoside-diphosphate kinase [Geobacillus sp. Y412MC52]
          Length = 149

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 94/138 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 1   MAERTFIMVKPDGVQRNLIGEIVARFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P++A  GTIR  +G+++G+N IHGSDS
Sbjct: 61  ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDFGLTVGKNVIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EIS +F   E++
Sbjct: 121 PQSAEREISLFFKEEELV 138


>gi|126697388|gb|ABO26651.1| nucleoside diphosphate kinase B [Haliotis discus discus]
          Length = 168

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 54/139 (38%), Positives = 83/139 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I+K  E+ G  +VA K    +++  E  Y     +PFF
Sbjct: 18  MAAERTFIAVKPDGVQRGLVGEIMKRFENRGYKLVACKMMTASKEHLEKHYSDLSTKPFF 77

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV   V +G+E +   R ++G T+P ++  GTIR  + I +G N  HGSD
Sbjct: 78  AGLVKYMGSGPVVAMVWEGKEVVKMGRMMLGATNPLQSNPGTIRGDFCIDVGRNICHGSD 137

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A +EI+ WF   E+ 
Sbjct: 138 AVESAQKEIALWFTPEELC 156


>gi|332246348|ref|XP_003272316.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 2 [Nomascus
           leucogenys]
          Length = 152

 Score =  183 bits (464), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A  EIS WF   E++
Sbjct: 121 DSVKSAEREISLWFKPEELV 140


>gi|291405780|ref|XP_002719333.1| PREDICTED: NME1-NME2 protein-like [Oryctolagus cuniculus]
          Length = 267

 Score =  183 bits (464), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 116 MAHLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 175

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 176 FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 235

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 236 DSVKSAEKEISLWFQPEELV 255



 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 64/118 (54%), Gaps = 1/118 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +V+ K    +     + Y+  KDRPF
Sbjct: 1   MANTERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVSLKLMQASEDLLREHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIH 117
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR    + +G    H
Sbjct: 61  FPGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDLCVQVGRTMAH 118


>gi|94468478|gb|ABF18088.1| nucleoside diphosphate kinase [Aedes aegypti]
          Length = 168

 Score =  183 bits (464), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E  G  +VA K  W  ++  E  Y     RPFFP L
Sbjct: 21  ERTFIMVKPDGVQRGLVGKIIKRFEQKGFKLVAMKLMWAEKELLEKHYADLSARPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +  GTIR    + +G N IHGSD+++
Sbjct: 81  VSYMGSGPVVPMVWEGLGVVKTGRQILGATNPADSAPGTIRGDLCVQVGRNIIHGSDAVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 141 SANKEIALWFTEKELV 156


>gi|83647154|ref|YP_435589.1| nucleoside diphosphate kinase [Hahella chejuensis KCTC 2396]
 gi|109892772|sp|Q2SDW0|NDK_HAHCH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|83635197|gb|ABC31164.1| Nucleoside diphosphate kinase [Hahella chejuensis KCTC 2396]
          Length = 142

 Score =  183 bits (464), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAAK   ++++QAE FY  HK+R FF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEIYSRFEKAGLRIVAAKMLHLSQEQAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+LV  M SGPV +Q L+GE AI+ NR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  PDLVAFMTSGPVVVQALEGENAIALNRQLMGATNPKEAEPGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  E++Y+F+ NEI 
Sbjct: 121 SAASAEREVAYFFSENEIC 139


>gi|56420744|ref|YP_148062.1| nucleoside diphosphate kinase [Geobacillus kaustophilus HTA426]
 gi|67460615|sp|Q5KXU2|NDK_GEOKA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56380586|dbj|BAD76494.1| nucleoside-diphosphate kinase [Geobacillus kaustophilus HTA426]
          Length = 149

 Score =  183 bits (464), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 94/138 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 1   MAERTFIMVKPDGVQRNLIGEIVARFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P++A  GTIR  +G+++G+N IHGSDS
Sbjct: 61  ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDFGLTVGKNVIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EIS +F   E++
Sbjct: 121 PQSAKREISLFFKEEELV 138


>gi|257060076|ref|YP_003137964.1| nucleoside diphosphate kinase [Cyanothece sp. PCC 8802]
 gi|256590242|gb|ACV01129.1| Nucleoside-diphosphate kinase [Cyanothece sp. PCC 8802]
          Length = 149

 Score =  183 bits (464), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 89/136 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G ++   E  G  +V  K   ++++ AE  Y +HK+RPFF  
Sbjct: 1   MERTFIMIKPDGVQRGLVGEVISRFEAKGFTLVGMKLMQVSKELAEKHYDVHKERPFFKG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + S PV   V +G+  ++  R+++G T+P  A  GTIR  YG+S+G N IHGSD++
Sbjct: 61  LVEFISSSPVVAMVWEGDGVVASARKLIGATNPLTAEPGTIRGDYGVSVGRNLIHGSDAI 120

Query: 123 KTALEEISYWFARNEI 138
           +TA  EI+ WF+  E+
Sbjct: 121 ETAQTEINLWFSSEEL 136


>gi|387496|gb|AAA39826.1| tumor metastatic process-associated protein NM23 [Mus musculus]
 gi|226526|prf||1516349A nm23 gene
          Length = 166

 Score =  183 bits (464), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y   KDRPFF  L
Sbjct: 19  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQASEDLLKEHYTDLKDRPFFTGL 78

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 79  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 138

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 139 SAEKEISLWFQPEELV 154


>gi|297529621|ref|YP_003670896.1| nucleoside-diphosphate kinase [Geobacillus sp. C56-T3]
 gi|297252873|gb|ADI26319.1| Nucleoside-diphosphate kinase [Geobacillus sp. C56-T3]
          Length = 149

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 95/138 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF M+KPD V+RNLIG IV   E  G  +V+AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 1   MAERTFIMVKPDGVQRNLIGEIVARFEKKGFQLVSAKLMQVSRELAEQHYAEHKERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P++A  GTIR  +G+++G+N IHGSDS
Sbjct: 61  ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDFGLTVGKNVIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EIS +F   E++
Sbjct: 121 PQSAEREISLFFKEEELV 138


>gi|325297017|ref|NP_001191681.1| nucleoside diphosphate kinase A [Ornithorhynchus anatinus]
          Length = 152

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ YL  KDRPF
Sbjct: 1   MATSERTFIAIKPDGVQRGLVGDIIKRFEQKGFRLVALKFVHASEDLLKEHYLDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           +  LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  YAGLVRYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A  EI  WF   E++
Sbjct: 121 DSVESAENEIGLWFGPEELV 140


>gi|145601735|ref|XP_363038.2| nucleoside diphosphate kinase [Magnaporthe oryzae 70-15]
 gi|145010245|gb|EDJ94901.1| nucleoside diphosphate kinase [Magnaporthe oryzae 70-15]
          Length = 153

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K     +   E  Y   KD+PFF
Sbjct: 1   MSTEQTFIAIKPDGVQRGLVGPIISRFEQRGYKLVAIKLVTPGKAHLEQHYADLKDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  AGLVEYMNSGPIAAMVWEGRDAVKTGRTLLGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKEGEVV 139


>gi|197102940|ref|NP_001127154.1| nucleoside diphosphate kinase B [Pongo abelii]
 gi|75062063|sp|Q5RFH3|NDKB_PONAB RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=Histidine protein
           kinase NDKB
 gi|55725237|emb|CAH89484.1| hypothetical protein [Pongo abelii]
          Length = 152

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y   KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYTDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRLMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFKPEELV 140


>gi|19924089|ref|NP_612557.1| nucleoside diphosphate kinase A [Rattus norvegicus]
 gi|462690|sp|Q05982|NDKA_RAT RecName: Full=Nucleoside diphosphate kinase A; Short=NDK A;
           Short=NDP kinase A; AltName: Full=Metastasis inhibition
           factor NM23; AltName: Full=Tumor metastatic
           process-associated protein
 gi|286232|dbj|BAA02635.1| nucleoside diphosphate kinase beta isoform [Rattus norvegicus]
 gi|149053873|gb|EDM05690.1| expressed in non-metastatic cells 1 [Rattus norvegicus]
          Length = 152

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFIQASEDLLKEHYIDLKDRPFFSGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SAEKEISLWFQPEELV 140


>gi|167629387|ref|YP_001679886.1| nucleoside diphosphate kinase [Heliobacterium modesticaldum Ice1]
 gi|226729820|sp|B0TBN6|NDK_HELMI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|167592127|gb|ABZ83875.1| nucleoside diphosphate kinase [Heliobacterium modesticaldum Ice1]
          Length = 149

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+R L+G I+   E  G  +V  KF  + R+ AE  Y  H  +PFF  
Sbjct: 1   MERTYLMIKPDGVQRGLVGEIISRFEKKGFKLVGMKFLRLTREMAEKHYAEHVGKPFFAG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV     +G++ +S +RE+MG T+P KA  GTIR  Y + IG N IHGSDS 
Sbjct: 61  LVDYIISGPVVAMCWEGKDIVSVSREMMGATNPAKAAPGTIRGTYAVDIGRNIIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
            +A  E++ +F  +E++
Sbjct: 121 ASAERELAIYFQSDELV 137


>gi|195036470|ref|XP_001989693.1| GH18934 [Drosophila grimshawi]
 gi|193893889|gb|EDV92755.1| GH18934 [Drosophila grimshawi]
          Length = 153

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W  ++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVAMKFMWAEKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N IHGSD+++
Sbjct: 66  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAQKEIALWFNEKELV 141


>gi|220935220|ref|YP_002514119.1| Nucleoside-diphosphate kinase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254767259|sp|B8GTN8|NDK_THISH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|219996530|gb|ACL73132.1| Nucleoside-diphosphate kinase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 143

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAA+   ++R+QAE FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEIYTRFEKAGLKIVAARMMHLSREQAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE A++ +R++MG T+PK A  GTIR  +  SI EN++HGSD
Sbjct: 61  KDLVDFMISGPVIVQALEGENAVALHRDIMGATNPKDAAPGTIRADFAESIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A +EI+++F   EI 
Sbjct: 121 SLENAGKEIAFFFKPEEIC 139


>gi|312381343|gb|EFR27111.1| hypothetical protein AND_06389 [Anopheles darlingi]
          Length = 153

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF + +++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEAKGFKLVALKFVFPSKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G  A+   R+++G T+P  +  GTIR    + +G N IHGSD+++
Sbjct: 66  VSYMSSGPVVPMVWEGLNAVKTGRKMLGATNPADSEPGTIRGDLCVQVGRNIIHGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFKEEELV 141


>gi|41152367|ref|NP_956264.1| nucleoside diphosphate kinase B [Danio rerio]
 gi|37590341|gb|AAH59486.1| Non-metastatic cells 2-like, protein (NM23B) expressed in [Danio
           rerio]
 gi|55962740|emb|CAI11562.1| novel nucleoside-diphosphate kinase (wu:fk59e05) [Danio rerio]
          Length = 153

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA K    +       Y   KDRPFFP L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M +GPV   V +G   I   R ++G+T+P  +  GTIR  + + +G N IHGSDS++
Sbjct: 66  VSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +EI 
Sbjct: 126 SANTEINLWFKPDEIC 141


>gi|307173082|gb|EFN64212.1| Nucleoside diphosphate kinase [Camponotus floridanus]
          Length = 170

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  ED G  +VA +  W   +  +  Y     RPFFP L
Sbjct: 23  ERTFIMVKPDGVQRGLVGKIIQRFEDKGFKLVAMRMVWPTDELLKQHYADLASRPFFPNL 82

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+PK +  GTIR  + I +G N IHGSDS++
Sbjct: 83  VKYMSSGPVVPMVWEGLNVVKTGRVMLGETNPKDSAPGTIRGDFCIQVGRNIIHGSDSVE 142

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 143 SAKKEINLWFGEKEVI 158


>gi|30584391|gb|AAP36444.1| Homo sapiens non-metastatic cells 2, protein (NM23B) expressed in
           [synthetic construct]
 gi|33303969|gb|AAQ02492.1| non-metastatic cells nucleoside-diphosphate kinase 2 [synthetic
           construct]
 gi|61372297|gb|AAX43819.1| non-metastatic cells 2 [synthetic construct]
 gi|61372303|gb|AAX43820.1| non-metastatic cells 2 [synthetic construct]
          Length = 153

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFKPEELV 140


>gi|320163249|gb|EFW40148.1| nucleoside diphosphate kinase [Capsaspora owczarzaki ATCC 30864]
          Length = 152

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 77/138 (55%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R L+G I+   E  G  +VA K    + +  +  Y     + FF
Sbjct: 1   MSTERTFIAVKPDGVQRGLVGEIIARFEKKGFRLVALKLVTASEELLKQHYADLAGKGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L+  M SGPV   V +G+  +   R+++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  NGLIAYMASGPVAAMVWEGKGVVKTGRKMLGATNPLDSEPGTIRGDYAIDVGRNICHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A +EI+ WF   E+
Sbjct: 121 SVESATKEIALWFKAEEL 138


>gi|317575765|ref|NP_001187018.1| putative oncoprotein nm23 [Ictalurus punctatus]
 gi|10180968|gb|AAG14350.1|AF283993_1 putative oncoprotein nm23 [Ictalurus punctatus]
 gi|308324341|gb|ADO29305.1| nucleoside diphosphate kinase b [Ictalurus punctatus]
          Length = 153

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LIG I+K  E  G  +VA KF   +    +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLIGDIIKRFEQKGFRLVALKFLQASEDLLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VKYMSSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIEVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 126 SANKEISLWFKPEELV 141


>gi|325197199|ref|NP_001191447.1| nucleoside diphosphate kinase B [Macaca mulatta]
          Length = 152

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFKPEELV 140


>gi|311772088|pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1
 gi|311772089|pdb|3L7U|B Chain B, Crystal Structure Of Human Nm23-H1
 gi|311772090|pdb|3L7U|C Chain C, Crystal Structure Of Human Nm23-H1
          Length = 172

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 25  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 84

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 85  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 144

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 145 SAEKEIGLWFHPEELV 160


>gi|295696359|ref|YP_003589597.1| Nucleoside-diphosphate kinase [Bacillus tusciae DSM 2912]
 gi|295411961|gb|ADG06453.1| Nucleoside-diphosphate kinase [Bacillus tusciae DSM 2912]
          Length = 149

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 69/136 (50%), Positives = 92/136 (67%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF MIKPD V+R LIG IV  LE  GL +VAAK   ++R+ AE  Y  H+D+PFF
Sbjct: 1   MALEQTFVMIKPDGVQRGLIGDIVSRLERRGLRLVAAKLMQVSRQLAEKHYEEHRDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  + SGPVF  V +G+ AI+  R++MG T+P++A  GTIR    +SIG N +HGSD
Sbjct: 61  GELVSFITSGPVFAMVWEGQGAIAVVRQMMGKTNPQEAAPGTIRGDLALSIGMNVVHGSD 120

Query: 121 SLKTALEEISYWFARN 136
           S ++A  EI+ WF   
Sbjct: 121 SPESAAREIALWFGGE 136


>gi|152978510|ref|YP_001344139.1| nucleoside diphosphate kinase [Actinobacillus succinogenes 130Z]
 gi|171704256|sp|A6VMK7|NDK_ACTSZ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|150840233|gb|ABR74204.1| Nucleoside-diphosphate kinase [Actinobacillus succinogenes 130Z]
          Length = 141

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 94/139 (67%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV+RNL+G I+   E+ G  +VA K   +N+ QAE FY  H+ +PFF
Sbjct: 1   MALERTLSIIKPDAVERNLVGKILSRFEENGFQIVAMKMLRLNQAQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M S PV + VL+ + A+   R ++G TDP++A +GTIR  +  S   NS+HGSD
Sbjct: 61  DGLVEYMTSAPVVVSVLEKDNAVKDYRTLIGATDPQQAAEGTIRKDFAESRRRNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A+ EI+Y+F  +EI 
Sbjct: 121 SEESAVREIAYFFVESEIC 139


>gi|261202478|ref|XP_002628453.1| nucleoside diphosphate kinase [Ajellomyces dermatitidis SLH14081]
 gi|239590550|gb|EEQ73131.1| nucleoside diphosphate kinase [Ajellomyces dermatitidis SLH14081]
 gi|239612277|gb|EEQ89264.1| nucleoside diphosphate kinase [Ajellomyces dermatitidis ER-3]
 gi|327353230|gb|EGE82087.1| nucleoside diphosphate kinase [Ajellomyces dermatitidis ATCC 18188]
          Length = 152

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 79/138 (57%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  IKPD V+R L+G I+   E+ G  + A K    +++  E  Y     +PFF 
Sbjct: 3   ASEQTFIAIKPDGVQRGLVGPIISRFENRGYKLAAIKLVTPSKEHLEKHYEDLSSKPFFK 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  + I +G N  HGSDS
Sbjct: 63  GLVTYMLSGPICAMVWEGRDAVKTGRAILGATNPLASAPGTIRGDFAIDVGRNVCHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           ++ A +EI+ WF   E++
Sbjct: 123 VENAKKEIALWFKPEELV 140


>gi|258571115|ref|XP_002544361.1| nucleoside diphosphate kinase 1 [Uncinocarpus reesii 1704]
 gi|237904631|gb|EEP79032.1| nucleoside diphosphate kinase 1 [Uncinocarpus reesii 1704]
          Length = 152

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/139 (38%), Positives = 79/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E  G  +VA K    +++  E  Y     +PFF
Sbjct: 1   MSSERTFIAIKPDGVQRGLIGPIISRFETRGYKLVAIKLVSPSKEHLEQHYADLAGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M+SGP+   V +G + +   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  KGLVTYMLSGPICAMVWEGRDVVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   +++
Sbjct: 121 SVENAKKEIALWFGEGDLV 139


>gi|55926145|ref|NP_114021.2| nucleoside diphosphate kinase B [Rattus norvegicus]
 gi|127984|sp|P19804|NDKB_RAT RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=Histidine protein
           kinase NDKB; AltName: Full=P18
 gi|205662|gb|AAA41684.1| nucleoside diphosphate kinase [Rattus norvegicus]
 gi|55778652|gb|AAH86599.1| Non-metastatic cells 2, protein (NM23B) expressed in [Rattus
           norvegicus]
 gi|149053870|gb|EDM05687.1| rCG34286, isoform CRA_a [Rattus norvegicus]
 gi|149053871|gb|EDM05688.1| rCG34286, isoform CRA_a [Rattus norvegicus]
          Length = 152

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +EI  WF   E+I
Sbjct: 121 DSVESAEKEIGLWFKPEELI 140


>gi|154285406|ref|XP_001543498.1| nucleoside-diphosphate kinase [Ajellomyces capsulatus NAm1]
 gi|150407139|gb|EDN02680.1| nucleoside-diphosphate kinase [Ajellomyces capsulatus NAm1]
          Length = 152

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 78/138 (56%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  IKPD V+R L+G I+   E  G  + A K    +++  E  Y     +PFF 
Sbjct: 3   ASEQTFIAIKPDGVQRGLVGPIISRFESRGYKLAAIKLVTPSKEHLEKHYEDLSSKPFFK 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  + I +G N  HGSDS
Sbjct: 63  GLVTYMLSGPICAMVWEGRDAVKTGRAILGATNPLASAPGTIRGDFAIDVGRNVCHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           ++ A +EI+ WF   E++
Sbjct: 123 VENAKKEIALWFKPEELV 140


>gi|208657559|gb|ACI30076.1| nucleoside diphosphate kinase [Anopheles darlingi]
          Length = 168

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF + +++  E  Y     RPFFP L
Sbjct: 21  ERTFIMVKPDGVQRGLVGKIIERFEAKGFKLVALKFVFPSKELLEKHYADLSARPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G  A+   R+++G T+P  +  GTIR    + +G N IHGSD+++
Sbjct: 81  VSYMSSGPVVPMVWEGLNAVKTGRKMLGATNPADSEPGTIRGDLCVQVGRNIIHGSDAVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 141 SANKEIALWFKEEELV 156


>gi|33303891|gb|AAQ02459.1| non-metastatic cells nucleoside-diphosphate kinase 1 [synthetic
           construct]
          Length = 153

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|269962414|ref|ZP_06176764.1| nucleoside diphosphate kinase [Vibrio harveyi 1DA3]
 gi|269832910|gb|EEZ87019.1| nucleoside diphosphate kinase [Vibrio harveyi 1DA3]
          Length = 141

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E  GL +VAAK   +  +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIVKPDAVERNLIGEIYHRIEKAGLRIVAAKMVHLTEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE+AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGEDAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI Y+F  +EI 
Sbjct: 121 SPESAAREIEYFFPESEIC 139


>gi|157132204|ref|XP_001662512.1| nucleoside-diphosphate kinase NBR-A, putative [Aedes aegypti]
 gi|108871239|gb|EAT35464.1| nucleoside-diphosphate kinase NBR-A, putative [Aedes aegypti]
          Length = 168

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E  G  +VA KF W  ++  E  Y     RPFFP L
Sbjct: 21  ERTFIMVKPDGVQRGLVGKIIKRFEQKGFKLVAMKFMWAEKELLEKHYADLSARPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +  GTIR    + +G N IHGSD+++
Sbjct: 81  VSYMGSGPVVPMVWEGLGVVKTGRQILGATNPADSAPGTIRGDLCVQVGRNIIHGSDAVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 141 SANKEIALWFTEKELV 156


>gi|212535140|ref|XP_002147726.1| nucleoside diphosphate kinase [Penicillium marneffei ATCC 18224]
 gi|210070125|gb|EEA24215.1| nucleoside diphosphate kinase [Penicillium marneffei ATCC 18224]
          Length = 153

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  + A K     R+  E  Y    ++PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLVGPIISRFESRGFKLAALKLVSPPRELLEKHYADLSEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  PGLVAYMLSGPIVAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF  +E+I
Sbjct: 121 SVENAKKEIALWFKEDEVI 139


>gi|325301267|ref|NP_001191672.1| nucleoside diphosphate kinase B [Equus caballus]
          Length = 152

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/140 (42%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R+L+G I+K  E  G  +VA K    +    +  Y+  KDRPF
Sbjct: 1   MANVERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKLLQASEDLLKQHYVDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMHSGPIVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFKPEELV 140


>gi|169776487|ref|XP_001822710.1| nucleoside diphosphate kinase [Aspergillus oryzae RIB40]
 gi|238503193|ref|XP_002382830.1| nucleoside diphosphate kinase [Aspergillus flavus NRRL3357]
 gi|83771445|dbj|BAE61577.1| unnamed protein product [Aspergillus oryzae]
 gi|220691640|gb|EED47988.1| nucleoside diphosphate kinase [Aspergillus flavus NRRL3357]
          Length = 153

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 55/138 (39%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E+ G  + A K C  +++  E  Y     +PFF
Sbjct: 1   MSDEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAALKLCSPSKEHLEQHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  M+SGP+   V +G E +   R ++G T+P  +  GTIR  + I +G N  HGSD
Sbjct: 61  PGLVSYMLSGPIVAMVWEGREVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A +EI+ WF   E+
Sbjct: 121 SVENAKKEIALWFKPEEL 138


>gi|45384260|ref|NP_990378.1| nucleoside diphosphate kinase [Gallus gallus]
 gi|82190139|sp|O57535|NDK_CHICK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|2827444|gb|AAB99856.1| nucleoside diphosphate kinase [Gallus gallus]
          Length = 153

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFVHASEDLLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E+I
Sbjct: 126 SAQKEISLWFKPAELI 141


>gi|147676534|ref|YP_001210749.1| nucleoside diphosphate kinase [Pelotomaculum thermopropionicum SI]
 gi|189029048|sp|A5D5U8|NDK_PELTS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|146272631|dbj|BAF58380.1| nucleoside diphosphate kinase [Pelotomaculum thermopropionicum SI]
          Length = 149

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+R L+G I+   E  G  +V  K   + R+ AE  Y  HK +PFF  
Sbjct: 1   MERTYLMIKPDGVQRGLVGEIIARFEKRGFKIVGLKMIRIGRELAEKHYGEHKGKPFFEP 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   V++G+ A+   RE+MG TDP KA  GTIR  YGI IG N IHGSDS 
Sbjct: 61  LVGYITSSPVVAMVIEGKNAVGAAREMMGATDPLKAAPGTIRGTYGIDIGRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
            +A  EI+ +F+ +E++
Sbjct: 121 ASAQREIALFFSADELM 137


>gi|4505409|ref|NP_002503.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 gi|66392192|ref|NP_001018147.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 gi|66392205|ref|NP_001018148.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 gi|66392227|ref|NP_001018149.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 gi|127983|sp|P22392|NDKB_HUMAN RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=C-myc purine-binding
           transcription factor PUF; AltName: Full=Histidine
           protein kinase NDKB; AltName: Full=nm23-H2
 gi|1311287|pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate
           Kinase, Nm23-H2
 gi|1311288|pdb|1NSK|L Chain L, The Crystal Structure Of A Human Nucleoside Diphosphate
           Kinase, Nm23-H2
 gi|1311289|pdb|1NSK|T Chain T, The Crystal Structure Of A Human Nucleoside Diphosphate
           Kinase, Nm23-H2
 gi|1311290|pdb|1NSK|U Chain U, The Crystal Structure Of A Human Nucleoside Diphosphate
           Kinase, Nm23-H2
 gi|1311291|pdb|1NSK|N Chain N, The Crystal Structure Of A Human Nucleoside Diphosphate
           Kinase, Nm23-H2
 gi|1311292|pdb|1NSK|O Chain O, The Crystal Structure Of A Human Nucleoside Diphosphate
           Kinase, Nm23-H2
 gi|189240|gb|AAA36369.1| nm23-H2S product (putative NDP kinase); putative [Homo sapiens]
 gi|349476|gb|AAA60228.1| c-myc transcription factor [Homo sapiens]
 gi|4467843|emb|CAB37870.1| NM23-H2 protein [Homo sapiens]
 gi|12803317|gb|AAH02476.1| Non-metastatic cells 2, protein (NM23B) expressed in [Homo sapiens]
 gi|30582929|gb|AAP35694.1| non-metastatic cells 2, protein (NM23B) expressed in [Homo sapiens]
 gi|49456397|emb|CAG46519.1| NME2 [Homo sapiens]
 gi|60655263|gb|AAX32195.1| non-metastatic cells 2 protein [synthetic construct]
 gi|60822079|gb|AAX36594.1| non-metastatic cells 2 [synthetic construct]
 gi|66267313|gb|AAH95458.1| NME2 protein [Homo sapiens]
 gi|119614970|gb|EAW94564.1| hCG2001850, isoform CRA_b [Homo sapiens]
 gi|119614973|gb|EAW94567.1| hCG2001850, isoform CRA_b [Homo sapiens]
 gi|189066690|dbj|BAG36237.1| unnamed protein product [Homo sapiens]
          Length = 152

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFKPEELV 140


>gi|156973377|ref|YP_001444284.1| nucleoside diphosphate kinase [Vibrio harveyi ATCC BAA-1116]
 gi|166233032|sp|A7MU38|NDK_VIBHB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|156524971|gb|ABU70057.1| hypothetical protein VIBHAR_01064 [Vibrio harveyi ATCC BAA-1116]
          Length = 141

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E  GL +VAAK   +  +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIVKPDAVERNLIGEIYHRIEKAGLRIVAAKMVHLTEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE+AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGEDAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|1421609|pdb|1NUE|A Chain A, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate
           Kinase B Complexed With Gdp At 2 Angstroms Resolution
 gi|1421610|pdb|1NUE|B Chain B, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate
           Kinase B Complexed With Gdp At 2 Angstroms Resolution
 gi|1421611|pdb|1NUE|C Chain C, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate
           Kinase B Complexed With Gdp At 2 Angstroms Resolution
 gi|1421612|pdb|1NUE|D Chain D, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate
           Kinase B Complexed With Gdp At 2 Angstroms Resolution
 gi|1421613|pdb|1NUE|E Chain E, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate
           Kinase B Complexed With Gdp At 2 Angstroms Resolution
 gi|1421614|pdb|1NUE|F Chain F, X-Ray Structure Of Nm23 Human Nucleoside Diphosphate
           Kinase B Complexed With Gdp At 2 Angstroms Resolution
 gi|206581866|pdb|3BBB|A Chain A, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Dinucleotide D(Ag)
 gi|206581867|pdb|3BBB|B Chain B, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Dinucleotide D(Ag)
 gi|206581868|pdb|3BBB|C Chain C, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Dinucleotide D(Ag)
 gi|206581869|pdb|3BBB|D Chain D, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Dinucleotide D(Ag)
 gi|206581870|pdb|3BBB|E Chain E, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Dinucleotide D(Ag)
 gi|206581871|pdb|3BBB|F Chain F, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Dinucleotide D(Ag)
 gi|206581878|pdb|3BBF|A Chain A, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Gdp
 gi|206581879|pdb|3BBF|B Chain B, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Gdp
 gi|206581880|pdb|3BBF|C Chain C, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Gdp
 gi|206581881|pdb|3BBF|D Chain D, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Gdp
 gi|206581882|pdb|3BBF|E Chain E, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Gdp
 gi|206581883|pdb|3BBF|F Chain F, Crystal Structure Of The Nm23-H2 Transcription Factor
           Complex With Gdp
          Length = 151

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP 
Sbjct: 3   LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPG 62

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 63  LVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSV 122

Query: 123 KTALEEISYWFARNEII 139
           K+A +EIS WF   E++
Sbjct: 123 KSAEKEISLWFKPEELV 139


>gi|328777933|ref|XP_393351.3| PREDICTED: nucleoside diphosphate kinase [Apis mellifera]
          Length = 171

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/133 (42%), Positives = 82/133 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G I++  E+ G  +VA K  W   +  +  Y     RPFFP L
Sbjct: 23  ERTFIMIKPDGVQRGLVGKIIQRFEEKGFKLVAMKMLWPTEELLKKHYSDLASRPFFPGL 82

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G  A+   R ++G+T+PK +  GTIR  + I +G N IHGSDS++
Sbjct: 83  IKYMSSGPVVPMVWEGLNAVKTGRYMLGETNPKDSAPGTIRGDFCIQVGRNIIHGSDSVE 142

Query: 124 TALEEISYWFARN 136
           +A +EI+ WF   
Sbjct: 143 SANKEINLWFGEE 155


>gi|163802470|ref|ZP_02196363.1| nucleoside diphosphate kinase [Vibrio sp. AND4]
 gi|159173771|gb|EDP58586.1| nucleoside diphosphate kinase [Vibrio sp. AND4]
          Length = 141

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E   L +VAAK   +  +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIVKPDAVERNLIGEIYHRIEKANLRIVAAKMVHLTEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE+AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGEDAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|206581872|pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2
           Transcription Factor
 gi|206581873|pdb|3BBC|B Chain B, Crystal Structure Of R88a Mutant Of The Nm23-H2
           Transcription Factor
 gi|206581874|pdb|3BBC|C Chain C, Crystal Structure Of R88a Mutant Of The Nm23-H2
           Transcription Factor
 gi|206581875|pdb|3BBC|D Chain D, Crystal Structure Of R88a Mutant Of The Nm23-H2
           Transcription Factor
 gi|206581876|pdb|3BBC|E Chain E, Crystal Structure Of R88a Mutant Of The Nm23-H2
           Transcription Factor
 gi|206581877|pdb|3BBC|F Chain F, Crystal Structure Of R88a Mutant Of The Nm23-H2
           Transcription Factor
          Length = 151

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 85/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP 
Sbjct: 3   LERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPG 62

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV   V +G   +     ++G+T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 63  LVKYMNSGPVVAMVWEGLNVVKTGAVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSV 122

Query: 123 KTALEEISYWFARNEII 139
           K+A +EIS WF   E++
Sbjct: 123 KSAEKEISLWFKPEELV 139


>gi|196248669|ref|ZP_03147369.1| Nucleoside-diphosphate kinase [Geobacillus sp. G11MC16]
 gi|196211545|gb|EDY06304.1| Nucleoside-diphosphate kinase [Geobacillus sp. G11MC16]
          Length = 149

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 93/138 (67%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF 
Sbjct: 1   MKERTFLMVKPDGVQRNLIGEIVSRFEKKGFQLVGAKLMQVSRELAEQHYAEHKERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  + SGPVF  V +GE  I+  R++MG T+P+ A  GTIR  +G+++G+N IHGSDS
Sbjct: 61  ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQDAAPGTIRGDFGLTVGKNVIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EI+ +F   E+I
Sbjct: 121 PQSAEREINLFFKEEELI 138


>gi|60822102|gb|AAX36595.1| non-metastatic cells 2 [synthetic construct]
          Length = 152

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANVERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFKPEELV 140


>gi|21435082|gb|AAM53644.1| abnormal wing disc-like protein [Choristoneura parallela]
          Length = 153

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 86/137 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R ++G+I++  E  G  +V  KF W + +  +  Y     RPFFP L
Sbjct: 6   ERTFLMIKPDGVQRGIVGTIIERFEKKGFKLVGLKFMWPSEELLQKHYADLASRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP    V +G  A+   R+++G T+P  +L GTIR    I +G N IHGSDS++
Sbjct: 66  VKYMSSGPAVPMVWEGLNAVKTGRQMLGATNPADSLPGTIRGDLCIEVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEIIG 140
           +A +EI+ WF+  E++G
Sbjct: 126 SANKEIALWFSEKELVG 142


>gi|30315965|sp|Q8TFN0|NDK_EMENI RecName: Full=Nucleoside diphosphate kinase; Short=NDP kinase;
           AltName: Full=AnNDK; Short=NDK
 gi|19743612|gb|AAL23684.1| nucleoside diphosphate kinase [Emericella nidulans]
 gi|259480994|tpe|CBF74127.1| TPA: Nucleoside diphosphate kinase (NDP kinase)(EC
           2.7.4.6)(AnNDK)(NDK)
           [Source:UniProtKB/Swiss-Prot;Acc:Q8TFN0] [Aspergillus
           nidulans FGSC A4]
          Length = 153

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 56/138 (40%), Positives = 81/138 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E+ G  + A K    +R   E  Y   K++PFF
Sbjct: 1   MTSEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAMKLTSPSRSLLEQHYSDLKEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  M+SGP+   V +G++ +   R ++G T+P  +  GTIR  + I +G N  HGSD
Sbjct: 61  PGLVTYMLSGPIVAMVWEGKDVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A +EI  WF   EI
Sbjct: 121 SVESAKKEIGLWFTPEEI 138


>gi|326931005|ref|XP_003211627.1| PREDICTED: nucleoside diphosphate kinase-like [Meleagris gallopavo]
          Length = 153

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I++  E  G  +VA K    +    +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIRRFEQKGFKLVAMKLTHASEDLLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 126 SAQKEINLWFKPAELI 141


>gi|92114967|ref|YP_574895.1| nucleoside diphosphate kinase [Chromohalobacter salexigens DSM
           3043]
 gi|119372022|sp|Q1QTL2|NDK_CHRSD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|91798057|gb|ABE60196.1| nucleoside diphosphate kinase [Chromohalobacter salexigens DSM
           3043]
          Length = 141

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E  GL +VAAK   +++ QAE FY  HK+RPFF
Sbjct: 1   MANERTLSIIKPDAVAKNVIGEIESRFEKAGLKIVAAKMLQLSQAQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI+ NR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  GDLVGFMTSGPVIVQVLEGENAIAANRDLMGATNPKEAAAGTIRADFAQSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F   EI 
Sbjct: 121 SPESAEREIAYFFGNEEIC 139


>gi|4557797|ref|NP_000260.1| nucleoside diphosphate kinase A isoform b [Homo sapiens]
 gi|197102032|ref|NP_001125354.1| nucleoside diphosphate kinase A [Pongo abelii]
 gi|332246352|ref|XP_003272318.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 4 [Nomascus
           leucogenys]
 gi|127981|sp|P15531|NDKA_HUMAN RecName: Full=Nucleoside diphosphate kinase A; Short=NDK A;
           Short=NDP kinase A; AltName: Full=Granzyme A-activated
           DNase; Short=GAAD; AltName: Full=Metastasis inhibition
           factor nm23; AltName: Full=Tumor metastatic
           process-associated protein; AltName: Full=nm23-H1
 gi|75061915|sp|Q5RC56|NDKA_PONAB RecName: Full=Nucleoside diphosphate kinase A; Short=NDK A;
           Short=NDP kinase A
 gi|20663967|pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A
 gi|20663968|pdb|1JXV|B Chain B, Crystal Structure Of Human Nucleoside Diphosphate Kinase A
 gi|20663969|pdb|1JXV|C Chain C, Crystal Structure Of Human Nucleoside Diphosphate Kinase A
 gi|20663970|pdb|1JXV|D Chain D, Crystal Structure Of Human Nucleoside Diphosphate Kinase A
 gi|20663971|pdb|1JXV|E Chain E, Crystal Structure Of Human Nucleoside Diphosphate Kinase A
 gi|20663972|pdb|1JXV|F Chain F, Crystal Structure Of Human Nucleoside Diphosphate Kinase A
 gi|116667864|pdb|2HVD|A Chain A, Human Nucleoside Diphosphate Kinase A Complexed With Adp
 gi|116667865|pdb|2HVD|B Chain B, Human Nucleoside Diphosphate Kinase A Complexed With Adp
 gi|116667866|pdb|2HVD|C Chain C, Human Nucleoside Diphosphate Kinase A Complexed With Adp
 gi|312824|emb|CAA51527.1| NM23H1 [Homo sapiens]
 gi|468542|emb|CAA53270.1| nm23H1g [Homo sapiens]
 gi|12653057|gb|AAH00293.1| Non-metastatic cells 1, protein (NM23A) expressed in [Homo sapiens]
 gi|17512044|gb|AAH18994.1| Non-metastatic cells 1, protein (NM23A) expressed in [Homo sapiens]
 gi|49457204|emb|CAG46901.1| NME1 [Homo sapiens]
 gi|49457226|emb|CAG46912.1| NME1 [Homo sapiens]
 gi|55727802|emb|CAH90654.1| hypothetical protein [Pongo abelii]
 gi|60815678|gb|AAX36353.1| non-metastatic cells 1 protein [synthetic construct]
 gi|119614974|gb|EAW94568.1| hCG2001850, isoform CRA_e [Homo sapiens]
 gi|158255646|dbj|BAF83794.1| unnamed protein product [Homo sapiens]
          Length = 152

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|311694380|gb|ADP97253.1| nucleoside diphosphate kinase [marine bacterium HP15]
          Length = 142

 Score =  181 bits (460), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E  GL +VAAK   + ++QAE FY  HK+RPFF
Sbjct: 1   MATERTLSIIKPDAVAKNVIGEIYSRFEKAGLNIVAAKMMHLTQEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI KNR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVAFMTSGPVVVQVLEGEGAILKNRDLMGATNPKEAEAGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  NEI 
Sbjct: 121 SAASAEREIAYFFNDNEIC 139


>gi|328951730|ref|YP_004369065.1| Nucleoside diphosphate kinase [Marinithermus hydrothermalis DSM
           14884]
 gi|328452054|gb|AEB12955.1| Nucleoside diphosphate kinase [Marinithermus hydrothermalis DSM
           14884]
          Length = 138

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 88/138 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L G I+  LE  G  +VA K   + R+ AE  Y  HK++PFFP 
Sbjct: 1   MERTFCMIKPDGVRRGLTGEILARLEKKGFRIVALKKMRIPRELAERHYAEHKEKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   VL+G   I++ R++MG T+P  AL GTIR  Y  +I EN IHGS + 
Sbjct: 61  LVEFITSGPVVAMVLEGPGVIAELRKLMGATNPADALPGTIRGDYATTIDENVIHGSATP 120

Query: 123 KTALEEISYWFARNEIIG 140
           + A  EI  +F  +EI+G
Sbjct: 121 EDAEREIRLFFREDEIVG 138


>gi|145242650|ref|XP_001393898.1| nucleoside diphosphate kinase [Aspergillus niger CBS 513.88]
 gi|134078451|emb|CAK40394.1| unnamed protein product [Aspergillus niger]
          Length = 153

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 85/138 (61%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E+ G  +VA K C   R+  E  Y   K++PFF
Sbjct: 1   MSSEQTFIAIKPDGVQRGLVGPIISRFENRGFKLVALKLCSPGREHLEKHYANLKEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  PGLVSYMLSGPICAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A +EI+ WF+ +E+
Sbjct: 121 SVENAQKEIALWFSPSEL 138


>gi|300864128|ref|ZP_07109023.1| Nucleoside diphosphate kinase [Oscillatoria sp. PCC 6506]
 gi|300337856|emb|CBN54169.1| Nucleoside diphosphate kinase [Oscillatoria sp. PCC 6506]
          Length = 149

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I+   E  G  +V  K   ++R+ AE  Y +H++RPFFP 
Sbjct: 1   MERTFLAIKPDGVQRGLVGEIIGRFEAKGFTLVGLKLVSVSRELAEAHYDVHRERPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +IS PV   V +G+  ++  R+++G T+P  A  GTIR  + +++G N IHGSD++
Sbjct: 61  LVEFIISSPVVAMVWQGDGVVASARKMIGATNPLNAEPGTIRGDFAVNVGRNIIHGSDAI 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI  WF   E++
Sbjct: 121 ETAQREIKLWFKDEELV 137


>gi|149478572|ref|XP_001515701.1| PREDICTED: similar to regenerating islet-derived family, member 4
           [Ornithorhynchus anatinus]
          Length = 267

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 83/139 (59%), Gaps = 1/139 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +VA K    + +  +  Y+  KDRPF
Sbjct: 116 MATGERTFIAIKPDGVQRGLVGDIIKRFEQKGFRLVAMKMLRASEEHLQQHYIDLKDRPF 175

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 176 FPGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 235

Query: 120 DSLKTALEEISYWFARNEI 138
           DS+K+A +EI  WF   E+
Sbjct: 236 DSVKSAEKEIGLWFKPEEL 254



 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 1/114 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ YL  KDRPF
Sbjct: 1   MATSERTFIAIKPDGVQRGLVGDIIKRFEQKGFRLVALKFVHASEDLLKEHYLDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           +  LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 61  YAGLVRYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 114


>gi|148683963|gb|EDL15910.1| mCG145251 [Mus musculus]
          Length = 153

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y   KDRPFF  L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQASEDLLKEHYTDLKDRPFFTGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 66  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 125

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 126 SAEKEISLWFQPEELV 141


>gi|6010063|emb|CAB57238.1| putative nucleoside-diphosphate kinase [Entodinium caudatum]
          Length = 156

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG I++  E  G  ++A K    ++   E+ Y  HK +PFF  
Sbjct: 4   LERTFIMIKPDGVQRGLIGPILERFERRGYKLIALKLFTPSKALLEEHYGEHKGKPFFEP 63

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+ GPV   + +G + +   R+++G T P  +  GTIR  Y I  G N +HGSDS+
Sbjct: 64  LVNYMLMGPVVCMIWEGLDIVKTGRKMLGATKPLNSEPGTIRGDYSIETGRNIVHGSDSV 123

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  WF   EI
Sbjct: 124 ESAEREIKLWFKPEEI 139


>gi|225557109|gb|EEH05396.1| nucleoside diphosphate kinase [Ajellomyces capsulatus G186AR]
 gi|240277654|gb|EER41162.1| nucleoside diphosphate kinase [Ajellomyces capsulatus H143]
 gi|325093741|gb|EGC47051.1| nucleoside diphosphate kinase [Ajellomyces capsulatus H88]
          Length = 152

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 78/138 (56%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  IKPD V+R L+G I+   E  G  + A K    +++  E  Y     +PFF 
Sbjct: 3   ASEQTFIAIKPDGVQRGLVGPIISRFESRGYKLAAIKLVTPSKEHLEKHYEDLSSKPFFK 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  + I +G N  HGSDS
Sbjct: 63  GLVTYMLSGPICAMVWEGRDAVKTGRAILGATNPLASAPGTIRGDFAIDVGRNVCHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           ++ A +EI+ WF   E++
Sbjct: 123 VENAKKEIALWFKPEELV 140


>gi|83952289|ref|ZP_00961021.1| nucleoside diphosphate kinase [Roseovarius nubinhibens ISM]
 gi|83837295|gb|EAP76592.1| nucleoside diphosphate kinase [Roseovarius nubinhibens ISM]
          Length = 140

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 99/140 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDA KRNL G I  + ED GL +VA K   +   QA  FY +H +RPF+
Sbjct: 1   MAVERTLSIIKPDATKRNLTGKINAKFEDAGLRIVAQKRIQLTPAQAGKFYEVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL   M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  GELCDFMASEPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI+++F+  E++G
Sbjct: 121 APETAAQEIAFFFSGLELVG 140


>gi|90819960|gb|ABD98737.1| putative nucleoside diphosphate kinase [Graphocephala atropunctata]
          Length = 170

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V R L+G I+K  E  G  +VA KF W   +  +  Y     +PFFP L
Sbjct: 22  ERTFIMVKPDGVHRGLVGKIIKRFETKGFKLVALKFTWPTEELLKKHYADLSSKPFFPGL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G T+P+ +  GTIR  Y I  G N IHGSD+++
Sbjct: 82  VKYMSSGPVVPMVWEGLNVVKTGRFLLGTTNPQDSNPGTIRGDYCIQTGRNIIHGSDAVE 141

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 142 SANKEIALWFNEKELV 157


>gi|6010071|emb|CAB57242.1| putative nucleoside diphosphate kinase [Entodinium caudatum]
          Length = 155

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG I++  E  G  ++A K    ++   E+ Y  HK +PFF  
Sbjct: 3   LERTFIMIKPDGVQRGLIGPILERFERRGYKLIALKLFTPSKALLEEHYGEHKGKPFFEP 62

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+ GPV   + +G + +   R+++G T P  +  GTIR  Y I  G N +HGSDS+
Sbjct: 63  LVNYMLMGPVVCMIWEGLDIVKTGRKMLGATKPLNSEPGTIRGDYSIETGRNIVHGSDSV 122

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  WF   EI
Sbjct: 123 ESAEREIKLWFKPEEI 138


>gi|172035604|ref|YP_001802105.1| nucleoside diphosphate kinase [Cyanothece sp. ATCC 51142]
 gi|254767224|sp|B1WQB7|NDK_CYAA5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|171697058|gb|ACB50039.1| nucleoside diphosphate kinase [Cyanothece sp. ATCC 51142]
          Length = 149

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 89/136 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G ++   E  G  +V  K   ++++ AE+ Y +HK+RPFF  
Sbjct: 1   MERTFIMIKPDGVQRGLVGEVIGRFEAKGFTLVGLKLMSVSKELAEEHYDVHKERPFFGS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + S PV   V +G+  ++  R+++G T+P  A  GTIR  +G+S+G N IHGSD++
Sbjct: 61  LVEFICSSPVVAMVWEGDGVVASARKLIGATNPLSAEPGTIRGDFGVSVGRNLIHGSDAI 120

Query: 123 KTALEEISYWFARNEI 138
           +TA  EIS WF   E+
Sbjct: 121 ETAQREISLWFNEKEL 136


>gi|149914664|ref|ZP_01903194.1| nucleoside diphosphate kinase [Roseobacter sp. AzwK-3b]
 gi|149811457|gb|EDM71292.1| nucleoside diphosphate kinase [Roseobacter sp. AzwK-3b]
          Length = 140

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDA  RNL G I  + ED GL +VA K   + + QA +FY +HK+RPF+
Sbjct: 1   MAVERTLSIIKPDATNRNLTGKINAKFEDAGLRIVAQKRIQLTKAQAGEFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNR+VMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPVVVQVLEGEGAIAKNRDVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|194217132|ref|XP_001499951.2| PREDICTED: similar to NME1-NME2 protein [Equus caballus]
          Length = 267

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 60/140 (42%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R+L+G I+K  E  G  +VA K    +    +  Y+  KDRPF
Sbjct: 116 MANVERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKLLQASEDLLKQHYVDLKDRPF 175

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 176 FPGLVKYMHSGPIVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 235

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 236 DSVKSAEKEISLWFKPEELV 255



 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 64/110 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R+L+G I+K  E  G  +VA KF   +    ++ Y   KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYNDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 114


>gi|37700232|ref|NP_032730.1| nucleoside diphosphate kinase A [Mus musculus]
 gi|127982|sp|P15532|NDKA_MOUSE RecName: Full=Nucleoside diphosphate kinase A; Short=NDK A;
           Short=NDP kinase A; AltName: Full=Metastasis inhibition
           factor NM23; AltName: Full=NDPK-A; AltName: Full=Tumor
           metastatic process-associated protein; AltName:
           Full=nm23-M1
 gi|200069|gb|AAA63391.1| protein nm23 [Mus musculus]
 gi|1816594|gb|AAB42080.1| nucleoside diphosphate kinase A long form [Mus musculus]
 gi|2654092|gb|AAB87689.1| nucleoside diphosphate kinase A [Mus musculus]
 gi|13542867|gb|AAH05629.1| Non-metastatic cells 1, protein (NM23A) expressed in [Mus musculus]
 gi|26330286|dbj|BAC28873.1| unnamed protein product [Mus musculus]
 gi|56800494|emb|CAI35364.1| expressed in non-metastatic cells 1 protein [Mus musculus]
 gi|74200308|dbj|BAE22943.1| unnamed protein product [Mus musculus]
          Length = 152

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y   KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQASEDLLKEHYTDLKDRPFFTGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SAEKEISLWFQPEELV 140


>gi|4389317|pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina
 gi|4389318|pdb|1BE4|B Chain B, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina
 gi|157838275|pdb|1BE4|C Chain C, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina
          Length = 151

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 4   ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGL 63

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 64  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 123

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 124 SAEKEIALWFRPEELV 139


>gi|221133864|ref|ZP_03560169.1| nucleoside-diphosphate kinase [Glaciecola sp. HTCC2999]
          Length = 143

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N+IG+I    E  GL +VA+K   ++++QAE FY  HK+RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMVHLSKEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+ KNRE+MG T+P +A  GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVQVLEGENAVVKNREIMGATNPAEAAAGTLRADYAESIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EI+Y+F+  E+ 
Sbjct: 121 APESAAREIAYFFSDEEVC 139


>gi|15640775|ref|NP_230405.1| nucleoside diphosphate kinase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121591432|ref|ZP_01678710.1| nucleoside diphosphate kinase [Vibrio cholerae 2740-80]
 gi|121726047|ref|ZP_01679346.1| nucleoside diphosphate kinase [Vibrio cholerae V52]
 gi|147673453|ref|YP_001216241.1| nucleoside diphosphate kinase [Vibrio cholerae O395]
 gi|153216235|ref|ZP_01950335.1| nucleoside diphosphate kinase [Vibrio cholerae 1587]
 gi|153800616|ref|ZP_01955202.1| nucleoside diphosphate kinase [Vibrio cholerae MZO-3]
 gi|153817262|ref|ZP_01969929.1| nucleoside diphosphate kinase [Vibrio cholerae NCTC 8457]
 gi|153822735|ref|ZP_01975402.1| nucleoside diphosphate kinase [Vibrio cholerae B33]
 gi|153824653|ref|ZP_01977320.1| nucleoside diphosphate kinase [Vibrio cholerae MZO-2]
 gi|153829402|ref|ZP_01982069.1| nucleoside diphosphate kinase [Vibrio cholerae 623-39]
 gi|227080935|ref|YP_002809486.1| nucleoside diphosphate kinase [Vibrio cholerae M66-2]
 gi|229505630|ref|ZP_04395140.1| nucleoside diphosphate kinase [Vibrio cholerae BX 330286]
 gi|229510698|ref|ZP_04400177.1| nucleoside diphosphate kinase [Vibrio cholerae B33]
 gi|229513105|ref|ZP_04402571.1| nucleoside diphosphate kinase [Vibrio cholerae TMA 21]
 gi|229517820|ref|ZP_04407264.1| nucleoside diphosphate kinase [Vibrio cholerae RC9]
 gi|229523421|ref|ZP_04412828.1| nucleoside diphosphate kinase [Vibrio cholerae TM 11079-80]
 gi|229525402|ref|ZP_04414807.1| nucleoside diphosphate kinase [Vibrio cholerae bv. albensis VL426]
 gi|229530114|ref|ZP_04419504.1| nucleoside diphosphate kinase [Vibrio cholerae 12129(1)]
 gi|229608648|ref|YP_002879296.1| nucleoside diphosphate kinase [Vibrio cholerae MJ-1236]
 gi|254225019|ref|ZP_04918633.1| nucleoside diphosphate kinase [Vibrio cholerae V51]
 gi|254285474|ref|ZP_04960438.1| nucleoside diphosphate kinase [Vibrio cholerae AM-19226]
 gi|254847893|ref|ZP_05237243.1| nucleoside diphosphate kinase [Vibrio cholerae MO10]
 gi|255744562|ref|ZP_05418513.1| nucleoside diphosphate kinase [Vibrio cholera CIRS 101]
 gi|261212144|ref|ZP_05926430.1| nucleoside diphosphate kinase [Vibrio sp. RC341]
 gi|262161303|ref|ZP_06030414.1| nucleoside diphosphate kinase [Vibrio cholerae INDRE 91/1]
 gi|262165068|ref|ZP_06032805.1| nucleoside diphosphate kinase [Vibrio mimicus VM223]
 gi|262168796|ref|ZP_06036491.1| nucleoside diphosphate kinase [Vibrio cholerae RC27]
 gi|262192503|ref|ZP_06050654.1| nucleoside diphosphate kinase [Vibrio cholerae CT 5369-93]
 gi|262402859|ref|ZP_06079420.1| nucleoside diphosphate kinase [Vibrio sp. RC586]
 gi|297581155|ref|ZP_06943079.1| nucleoside diphosphate kinase [Vibrio cholerae RC385]
 gi|298499111|ref|ZP_07008918.1| nucleoside diphosphate kinase [Vibrio cholerae MAK 757]
 gi|18203201|sp|Q9KTX4|NDK_VIBCH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|172047439|sp|A5F3F7|NDK_VIBC3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|254767260|sp|C3LT09|NDK_VIBCM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|9655202|gb|AAF93921.1| nucleoside diphosphate kinase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121546709|gb|EAX56886.1| nucleoside diphosphate kinase [Vibrio cholerae 2740-80]
 gi|121631529|gb|EAX63899.1| nucleoside diphosphate kinase [Vibrio cholerae V52]
 gi|124114380|gb|EAY33200.1| nucleoside diphosphate kinase [Vibrio cholerae 1587]
 gi|124123905|gb|EAY42648.1| nucleoside diphosphate kinase [Vibrio cholerae MZO-3]
 gi|125622406|gb|EAZ50726.1| nucleoside diphosphate kinase [Vibrio cholerae V51]
 gi|126512178|gb|EAZ74772.1| nucleoside diphosphate kinase [Vibrio cholerae NCTC 8457]
 gi|126519766|gb|EAZ76989.1| nucleoside diphosphate kinase [Vibrio cholerae B33]
 gi|146315336|gb|ABQ19875.1| nucleoside diphosphate kinase [Vibrio cholerae O395]
 gi|148875122|gb|EDL73257.1| nucleoside diphosphate kinase [Vibrio cholerae 623-39]
 gi|149741871|gb|EDM55900.1| nucleoside diphosphate kinase [Vibrio cholerae MZO-2]
 gi|150424336|gb|EDN16273.1| nucleoside diphosphate kinase [Vibrio cholerae AM-19226]
 gi|227008823|gb|ACP05035.1| nucleoside diphosphate kinase [Vibrio cholerae M66-2]
 gi|227012580|gb|ACP08790.1| nucleoside diphosphate kinase [Vibrio cholerae O395]
 gi|229333888|gb|EEN99374.1| nucleoside diphosphate kinase [Vibrio cholerae 12129(1)]
 gi|229338983|gb|EEO04000.1| nucleoside diphosphate kinase [Vibrio cholerae bv. albensis VL426]
 gi|229339784|gb|EEO04799.1| nucleoside diphosphate kinase [Vibrio cholerae TM 11079-80]
 gi|229344535|gb|EEO09509.1| nucleoside diphosphate kinase [Vibrio cholerae RC9]
 gi|229349998|gb|EEO14952.1| nucleoside diphosphate kinase [Vibrio cholerae TMA 21]
 gi|229350663|gb|EEO15604.1| nucleoside diphosphate kinase [Vibrio cholerae B33]
 gi|229357853|gb|EEO22770.1| nucleoside diphosphate kinase [Vibrio cholerae BX 330286]
 gi|229371303|gb|ACQ61726.1| nucleoside diphosphate kinase [Vibrio cholerae MJ-1236]
 gi|254843598|gb|EET22012.1| nucleoside diphosphate kinase [Vibrio cholerae MO10]
 gi|255737593|gb|EET92987.1| nucleoside diphosphate kinase [Vibrio cholera CIRS 101]
 gi|260838752|gb|EEX65403.1| nucleoside diphosphate kinase [Vibrio sp. RC341]
 gi|262022914|gb|EEY41620.1| nucleoside diphosphate kinase [Vibrio cholerae RC27]
 gi|262024784|gb|EEY43452.1| nucleoside diphosphate kinase [Vibrio mimicus VM223]
 gi|262029053|gb|EEY47706.1| nucleoside diphosphate kinase [Vibrio cholerae INDRE 91/1]
 gi|262031662|gb|EEY50249.1| nucleoside diphosphate kinase [Vibrio cholerae CT 5369-93]
 gi|262351641|gb|EEZ00774.1| nucleoside diphosphate kinase [Vibrio sp. RC586]
 gi|297534471|gb|EFH73308.1| nucleoside diphosphate kinase [Vibrio cholerae RC385]
 gi|297543444|gb|EFH79494.1| nucleoside diphosphate kinase [Vibrio cholerae MAK 757]
 gi|327483541|gb|AEA77948.1| Nucleoside diphosphate kinase [Vibrio cholerae LMA3894-4]
          Length = 142

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAVKRNLIG I   +E  GL ++AAK   ++ +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIIKPDAVKRNLIGEIYHRIEKAGLQIIAAKMVHLSEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GT+R  Y +S+  NS+HGSD
Sbjct: 61  EPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTLRADYALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI ++F  +EI 
Sbjct: 121 SPASAAREIEFFFPESEIC 139


>gi|75298577|sp|Q852S5|NDK2_TOBAC RecName: Full=Nucleoside diphosphate kinase 2, chloroplastic;
           AltName: Full=Nucleoside diphosphate kinase II;
           Short=NDK II; Short=NDP kinase II; Short=NDPK II; Flags:
           Precursor
 gi|27807824|dbj|BAC55280.1| nucleoside diphosphate kinase [Nicotiana tabacum]
          Length = 232

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+R L+G I+   E  G  +   K     ++ AE+ Y   + +PFFP+
Sbjct: 84  VEETYIMIKPDGVQRGLVGEIISRFEKKGFKLTGLKLFHCPKELAEEHYKDLQSKPFFPK 143

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G   ++  R+++G T+P  A  GTIR    +  G N +HGSDS 
Sbjct: 144 LIDYITSGPVVCMAWEGVGVVASARKLIGATNPLNAEPGTIRGDLAVQTGRNVVHGSDSP 203

Query: 123 KTALEEISYWFARNEII 139
                EI+ WF   E+ 
Sbjct: 204 DNGKREIALWFGEGELC 220


>gi|261856770|ref|YP_003264053.1| nucleoside-diphosphate kinase [Halothiobacillus neapolitanus c2]
 gi|261837239|gb|ACX97006.1| Nucleoside-diphosphate kinase [Halothiobacillus neapolitanus c2]
          Length = 142

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 77/138 (55%), Positives = 102/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I+   ED GL VVA +   ++R+QAE FY +H++RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGKIISRFEDAGLAVVAGRMMQLSREQAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGPVF+QVL+G+ AI+KNR++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  GELVSFMISGPVFVQVLEGDNAIAKNRDLMGATDPKKADPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S + A  EI Y+F   E+
Sbjct: 121 SAENAAIEIDYFFKPEEV 138


>gi|148238317|ref|NP_001081044.1| nucleoside diphosphate kinase A1 [Xenopus laevis]
 gi|1655704|emb|CAA66473.1| NM23/nucleoside diphosphate kinase [Xenopus laevis]
 gi|1655710|emb|CAA66475.1| NM23/nucleoside diphosphate kinase [Xenopus laevis]
          Length = 154

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LIG I+K  E  G  +VA KF   ++      Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLIGDIIKRFEQKGFRLVAMKFQQASQDLLRQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VEYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFKDEELV 141


>gi|301781232|ref|XP_002926027.1| PREDICTED: LOW QUALITY PROTEIN: nucleoside diphosphate kinase
           B-like [Ailuropoda melanoleuca]
          Length = 270

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP L
Sbjct: 123 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPFFPGL 182

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 183 VKYMNSGPVVAMVWEGLNVVKTGRMMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 242

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 243 SAEKEISLWFKPEELV 258



 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 64/110 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R+L+G I+K  E  G  ++A K    +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLIAMKLIQASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 65  VKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 114


>gi|115291340|gb|ABI93176.1| oncoprotein nm23 [Litopenaeus vannamei]
          Length = 151

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 54/139 (38%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           MV E+TF  +KPD V+R LIG I+K  E  G  +   K+   +    +  Y+   D+PF+
Sbjct: 1   MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGPV     +G   +   R +MG+T P  +  GTIR  + I +G N IHGSD
Sbjct: 61  PGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI+ WF   E++
Sbjct: 121 SVESANKEIALWFKPEELV 139


>gi|325910861|ref|NP_001191805.1| nucleoside diphosphate kinase A [Callithrix jacchus]
          Length = 152

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|255540363|ref|XP_002511246.1| nucleoside diphosphate kinase, putative [Ricinus communis]
 gi|223550361|gb|EEF51848.1| nucleoside diphosphate kinase, putative [Ricinus communis]
          Length = 242

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L+G I+   E  G  +   K     ++ AE+ Y   K RPFFP+
Sbjct: 94  VEETYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCPKELAEEHYKDLKARPFFPK 153

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 154 LIDYITSGPVVCMAWEGVGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSP 213

Query: 123 KTALEEISYWFARNEII 139
           +    E++ WF   EI 
Sbjct: 214 ENGKREVALWFKEGEIC 230


>gi|6679078|ref|NP_032731.1| nucleoside diphosphate kinase B [Mus musculus]
 gi|117606270|ref|NP_001070997.1| nucleoside diphosphate kinase B [Mus musculus]
 gi|266608|sp|Q01768|NDKB_MOUSE RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=Histidine protein
           kinase NDKB; AltName: Full=P18; AltName: Full=nm23-M2
 gi|53354|emb|CAA48275.1| nucleoside diphosphate kinase B [Mus musculus]
 gi|12849197|dbj|BAB28246.1| unnamed protein product [Mus musculus]
 gi|44890513|gb|AAH66995.1| Non-metastatic cells 2, protein (NM23B) expressed in [Mus musculus]
 gi|56269658|gb|AAH86893.1| Non-metastatic cells 2, protein (NM23B) expressed in [Mus musculus]
 gi|56270600|gb|AAH86892.1| Non-metastatic cells 2, protein (NM23B) expressed in [Mus musculus]
 gi|56800493|emb|CAI35363.1| expressed in non-metastatic cells 2 protein [Mus musculus]
 gi|74139525|dbj|BAE40900.1| unnamed protein product [Mus musculus]
 gi|74185568|dbj|BAE30250.1| unnamed protein product [Mus musculus]
 gi|74219544|dbj|BAE29543.1| unnamed protein product [Mus musculus]
 gi|148683961|gb|EDL15908.1| mCG1461, isoform CRA_a [Mus musculus]
 gi|148683962|gb|EDL15909.1| mCG1461, isoform CRA_a [Mus musculus]
          Length = 152

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +EI  WF   E+I
Sbjct: 121 DSVESAEKEIHLWFKPEELI 140


>gi|292491211|ref|YP_003526650.1| nucleoside-diphosphate kinase [Nitrosococcus halophilus Nc4]
 gi|291579806|gb|ADE14263.1| Nucleoside-diphosphate kinase [Nitrosococcus halophilus Nc4]
          Length = 143

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL +VAA+   ++++QA+ FY +HK+RPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGEIYTRFEKGGLRIVAARMLHLSKEQAQGFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M SGPV +QVL+GE+AI+KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVEFMTSGPVIVQVLEGEDAIAKNRELMGATNPKEAAPGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
             +TA +EI+++F   EI 
Sbjct: 121 GPETAEQEINFFFKPEEIC 139


>gi|290542291|ref|NP_001166344.1| nucleoside diphosphate kinase A [Cavia porcellus]
 gi|12700713|gb|AAK00527.1| nucleoside diphosphate kinase A [Cavia porcellus]
          Length = 153

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 1/137 (0%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA K    +    ++ Y+  KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLVGDIIKRFEQKGFRLVALKLIQASEDLLKEHYVDLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS-DSL 122
           VQ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS DS+
Sbjct: 65  VQYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSGDSV 124

Query: 123 KTALEEISYWFARNEII 139
           ++A +EI+ WF   E++
Sbjct: 125 ESAEKEIALWFQPEELV 141


>gi|68299781|ref|NP_001019808.1| nucleoside diphosphate kinase A [Canis lupus familiaris]
 gi|68565663|sp|Q50KA9|NDKA_CANFA RecName: Full=Nucleoside diphosphate kinase A; Short=NDK A;
           Short=NDP kinase A; AltName: Full=nm23-C1
 gi|63003107|dbj|BAD97837.1| NM23-C1 [Canis lupus familiaris]
          Length = 152

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R+L+G I+K  E  G  ++A K    +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLIAMKLIQASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFQPEELV 140


>gi|297625175|ref|YP_003706609.1| Nucleoside-diphosphate kinase [Truepera radiovictrix DSM 17093]
 gi|297166355|gb|ADI16066.1| Nucleoside-diphosphate kinase [Truepera radiovictrix DSM 17093]
          Length = 145

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 90/139 (64%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T++M+KPD VKR L+G +++ LE  G  +V  K   + R  AE+ Y  H+ +PFF
Sbjct: 7   MALERTYAMVKPDGVKRGLVGEVLRRLEHKGFKIVGMKLMQIPRATAEEHYGEHRGKPFF 66

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V++GE AI++ R++MG T+PK A  GT+R  +  +I EN +HGSD
Sbjct: 67  EGLVSFITSGPVVAMVVEGENAIAEWRKMMGATNPKDAAPGTLRGDFAATIDENIVHGSD 126

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA  EI  +F   E++
Sbjct: 127 APETAEREIGIFFKPEELL 145


>gi|255636688|gb|ACU18680.1| unknown [Glycine max]
          Length = 227

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T+ M+KPD V+R L+G I+   E  G  +   K    +++ AE+ Y   K + FFP+
Sbjct: 79  VDQTYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCSKELAEEHYKDLKQKSFFPK 138

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 139 LIDYITSGPVVCMAWEGVGVVASARKLIGATDPLQAEPGTIRGDLAVQTGRNVVHGSDSP 198

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 199 ENGKREIALWFKEGEVC 215


>gi|255630417|gb|ACU15565.1| unknown [Glycine max]
          Length = 229

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T+ M+KPD V+R L+G I+   E  G  +   K    +++ AE+ Y   K + FFP+
Sbjct: 77  VDQTYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCSKELAEEHYKDLKQKSFFPK 136

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 137 LIDYITSGPVVCMAWEGVGVVASARKLIGATDPLQAEPGTIRGDLAVQTGRNVVHGSDSP 196

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 197 ENGKREIALWFKEGEVC 213


>gi|327265075|ref|XP_003217334.1| PREDICTED: nucleoside diphosphate kinase-like [Anolis carolinensis]
          Length = 153

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 55/141 (39%), Positives = 86/141 (60%), Gaps = 2/141 (1%)

Query: 1   MV--IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRP 58
           M    E+TF  +KPD V+R L+G I+K  E  G  +VA K    + +  ++ Y+  KD+P
Sbjct: 1   MAPNTERTFIAVKPDGVQRGLVGEIIKRFEQKGFRMVAMKLLHASEELLKEHYIDLKDKP 60

Query: 59  FFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHG 118
           F+P LV+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHG
Sbjct: 61  FYPGLVKYMNSGPIVAMVWEGLNVVKTGRLMLGETNPADSKPGTIRGDFCIQVGRNIIHG 120

Query: 119 SDSLKTALEEISYWFARNEII 139
           SDS+++A +EI+ WF   E++
Sbjct: 121 SDSVESAQKEINLWFKPAELV 141


>gi|325910863|ref|NP_001191806.1| nucleoside diphosphate kinase B [Callithrix jacchus]
          Length = 152

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSADKEISLWFKPEELV 140


>gi|126661116|ref|ZP_01732196.1| Nucleoside diphosphate kinase [Cyanothece sp. CCY0110]
 gi|126617592|gb|EAZ88381.1| Nucleoside diphosphate kinase [Cyanothece sp. CCY0110]
          Length = 149

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 89/136 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G ++   E  G  +V  K   ++++ AE+ Y +HK+RPFF  
Sbjct: 1   MERTFIMIKPDGVQRGLVGEVIGRFEAKGFTLVGLKLMSVSKELAEEHYDVHKERPFFGS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + S PV   V +GE  ++  R+++G T+P  A  GTIR  +G+S+G N IHGSD++
Sbjct: 61  LVEFICSSPVVAMVWEGEGVVASARKLIGATNPLSAEPGTIRGDFGVSVGRNLIHGSDAI 120

Query: 123 KTALEEISYWFARNEI 138
           +TA  EIS WF   E+
Sbjct: 121 ETAQREISLWFNEKEL 136


>gi|115483468|ref|NP_001065404.1| Os10g0563700 [Oryza sativa Japonica Group]
 gi|12597873|gb|AAG60181.1|AC084763_1 putative nucleoside diphosphate kinase [Oryza sativa Japonica
           Group]
 gi|31433540|gb|AAP55038.1| Nucleoside diphosphate kinase 1, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113639936|dbj|BAF27241.1| Os10g0563700 [Oryza sativa Japonica Group]
 gi|125532976|gb|EAY79541.1| hypothetical protein OsI_34670 [Oryza sativa Indica Group]
 gi|125575712|gb|EAZ16996.1| hypothetical protein OsJ_32481 [Oryza sativa Japonica Group]
 gi|149391949|gb|ABR25875.1| nucleoside diphosphate kinase [Oryza sativa Indica Group]
 gi|215704290|dbj|BAG93130.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 151

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 82/135 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF MIKPD V+R LIG ++   E  G  + A K   + +  AE  Y     +PFF
Sbjct: 1   MALEQTFIMIKPDGVQRGLIGEVIGRFEKKGFYLKAMKLINVEKSFAEKHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ ++SGPV   V +G++ +S  R+++G T+P  A  GTIR  + + IG N IHGSD
Sbjct: 61  GGLVEYIVSGPVVAMVWEGKQVVSTGRKLVGATNPLAAEPGTIRGDFAVDIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S++ A +EI+ WF  
Sbjct: 121 SVENARKEIALWFPE 135


>gi|325197167|ref|NP_001191440.1| nucleoside diphosphate kinase A [Pan troglodytes]
 gi|325197173|ref|NP_001191441.1| nucleoside diphosphate kinase A [Pan troglodytes]
          Length = 152

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|270003279|gb|EEZ99726.1| hypothetical protein TcasGA2_TC002492 [Tribolium castaneum]
          Length = 154

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E  G  +VA KF W + +  +  Y     +PFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIKRFESKGFKLVALKFTWPSEELLKKHYADLATKPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G T+P  +  GTIR    I +G N IHGSDS++
Sbjct: 66  VKYMSSGPVVPMVWEGLNVVKTGRVMLGATNPADSAPGTIRGDLCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E+I
Sbjct: 126 SAKKEIGLWFTEKEVI 141


>gi|239636858|ref|ZP_04677857.1| nucleoside diphosphate kinase [Staphylococcus warneri L37603]
 gi|239597532|gb|EEQ80030.1| nucleoside diphosphate kinase [Staphylococcus warneri L37603]
          Length = 149

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E+ GL +V  K   + ++ AE  Y  H+ +PF+  
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIENKGLKLVGGKLMQVPQELAEKHYGEHEGKPFYNN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDS+
Sbjct: 61  LISFITSAPVFAMVVEGEDAVAVSRHIIGSTNPSEAAPGSIRGDLGLTVGRNIIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF   EI
Sbjct: 121 ESAEREINLWFKEEEI 136


>gi|255711358|ref|XP_002551962.1| KLTH0B04004p [Lachancea thermotolerans]
 gi|238933340|emb|CAR21524.1| KLTH0B04004p [Lachancea thermotolerans]
          Length = 153

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+  I+   ED G  +VA K    +++     Y  H D+PFFP++
Sbjct: 6   ERTFIAIKPDGVQRGLVAKILARFEDRGFKLVAVKLLRPSQELLRQHYAEHVDKPFFPKM 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
              M SGPV   V +G++A+ + R ++G T+P  +  GTIR  + I +G N  HGSDS++
Sbjct: 66  SAFMSSGPVLATVWEGKDAVRQGRVILGATNPLNSAPGTIRGDFAIDMGRNVCHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 126 SAQREIALWFQPEELV 141


>gi|124024518|ref|YP_001018825.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT
           9303]
 gi|166233001|sp|A2CDK0|NDK_PROM3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|123964804|gb|ABM79560.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT
           9303]
          Length = 152

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ A + Y +H++RPFF
Sbjct: 1   MAVERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLAPSRELAGEHYGVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 61  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
              TA  EI+ WF+  E+
Sbjct: 121 GPDTAQFEINLWFSPEEL 138


>gi|86607769|ref|YP_476531.1| nucleoside diphosphate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|109892794|sp|Q2JPL4|NDK_SYNJB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|86556311|gb|ABD01268.1| nucleoside diphosphate kinase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 149

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 91/137 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G+I++ LE  G  +V  K   ++++ AE  Y  HK+RPFF  
Sbjct: 1   MERTFIAIKPDGVQRGLVGTIIQRLESRGYQLVGLKLVQVSQELAEAHYAEHKERPFFHS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V +G+  I+  R+++G T+P +A  GTIR  +GI IG N IHGSD +
Sbjct: 61  LVKFITSGPVVAMVWQGKGVIAAARKLIGKTNPLEAEPGTIRGDFGIDIGRNLIHGSDGV 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF  +E++
Sbjct: 121 ETAQREIALWFDESELV 137


>gi|209527061|ref|ZP_03275576.1| Nucleoside-diphosphate kinase [Arthrospira maxima CS-328]
 gi|209492489|gb|EDZ92829.1| Nucleoside-diphosphate kinase [Arthrospira maxima CS-328]
          Length = 149

 Score =  180 bits (458), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LIG I+K  E  G  +V  K    +R+ AE  Y +HK+RPFF +
Sbjct: 1   MERTFLAIKPDGVQRGLIGEIIKRFEAKGFTLVGLKIMKASRQLAEQHYDVHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGP+   V +GE  I+  R+++G T+P  A  GT+R  +GIS+G N IHGSD+ 
Sbjct: 61  LVSFIISGPLVAMVWEGEGVIASARKIIGATNPLNAEPGTLRGDFGISVGRNLIHGSDAP 120

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 121 ETAQKEIALWFKDEELV 137


>gi|110671458|gb|ABG81980.1| putative abnormal wing disc-like protein [Diaphorina citri]
          Length = 153

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 85/137 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G+I+K  ED G  +VA KF W + +  +  Y     +PFFP L
Sbjct: 6   ERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G T+P  +  GT+R    I +G N +HGSDS++
Sbjct: 66  VKYMSSGPVVPMVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLCIQVGRNIMHGSDSVE 125

Query: 124 TALEEISYWFARNEIIG 140
           +A +EI+ WF   E+IG
Sbjct: 126 SAKKEIALWFTEKEVIG 142


>gi|326436534|gb|EGD82104.1| nucleoside diphosphate kinase 2 [Salpingoeca sp. ATCC 50818]
          Length = 151

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 55/138 (39%), Positives = 84/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R L+G I+K  E  G  +VA K    + +  E+ Y   K + FF
Sbjct: 1   MPRERTYIMIKPDGVQRGLVGEIIKRFEQKGFKLVALKLKTASTELLEEHYADLKGKKFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+ M SGPV   V +G +A+   R+++G+T P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PSLVKYMASGPVCCMVWEGTDAVYFGRKLLGETRPYDSAPGTIRGDFCVEVGRNICHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           ++++A +EI+ WF   E+
Sbjct: 121 AVESAEKEIALWFTPEEL 138


>gi|317121936|ref|YP_004101939.1| nucleoside diphosphate kinase [Thermaerobacter marianensis DSM
           12885]
 gi|315591916|gb|ADU51212.1| nucleoside diphosphate kinase [Thermaerobacter marianensis DSM
           12885]
          Length = 151

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I+  LE  GL +V  K   ++ + A   Y +H+ +PFFP 
Sbjct: 1   MERTFVMVKPDGVQRGLVGEIIARLERKGLKLVGLKMLQVSEELARRHYAVHEGKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + S PV   V +G EA++  R ++G TD  KA  GTIR      IG N +HGSDS 
Sbjct: 61  LIRFITSAPVVAMVWEGREAVAVVRNLLGPTDGAKAAPGTIRGDLANDIGFNLVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A +EI+ WF ++E++
Sbjct: 121 ESARQEIALWFRQDELL 137


>gi|238734462|gb|ACR55625.1| nucleoside diphosphate kinase 2 [Branchiostoma belcheri
           tsingtauense]
          Length = 171

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 82/135 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E++F MIKPD V+R L+G ++K  E  G  +VA KF     +  ++ Y+    +PF+  L
Sbjct: 23  ERSFIMIKPDGVQRGLVGEVIKRFEQKGFKLVAMKFMQATEEHMKEHYIDLAKKPFYAGL 82

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
            + M + PV   V +G + +   R ++G+T+P  +  GTIR  Y + +G N +HGSDS++
Sbjct: 83  CKYMSTSPVVPMVWEGLDVVRTGRVMLGETNPADSKPGTIRGDYCVEVGRNLVHGSDSVE 142

Query: 124 TALEEISYWFARNEI 138
           +A +EI+ WF  +E+
Sbjct: 143 SAKKEIALWFKDDEL 157


>gi|148243476|ref|YP_001228633.1| nucleoside diphosphate kinase [Synechococcus sp. RCC307]
 gi|147851786|emb|CAK29280.1| Nucleoside diphosphate kinase [Synechococcus sp. RCC307]
          Length = 187

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ AE  Y +HK+RPFF
Sbjct: 36  MSTERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFF 95

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 96  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 155

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 156 AAETAQFEIGLWFQPSEL 173


>gi|161669226|gb|ABX75465.1| nucleoside diphosphate kinase [Lycosa singoriensis]
          Length = 154

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 77/136 (56%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+   E  G  +VA KF   +++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIISRFEKKGFKLVAMKFMQASQELLEKHYADLAGRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M  GPV   V +G   +   R+++G T+P  +  GT+R    I +G N IHGSDS  
Sbjct: 66  VSYMQLGPVVPMVWEGLNVVKTGRDIIGATNPMDSQPGTLRGDLCIQVGRNIIHGSDSCP 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+ 
Sbjct: 126 SAEKEIALWFKEEELC 141


>gi|325652098|ref|NP_001191688.1| nucleoside diphosphate kinase A [Sus scrofa]
          Length = 152

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VTYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|109899435|ref|YP_662690.1| nucleoside-diphosphate kinase [Pseudoalteromonas atlantica T6c]
 gi|119372045|sp|Q15R52|NDK_PSEA6 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|109701716|gb|ABG41636.1| nucleoside diphosphate kinase [Pseudoalteromonas atlantica T6c]
          Length = 143

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N+IG+I    E  GL +VA+K   ++++QAE FY  H +RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMLHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A+ KNRE+MG T+P +AL GT+R  Y  SI EN+ HGSD
Sbjct: 61  GALVEFMTSGPVMVQVLEGENAVLKNREIMGATNPAEALAGTLRADYAASIDENACHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EI+Y+F+  EI 
Sbjct: 121 APESAAREIAYFFSDEEIC 139


>gi|242240159|ref|YP_002988340.1| nucleoside-diphosphate kinase [Dickeya dadantii Ech703]
 gi|242132216|gb|ACS86518.1| Nucleoside-diphosphate kinase [Dickeya dadantii Ech703]
          Length = 143

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV +N+IG+I    E  G  +VAAK   + R QAE FY  H+ +PFF
Sbjct: 1   MTVERTFSIIKPNAVAKNVIGAIYARFESAGFKIVAAKMLHLTRDQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  DGLVSFMTSGPVVVQVLEGENAVQRHRDIMGATNPANALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+F+ +EI 
Sbjct: 121 SVASAEREIAYFFSADEIC 139


>gi|73963227|ref|XP_852718.1| PREDICTED: similar to expressed in non-metastatic cells 1, protein
           (NM23A) (nucleoside diphosphate kinase) [Canis
           familiaris]
          Length = 152

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 87/136 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+RNL+G I+K LE  G C++A K    +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRNLVGEIIKRLEQKGFCLIAMKLIQASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G  A+   R ++G+T+P ++  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMQSGPVVATVWEGLNAVKTGRVMLGETNPGESKPGTIRGDFCIQVGRNVIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFQPEELV 140


>gi|260776724|ref|ZP_05885619.1| nucleoside diphosphate kinase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607947|gb|EEX34212.1| nucleoside diphosphate kinase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 142

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+RNLIG I   +E  GL ++AAK   +  +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIIKPDAVERNLIGEIYHRIEKAGLQIIAAKMVQLTEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE+AIS+ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGEDAISRYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F + EI 
Sbjct: 121 SPESAAREIEFFFPQAEIC 139


>gi|149375015|ref|ZP_01892788.1| Nucleoside diphosphate kinase [Marinobacter algicola DG893]
 gi|149360904|gb|EDM49355.1| Nucleoside diphosphate kinase [Marinobacter algicola DG893]
          Length = 142

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E   L +VAAK   + ++QAE FY  HK+RPFF
Sbjct: 1   MSNERTLSIIKPDAVAKNVIGEIYTRFEKADLTIVAAKMMHLTQEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+G  AI KNR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVAFMTSGPVVVQVLEGNGAILKNRDLMGATNPKEAEAGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  +EI 
Sbjct: 121 SAASAEREIAYFFNDSEIC 139


>gi|325297009|ref|NP_001191679.1| nucleoside diphosphate kinase B [Oryctolagus cuniculus]
          Length = 152

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MAHLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 121 DSVKSAEKEISLWFQPEELV 140


>gi|258627186|ref|ZP_05721974.1| nucleoside diphosphate kinase [Vibrio mimicus VM603]
 gi|262172173|ref|ZP_06039851.1| nucleoside diphosphate kinase [Vibrio mimicus MB-451]
 gi|258580488|gb|EEW05449.1| nucleoside diphosphate kinase [Vibrio mimicus VM603]
 gi|261893249|gb|EEY39235.1| nucleoside diphosphate kinase [Vibrio mimicus MB-451]
          Length = 142

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAVKRNLIG I   +E  GL ++AAK   ++ +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIIKPDAVKRNLIGEIYHRIEKAGLQIIAAKMVHLSEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI + RE+MG T+P++A  GT+R  Y +S+  NS+HGSD
Sbjct: 61  EPLKEFMTSGPIMVQVLEGENAIVRYRELMGKTNPEEAACGTLRADYALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI ++F  +EI 
Sbjct: 121 SPASAAREIEFFFPESEIC 139


>gi|325197188|ref|NP_001191444.1| nucleoside diphosphate kinase A [Macaca mulatta]
          Length = 152

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SAEKEISLWFHPEELV 140


>gi|322791096|gb|EFZ15678.1| hypothetical protein SINV_12396 [Solenopsis invicta]
          Length = 161

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E+ G  +VA K  W +    +  Y     RPFFP L
Sbjct: 14  ERTFIMVKPDGVQRGLVGKIIQRFEEKGFKLVAMKMLWPSEDLLKKHYADLASRPFFPGL 73

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SG V   V +G   +   R ++G+T+PK +  GTIR  + I +G N IHGSDS++
Sbjct: 74  VKYMSSGAVVPMVWEGLNVVKTGRVMLGETNPKDSAPGTIRGDFCIQVGRNIIHGSDSVE 133

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E+I
Sbjct: 134 SAKKEISLWFGEKEVI 149


>gi|197128290|gb|ACH44788.1| putative nucleoside diphosphate kinase variant 2 [Taeniopygia
           guttata]
          Length = 173

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRPFFP L
Sbjct: 26  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFVHASEDLLKQHYIDLKDRPFFPGL 85

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 86  VKYMNSGPIVAMVWEGLNVVKTVRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 145

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 146 SAQKEINLWFKPAELI 161


>gi|119224069|gb|AAI26770.1| NME1 protein [Bos taurus]
 gi|151556410|gb|AAI48016.1| NME1 protein [Bos taurus]
          Length = 152

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFRPEELV 140


>gi|1709243|sp|P52175|NDKA2_BOVIN RecName: Full=Nucleoside diphosphate kinase A 2; Short=NDK A 2;
           Short=NDP kinase A 2; AltName: Full=Nucleoside
           diphosphate kinase NBR-B; Short=NDK NBR-B
 gi|1064897|emb|CAA63533.1| nucleoside-diphosphate kinase NBR-B [Bos taurus]
          Length = 152

 Score =  180 bits (457), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFRPEELV 140


>gi|1709242|sp|P52174|NDKA1_BOVIN RecName: Full=Nucleoside diphosphate kinase A 1; Short=NDK A 1;
           Short=NDP kinase A 1; AltName: Full=Nucleoside
           diphosphate kinase NBR-A; Short=NDK NBR-A
 gi|4558116|pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina
 gi|4558117|pdb|1BHN|B Chain B, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina
 gi|4558118|pdb|1BHN|C Chain C, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina
 gi|4558119|pdb|1BHN|D Chain D, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina
 gi|4558120|pdb|1BHN|E Chain E, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina
 gi|4558121|pdb|1BHN|F Chain F, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina
 gi|1064895|emb|CAA63532.1| nucleoside-diphosphate kinase NBR-A [Bos taurus]
          Length = 152

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LIG I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFHPEELV 140


>gi|297616335|ref|YP_003701494.1| nucleoside-diphosphate kinase [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144172|gb|ADI00929.1| Nucleoside-diphosphate kinase [Syntrophothermus lipocalidus DSM
           12680]
          Length = 148

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 84/137 (61%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I+  +E  G  +V  K   +++  AE  Y  H+ +PFF E
Sbjct: 1   MERTFVMVKPDGVERGLVGEIIGRIEAKGFKLVGLKMLKLSQAMAERHYAEHRGKPFFQE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   V +G   I   R++MG T+P +A  GTIR  +GI I +N IHGSDS 
Sbjct: 61  LVDFITSSPVVAMVWEGNGVIESVRKLMGKTNPLEAEPGTIRGDFGIYISKNIIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F  +E++
Sbjct: 121 ESAAREIEIFFRPDELV 137


>gi|28897378|ref|NP_796983.1| nucleoside diphosphate kinase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838556|ref|ZP_01991223.1| nucleoside diphosphate kinase [Vibrio parahaemolyticus AQ3810]
 gi|260363555|ref|ZP_05776384.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus K5030]
 gi|260876338|ref|ZP_05888693.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus AN-5034]
 gi|260898609|ref|ZP_05907105.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus Peru-466]
 gi|260899291|ref|ZP_05907686.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus AQ4037]
 gi|31340240|sp|Q87S20|NDK_VIBPA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|28805590|dbj|BAC58867.1| nucleoside diphosphate kinase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748071|gb|EDM58930.1| nucleoside diphosphate kinase [Vibrio parahaemolyticus AQ3810]
 gi|308086927|gb|EFO36622.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus Peru-466]
 gi|308092912|gb|EFO42607.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus AN-5034]
 gi|308106646|gb|EFO44186.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus AQ4037]
 gi|308112997|gb|EFO50537.1| nucleoside-diphosphate kinase [Vibrio parahaemolyticus K5030]
 gi|328472599|gb|EGF43462.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Vibrio
           parahaemolyticus 10329]
          Length = 141

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E  GL ++AAK   +  +QA  FY  H+ + FF
Sbjct: 1   MALERTFSIVKPDAVERNLIGEIYNRIEKAGLRIIAAKMVHLTEEQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GT+R  Y +S+  NS+HGSD
Sbjct: 61  QPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAAAGTLRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|88858484|ref|ZP_01133126.1| nucleoside diphosphate kinase [Pseudoalteromonas tunicata D2]
 gi|88820101|gb|EAR29914.1| nucleoside diphosphate kinase [Pseudoalteromonas tunicata D2]
          Length = 143

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N IG+I    E  GL +VA+K   +++++AE FY  H  RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNHIGAIYNRFESAGLKIVASKMVHLSKEKAEGFYAEHSARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+ KNRE+MG T+P  AL GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVQVLEGENAVLKNREIMGATNPADALAGTLRADYADSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +L++A  EI+Y+F+  EI 
Sbjct: 121 ALESAAREIAYFFSDEEIC 139


>gi|332026603|gb|EGI66712.1| Nucleoside diphosphate kinase [Acromyrmex echinatior]
          Length = 152

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +V  K  W +    +  Y     RPFFP L
Sbjct: 5   ERTFIMVKPDGVQRGLVGKIIQRFEQKGFKLVTIKMLWPSEDLLKKHYADLASRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+PK +  GTIR  + + +G N IHGSDS++
Sbjct: 65  VTYMSSGPVVPMVWEGLNVVKTGRVMLGETNPKDSAPGTIRGDFCVQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E+I
Sbjct: 125 SAKKEIELWFGEKEVI 140


>gi|209964855|ref|YP_002297770.1| nucleoside diphosphate kinase [Rhodospirillum centenum SW]
 gi|226729850|sp|B6IN60|NDK_RHOCS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|209958321|gb|ACI98957.1| Nucleoside diphosphate kinase [Rhodospirillum centenum SW]
          Length = 140

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S++KPDA +RNL G I    E+ GL +VA K   + R+QAE FY++H +RPF+
Sbjct: 1   MAVERTLSIVKPDATRRNLTGKINARFEEAGLRIVAQKRIRLTREQAEQFYIVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGPV +QVL+GE A+++NRE+MG T+P  A  GTIR  +  SI  NS+HGSD
Sbjct: 61  GELVSFMISGPVVVQVLEGENAVARNREIMGATNPANAAPGTIRKDFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           SL+ A  EI+Y+F+  EI+G
Sbjct: 121 SLENAATEIAYFFSGTEIVG 140


>gi|261252075|ref|ZP_05944648.1| nucleoside diphosphate kinase [Vibrio orientalis CIP 102891]
 gi|260935466|gb|EEX91455.1| nucleoside diphosphate kinase [Vibrio orientalis CIP 102891]
          Length = 141

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E  GL ++AAK   +  +QA  FY  H+ +PFF
Sbjct: 1   MPLERTFSIVKPDAVERNLIGEIYHRIEKAGLQIIAAKMVRLTEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE+AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGEDAIARYRELMGKTNPEEAACGTIRADYAVSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|254490100|ref|ZP_05103292.1| Nucleoside diphosphate kinase superfamily [Methylophaga thiooxidans
           DMS010]
 gi|224464688|gb|EEF80945.1| Nucleoside diphosphate kinase superfamily [Methylophaga thiooxydans
           DMS010]
          Length = 143

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL +VAAK   + ++QAE FY  HK+RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGEIYTRFEKAGLKIVAAKMMHLTQEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE ++  +R++MG T+P +A  GTIR  +  SI EN++HGSD
Sbjct: 61  NDLVSFMTSGPVTVSVLEGENSVLTHRDLMGATNPAEADAGTIRADFAQSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  E++Y+FA  E+ 
Sbjct: 121 SVESAAREVAYFFADGEVC 139


>gi|297372568|emb|CBA62654.1| BVpp17b protein [Chelonus inanitus]
          Length = 156

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 58/134 (43%), Positives = 83/134 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G I++  E+ G  +VA K  W +    ++ Y     RPFFP L
Sbjct: 6   ERTFIMIKPDGVQRGLVGKIIQRFEEKGFKLVAMKMVWASEDLLKEHYADLSSRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G  A+   R ++G+T+PK +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VKYMSSGPVVPMVWEGLNAVKTGRVMLGETNPKDSAPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNE 137
           +A +EI  WF   +
Sbjct: 126 SAQKEIKLWFGEKD 139


>gi|121543999|gb|ABM55663.1| putative abnormal wing disc-like protein [Maconellicoccus hirsutus]
          Length = 171

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R ++G I++  E  G  +VA KF W + +  +  Y     RPFFP L
Sbjct: 24  ERTFIMVKPDGVQRGIVGKIIERFEAKGFKLVALKFTWASEELLQKHYSDLAGRPFFPGL 83

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G TDPK +  GTIR  + I +G N IHGSDS+ 
Sbjct: 84  VKYMSSGPVVPMVWEGLNVVKTGRVMLGATDPKDSAPGTIRGDFCIQVGRNIIHGSDSVD 143

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF  +E++
Sbjct: 144 SANKEISLWFTPDEVV 159


>gi|224121906|ref|XP_002318702.1| predicted protein [Populus trichocarpa]
 gi|222859375|gb|EEE96922.1| predicted protein [Populus trichocarpa]
          Length = 152

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 51/140 (36%), Positives = 75/140 (53%), Gaps = 3/140 (2%)

Query: 3   IEK---TFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           +E+   T+ M+KPD V+R L+G I+   E  G  +   K     ++ AE+ Y   K +PF
Sbjct: 1   MEQVDETYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCPKELAEEHYKDLKAKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP L+  + SGPV     +G   ++  R+++G TDP KA  GTIR    +  G N +HGS
Sbjct: 61  FPGLIDYITSGPVVCMAWEGVGVVASARKLIGSTDPLKAEPGTIRGDLAVQTGRNVVHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS +    EI  WF   E+ 
Sbjct: 121 DSPENGKREIGLWFKEGELC 140


>gi|226946071|ref|YP_002801144.1| Nucleoside-diphosphate kinase [Azotobacter vinelandii DJ]
 gi|259511697|sp|C1DE61|NDK_AZOVD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226720998|gb|ACO80169.1| Nucleoside-diphosphate kinase [Azotobacter vinelandii DJ]
          Length = 143

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I+   E  GL VVAAK   ++ ++A  FY  HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEILTRFEKAGLSVVAAKMVQLSEREAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI+KNRE+MG TDPKKA  GTIR  + +SI EN++HGSD
Sbjct: 61  KDLVSFMTSGPVVVQVLEGEGAIAKNRELMGATDPKKAEPGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+FA  E+ 
Sbjct: 121 SEASAAREIAYFFAATEVC 139


>gi|125579646|gb|EAZ20792.1| hypothetical protein OsJ_36416 [Oryza sativa Japonica Group]
          Length = 217

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 76/138 (55%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   K++PFFP
Sbjct: 68  SVEQSYIMIKPDGVQRGLVGEIISRFEKKGFVLKGLKLFQCPKDLAQEHYKDLKEKPFFP 127

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L++ + SGPV     +G   ++  R+++G T+P +A  GTIR    +  G N +HGSDS
Sbjct: 128 GLIEYITSGPVVCMAWEGNGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDS 187

Query: 122 LKTALEEISYWFARNEII 139
                 EI+ WF   E+ 
Sbjct: 188 PDNGKREIALWFKEGELC 205


>gi|125536940|gb|EAY83428.1| hypothetical protein OsI_38642 [Oryza sativa Indica Group]
          Length = 217

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 76/138 (55%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   K++PFFP
Sbjct: 68  SVEQSYIMIKPDGVQRGLVGEIISRFEKKGFVLKGLKLFQCPKDLAQEHYKDLKEKPFFP 127

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L++ + SGPV     +G   ++  R+++G T+P +A  GTIR    +  G N +HGSDS
Sbjct: 128 GLIEYITSGPVVCMAWEGNGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDS 187

Query: 122 LKTALEEISYWFARNEII 139
                 EI+ WF   E+ 
Sbjct: 188 PDNGKREIALWFKEGELC 205


>gi|115488968|ref|NP_001066971.1| Os12g0548300 [Oryza sativa Japonica Group]
 gi|108862799|gb|ABG22043.1| Nucleoside diphosphate kinase 2, chloroplast precursor, putative,
           expressed [Oryza sativa Japonica Group]
 gi|113649478|dbj|BAF29990.1| Os12g0548300 [Oryza sativa Japonica Group]
 gi|215697751|dbj|BAG91745.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 220

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 76/138 (55%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   K++PFFP
Sbjct: 71  SVEQSYIMIKPDGVQRGLVGEIISRFEKKGFVLKGLKLFQCPKDLAQEHYKDLKEKPFFP 130

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L++ + SGPV     +G   ++  R+++G T+P +A  GTIR    +  G N +HGSDS
Sbjct: 131 GLIEYITSGPVVCMAWEGNGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDS 190

Query: 122 LKTALEEISYWFARNEII 139
                 EI+ WF   E+ 
Sbjct: 191 PDNGKREIALWFKEGELC 208


>gi|312221561|emb|CBY01501.1| similar to nucleoside diphosphate kinase [Leptosphaeria maculans]
          Length = 152

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 78/138 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E+ G  + A K    +++  E  Y     +PFF
Sbjct: 1   MTTEQTFIAIKPDGVQRGLIGPIISRFENRGFKLAAIKLVTPSKEHLEKHYEDLAGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M SGPV   V +G +A+   R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PGLIAYMGSGPVCAMVWEGRDAVKTGRAILGATNPLASAPGTIRGDFALDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++   +EI+ WF   E+
Sbjct: 121 SVENGKKEIALWFKEGEV 138


>gi|114563587|ref|YP_751100.1| nucleoside-diphosphate kinase [Shewanella frigidimarina NCIMB 400]
 gi|114334880|gb|ABI72262.1| nucleoside diphosphate kinase [Shewanella frigidimarina NCIMB 400]
          Length = 164

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H  RPFF
Sbjct: 22  MAIERTFSIIKPDAVAKNHIGAIYNRFESAGLKIIASKMVQLSKEQAEGFYAEHSARPFF 81

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+  NRE+MG T+P +A +GT+R  Y  SI EN++HGSD
Sbjct: 82  GALVSFMTSGPVMVQVLEGENAVLANREIMGATNPAEAARGTLRADYAASIDENAVHGSD 141

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F+ +E+ 
Sbjct: 142 AVESAAREIAYFFSADEVC 160


>gi|325652120|ref|NP_001191691.1| nucleoside diphosphate kinase B [Taeniopygia guttata]
 gi|197128292|gb|ACH44790.1| putative nucleoside diphosphate kinase variant 1 [Taeniopygia
           guttata]
 gi|197128293|gb|ACH44791.1| putative nucleoside diphosphate kinase variant 1 [Taeniopygia
           guttata]
 gi|197128294|gb|ACH44792.1| putative nucleoside diphosphate kinase variant 1 [Taeniopygia
           guttata]
 gi|197129936|gb|ACH46434.1| putative nucleoside diphosphate kinase variant 1 [Taeniopygia
           guttata]
          Length = 153

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRPFFP L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFVHASEDLLKQHYIDLKDRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VKYMNSGPIVAMVWEGLNVVKTVRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 126 SAQKEINLWFKPAELI 141


>gi|56963655|ref|YP_175386.1| nucleoside diphosphate kinase [Bacillus clausii KSM-K16]
 gi|67460635|sp|Q5WGT0|NDK_BACSK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56909898|dbj|BAD64425.1| nucleoside diphosphate kinase [Bacillus clausii KSM-K16]
          Length = 147

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 89/136 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+RNLIG+IV   E  G  + AAK   ++++ AE  Y  H++RPFF E
Sbjct: 1   MERTYVMVKPDGVQRNLIGNIVSRFEQKGYTLAAAKLVTLSKETAETHYSEHRERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I   R+++G T+P +A  GTIR    +++G N +HGSDS 
Sbjct: 61  LVSFITSGPVFAMVWEGEGVIKAARQLIGATNPSEAAPGTIRGDLAVNVGMNVVHGSDSP 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ +F   E+
Sbjct: 121 ESAEREIAIFFKEEEL 136


>gi|262395121|ref|YP_003286975.1| nucleoside diphosphate kinase [Vibrio sp. Ex25]
 gi|262338715|gb|ACY52510.1| nucleoside diphosphate kinase [Vibrio sp. Ex25]
          Length = 141

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 68/138 (49%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+RNLIG I   +E  GL +VAAK   +   QA  FY  H+ + FF
Sbjct: 1   MALERTFSIIKPDAVERNLIGEIYNRIEKAGLRIVAAKMVHLTEDQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GT+R  Y +S+  NS+HGSD
Sbjct: 61  PPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTLRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI ++F  +E+
Sbjct: 121 SPESAAREIEFFFPESEV 138


>gi|213406603|ref|XP_002174073.1| nucleoside diphosphate kinase [Schizosaccharomyces japonicus
           yFS275]
 gi|212002120|gb|EEB07780.1| nucleoside diphosphate kinase [Schizosaccharomyces japonicus
           yFS275]
          Length = 150

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 86/138 (62%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF  IKPDAV+R LIG+I+   E  G  + A K    +R+ AE+ Y  HK +PFF 
Sbjct: 1   MNEQTFIAIKPDAVQRGLIGAIISRFEVKGYTLRAMKLIVPSRQLAEEHYAEHKGKPFFE 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  + SGPV   + +G+E +   R ++G T+P  +  GTIR  YG+ +G N  HGSDS
Sbjct: 61  PLVSFLTSGPVCAMIWEGKEVVKTGRVMLGATNPLASAPGTIRGDYGVDVGRNVCHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
           +++A  EI+ WF  +E++
Sbjct: 121 VESAKREIALWFEPSEVL 138


>gi|185135416|ref|NP_001117775.1| nucleoside diphosphate kinase [Oncorhynchus mykiss]
 gi|28436149|gb|AAO42980.1| nucleoside diphosphate kinase [Oncorhynchus mykiss]
          Length = 151

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF        +  Y   KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRRLVGDIIKRFELKGFKLVGMKFIQAPESLLKKHYADLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  Y I +G N IHGSDS++
Sbjct: 65  VSYMASGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDYCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+ 
Sbjct: 125 SANKEINLWFKPEELC 140


>gi|198424347|ref|XP_002121438.1| PREDICTED: similar to nucleoside diphosphate kinase [Ciona
           intestinalis]
          Length = 178

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 54/137 (39%), Positives = 77/137 (56%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+TF  +KPD V+R L+G IV   E  G  +VA K         +  Y     +PFF 
Sbjct: 29  AMERTFIAVKPDGVQRGLVGKIVARFEAKGFKLVAMKMATATEDHLKKHYSDLSSKPFFA 88

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M SGPV   V +G+  +   R ++G T+P  +L GTIR  +GI +G N  HGSDS
Sbjct: 89  GLVKYMGSGPVVAMVWEGQGVVKTGRVMLGATNPADSLPGTIRGDFGIQVGRNVCHGSDS 148

Query: 122 LKTALEEISYWFARNEI 138
           +++A +EI  WF   E+
Sbjct: 149 VESATKEIGLWFTDCEL 165


>gi|148979604|ref|ZP_01815609.1| nucleoside diphosphate kinase [Vibrionales bacterium SWAT-3]
 gi|145961689|gb|EDK26986.1| nucleoside diphosphate kinase [Vibrionales bacterium SWAT-3]
          Length = 144

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAVKRNL+G I   +E  GL ++AAK   +  +QA  FY  H+ + FF
Sbjct: 1   MALERTFSIVKPDAVKRNLVGEIYHRIEKAGLEIIAAKMVRLTEEQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR  Y IS+  NS+HGSD
Sbjct: 61  GPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYAISMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|23016253|ref|ZP_00056011.1| COG0105: Nucleoside diphosphate kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 140

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 97/140 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA +RNL G I    E+ GL  VA K   + + QA+ FY +H +R FF
Sbjct: 1   MAIERTLSIIKPDATRRNLTGKINARFEEAGLRFVAQKRVQLTKAQAQQFYSVHAERSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGPV +QVL+GE A+++NRE+MG T+P  A  GTIR  +  S+  NS+HGSD
Sbjct: 61  GELVDFMISGPVVVQVLEGEGAVARNREIMGATNPANAAPGTIRADFAESVEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+Y+FA +EI+G
Sbjct: 121 SAENAAIEIAYFFAGSEIVG 140


>gi|329120381|ref|ZP_08249048.1| nucleoside diphosphate kinase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327462336|gb|EGF08662.1| nucleoside diphosphate kinase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 176

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++T S++KPDAV +NLIG I    E+ GL +VAAK   ++R++AE FY +HKDRPFF
Sbjct: 36  MTIQRTLSIVKPDAVGKNLIGRIYSRFEENGLKIVAAKMKHLSREEAEGFYAVHKDRPFF 95

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A++KNRE+MG T+P++A  GTIR  +  S+G+N++HGSD
Sbjct: 96  AGLVEFMTSGPVMVQVLEGENAVAKNRELMGATNPQEAAAGTIRADFADSVGQNAVHGSD 155

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  EI+Y+FA  EI 
Sbjct: 156 SAENAALEIAYFFAATEIC 174


>gi|327400364|ref|YP_004341203.1| Nucleoside diphosphate kinase [Archaeoglobus veneficus SNP6]
 gi|327315872|gb|AEA46488.1| Nucleoside diphosphate kinase [Archaeoglobus veneficus SNP6]
          Length = 149

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G ++  LE  GL +V  K  W+  + A + Y  H ++PFF  
Sbjct: 1   MERTFVMVKPDGVQRGLVGEVISRLERKGLKIVGLKMMWIQEELAMEHYAEHAEKPFFQS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V++G++A+   R ++G T+P +A  GTIR  +G+ IG N +H SDSL
Sbjct: 61  LVDYITSGPVVAMVVEGKDAVKVVRTLVGATNPVEASPGTIRGDFGLDIGRNVVHASDSL 120

Query: 123 KTALEEISYWFARNEII 139
           K+A  EIS +F   E+I
Sbjct: 121 KSAEREISLFFDAEELI 137


>gi|75909630|ref|YP_323926.1| nucleoside diphosphate kinase [Anabaena variabilis ATCC 29413]
 gi|20138835|sp|Q8YRP2|NDK_ANASP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|109892765|sp|Q3M7K5|NDK_ANAVT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|75703355|gb|ABA23031.1| nucleoside diphosphate kinase [Anabaena variabilis ATCC 29413]
          Length = 149

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 92/137 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I++  E  G  +V  KF  ++++ AE  Y +H++RPFFP 
Sbjct: 1   MERTFLAIKPDGVQRGLVGEIIRRFETKGFTLVGLKFLQVSKELAEQHYGVHRERPFFPS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V +G+  I+  R+++G T+P  A  GTIR  +GI+IG N IHGSD+ 
Sbjct: 61  LVEFITSGPVVAMVWEGDGVIASARKIIGATNPLTAEPGTIRGDFGINIGRNLIHGSDAP 120

Query: 123 KTALEEISYWFARNEII 139
           +TA +E+S WF   E++
Sbjct: 121 ETAQKEVSLWFTDAELV 137


>gi|6225751|sp|P70010|NDKA1_XENLA RecName: Full=Nucleoside diphosphate kinase A1; Short=NDK A1;
           Short=NDP kinase A1; AltName: Full=NM23/nucleoside
           diphosphate kinase A1
 gi|1655706|emb|CAA66474.1| NM23/nucleoside diphosphate kinase [Xenopus laevis]
 gi|51258565|gb|AAH79795.1| Nm23ndk-a protein [Xenopus laevis]
          Length = 154

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   ++      Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLMGDIIKRFEQKGFRLVAMKFQQASQDLLRQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VEYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFKDEELV 141


>gi|16758266|ref|NP_445959.1| nucleoside diphosphate kinase 3 [Rattus norvegicus]
 gi|12621064|gb|AAG54075.1| nucleoside diphosphate kinase DR-nm23 [Rattus norvegicus]
          Length = 169

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y+  ++RPF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELRERPFYSRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G TDP  A  GTIR  + + +G+N IHGSDS++
Sbjct: 82  VKYMGSGPVVAMVWQGLDVVRASRALIGATDPGDATPGTIRGDFCVEVGKNVIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SAQREIALWFREDELL 157


>gi|194500331|gb|ACF75416.1| nucleoside diphosphate kinase [Sparus aurata]
          Length = 152

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R +IG I+K  E  G  +V  K    ++   E  Y   K RPFFP L
Sbjct: 6   ERTFIAIKPDGVQRGIIGEIIKRFEAKGFKLVGMKMMHASQDHLEKHYADLKGRPFFPTL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G+  +   R ++G+T+P  +  GTIR  + I + +N IHGSDS++
Sbjct: 66  IDYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF  +E++
Sbjct: 126 SANKEISLWFTDDELV 141


>gi|187109140|ref|NP_001119625.1| abnormal wing discs 1 [Acyrthosiphon pisum]
 gi|90186497|gb|ABD91521.1| abnormal wing disc-like protein [Acyrthosiphon pisum]
 gi|239788904|dbj|BAH71107.1| ACYPI000025 [Acyrthosiphon pisum]
          Length = 157

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E+ G  +VA KF W + +     Y     RPFFP L
Sbjct: 8   ERTFIMVKPDGVQRGLVGKIIKRFEEKGFKLVAMKFMWASEELLSKHYADLSSRPFFPGL 67

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M S PV   V +G + +   R ++G TDPK +  GTIR    + +G N IHGSD+++
Sbjct: 68  VKYMASAPVVPMVWEGLDVVKTGRFILGATDPKNSNPGTIRGDLCVQVGRNIIHGSDAVE 127

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF+  E++
Sbjct: 128 SANKEIALWFSEKEVV 143


>gi|149190093|ref|ZP_01868370.1| nucleoside diphosphate kinase [Vibrio shilonii AK1]
 gi|148836123|gb|EDL53083.1| nucleoside diphosphate kinase [Vibrio shilonii AK1]
          Length = 141

 Score =  180 bits (456), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E  GL ++AAK   +  +QA+ FY  H+ +PFF
Sbjct: 1   MALERTFSIVKPDAVERNLIGEIYHRIEKAGLKIIAAKMVHLTDEQAKGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE+AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  DALREFMTSGPIMVQVLEGEDAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPTSEIC 139


>gi|2851535|sp|Q90380|NDK_COLLI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|2264338|gb|AAC60275.1| nucleoside diphosphate kinase [Columba livia]
 gi|2415423|gb|AAC78437.1| nucleoside diphosphate kinase [Columba livia]
          Length = 153

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   + +  +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGMKFVHASEELLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VKYMNSGPIVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 126 SAQKEINLWFKPAELI 141


>gi|169616043|ref|XP_001801437.1| hypothetical protein SNOG_11193 [Phaeosphaeria nodorum SN15]
 gi|111060572|gb|EAT81692.1| hypothetical protein SNOG_11193 [Phaeosphaeria nodorum SN15]
          Length = 153

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 55/138 (39%), Positives = 79/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E+ G  + A K    +++  E  Y    D+PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLIGPIISRFENRGFKLAAIKLITPSKEHLEKHYEDLSDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M SGPV   V +G +A+   R ++G T+P  +  GTIR  Y + +G N  HGSD
Sbjct: 61  PGLIAYMGSGPVCAMVWEGRDAVKTGRSILGATNPLASAPGTIRGDYALDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++   +EI+ WF   E+
Sbjct: 121 SVENGKKEIALWFKEGEV 138


>gi|330923239|ref|XP_003300159.1| hypothetical protein PTT_11324 [Pyrenophora teres f. teres 0-1]
 gi|311325834|gb|EFQ91734.1| hypothetical protein PTT_11324 [Pyrenophora teres f. teres 0-1]
          Length = 196

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 79/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R LIG I+   E+ G  + A K    +++  E  Y    D+PFF
Sbjct: 45  MTTEQTFIAVKPDGVQRGLIGPIITRFENRGFKLAAIKMVTPSKEHLEKHYADLSDKPFF 104

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M SGPV   V +G +A+   R ++G T+P  +  GTIR  Y + +G N  HGSD
Sbjct: 105 PGLIAYMGSGPVCAMVWEGRDAVKTGRSILGATNPLASAPGTIRGDYALDVGRNVCHGSD 164

Query: 121 SLKTALEEISYWFARNEI 138
           S++   +EI+ WF   E+
Sbjct: 165 SVENGKKEIALWFKEGEV 182


>gi|189209676|ref|XP_001941170.1| nucleoside diphosphate kinase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187977263|gb|EDU43889.1| nucleoside diphosphate kinase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 196

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 79/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R LIG I+   E+ G  + A K    +++  E  Y    D+PFF
Sbjct: 45  MTTEQTFIAVKPDGVQRGLIGPIITRFENRGFKLAAIKMVTPSKEHLEKHYADLSDKPFF 104

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M SGPV   V +G +A+   R ++G T+P  +  GTIR  Y + +G N  HGSD
Sbjct: 105 PGLIAYMGSGPVCAMVWEGRDAVKTGRSILGATNPLASAPGTIRGDYALDVGRNVCHGSD 164

Query: 121 SLKTALEEISYWFARNEI 138
           S++   +EI+ WF   E+
Sbjct: 165 SVENGKKEIALWFKEGEV 182


>gi|310799332|gb|EFQ34225.1| nucleoside diphosphate kinase [Glomerella graminicola M1.001]
          Length = 153

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E  G  +VA K     +   E  Y   KD+PFF
Sbjct: 1   MASEQTFIAIKPDGVQRGLIGPIISRFESRGFKLVAIKLMTPGKAHLEAHYADLKDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L++ M SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  GGLIEYMNSGPICAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   +++
Sbjct: 121 SVENAKKEIALWFKDGDVV 139


>gi|255571035|ref|XP_002526468.1| nucleoside diphosphate kinase, putative [Ricinus communis]
 gi|223534143|gb|EEF35859.1| nucleoside diphosphate kinase, putative [Ricinus communis]
          Length = 148

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 80/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFSLKGLKLITVDRSFAEQHYADLSAKPFFSG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   V +G+  ++  R ++G T+P ++  GTIR  + I IG N IHGSDS+
Sbjct: 61  LVDYIISGPVVAMVWEGKNVVTTGRTIIGATNPAQSAPGTIRGDFAIDIGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPE 133


>gi|320589983|gb|EFX02439.1| nucleoside diphosphate kinase [Grosmannia clavigera kw1407]
          Length = 151

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 55/138 (39%), Positives = 82/138 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +VA K    +++  E  Y   KD+ FF
Sbjct: 1   MATEQTFIAIKPDGVQRGLVGPIISRFEQRGYKLVALKLVSPSQEHLETHYSDLKDKAFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGP+   V +G +A+   R ++G T+P  +L GTIR  + I+ G N  HGSD
Sbjct: 61  PGLIKYMGSGPIVAMVWEGTDAVKTGRTLLGATNPLNSLPGTIRGDFAITTGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A +EI+ WF   ++
Sbjct: 121 SVENAKKEIALWFKPEDL 138


>gi|159029329|emb|CAO90195.1| ndk [Microcystis aeruginosa PCC 7806]
          Length = 149

 Score =  179 bits (455), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 88/136 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+RNL+G I++  E  G  +V  K   ++ + AE  Y +HK+RPFFP 
Sbjct: 1   MERTFLMIKPDGVQRNLVGEIIQRFEAKGFTLVGLKMMQVSSELAEKHYAVHKERPFFPS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   V +GE  I+  R+++G T+P  A  GTIR  +GIS+G N IHGSD  
Sbjct: 61  LVDFITSSPVVAMVWQGEGVIASARKIIGATNPLNAEPGTIRGDFGISVGRNLIHGSDGP 120

Query: 123 KTALEEISYWFARNEI 138
            TA +E+S WF+  E+
Sbjct: 121 DTAKDEVSLWFSDAEL 136


>gi|332305580|ref|YP_004433431.1| Nucleoside-diphosphate kinase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172909|gb|AEE22163.1| Nucleoside-diphosphate kinase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 143

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N+IG+I    E  GL +VA+K   ++++QAE FY  H +RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMIHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A+ KNRE+MG T+P +AL GT+R  Y  SI EN+ HGSD
Sbjct: 61  AALVEFMTSGPVMVQVLEGENAVVKNREIMGATNPAEALAGTLRADYAASIDENACHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EI+Y+F+  EI 
Sbjct: 121 APESAAREIAYFFSDEEIC 139


>gi|291618415|ref|YP_003521157.1| Ndk [Pantoea ananatis LMG 20103]
 gi|304398589|ref|ZP_07380461.1| Nucleoside-diphosphate kinase [Pantoea sp. aB]
 gi|308187774|ref|YP_003931905.1| Nucleoside diphosphate kinase [Pantoea vagans C9-1]
 gi|291153445|gb|ADD78029.1| Ndk [Pantoea ananatis LMG 20103]
 gi|304353800|gb|EFM18175.1| Nucleoside-diphosphate kinase [Pantoea sp. aB]
 gi|308058284|gb|ADO10456.1| Nucleoside diphosphate kinase [Pantoea vagans C9-1]
 gi|327394807|dbj|BAK12229.1| nucleoside diphosphate kinase Ndk [Pantoea ananatis AJ13355]
          Length = 143

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V AK   ++++QAE FY  H+ +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGAIYNRFESAGFKIVGAKMLQLSKEQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV + VL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPVVVSVLEGENAVQRHRDLMGATNPANALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  NEI 
Sbjct: 121 SAESAAREIAYFFGENEIC 139


>gi|170077436|ref|YP_001734074.1| nucleoside diphosphate kinase [Synechococcus sp. PCC 7002]
 gi|226729868|sp|B1XIE7|NDK_SYNP2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|169885105|gb|ACA98818.1| Nucleoside diphosphate kinase [Synechococcus sp. PCC 7002]
          Length = 149

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 90/136 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G +++  E  G  +V  K   ++R+ AE  Y +H++RPFF  
Sbjct: 1   MERTFVMVKPDGVQRGLVGDVIRRFEAKGFKLVGLKLVSVSRELAEQHYGVHRERPFFGS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +IS PV   V +G+ AI+  R+++G T+P +A  GTIR  +G+ IG N IHGSD  
Sbjct: 61  LVEFIISVPVVAMVWEGKGAIAAARKIIGATNPLEAEPGTIRGDFGVDIGRNLIHGSDGP 120

Query: 123 KTALEEISYWFARNEI 138
            TA  EI+ WF+ +E+
Sbjct: 121 DTAASEIALWFSESEL 136


>gi|242792131|ref|XP_002481891.1| nucleoside diphosphate kinase [Talaromyces stipitatus ATCC 10500]
 gi|218718479|gb|EED17899.1| nucleoside diphosphate kinase [Talaromyces stipitatus ATCC 10500]
          Length = 153

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G IV   E  G  + A K     R+  E  Y    D+PFF
Sbjct: 1   MSSEQTFIAIKPDGVQRGLVGPIVSRFESRGFKLAAIKLISPPRELLEKHYADLADKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  M+SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  PGLVTYMLSGPIVAMVWEGRDAVKTGRTILGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E+I
Sbjct: 121 SVENAKKEIALWFKEGEVI 139


>gi|302306657|ref|NP_983042.2| ABR096Cp [Ashbya gossypii ATCC 10895]
 gi|299788622|gb|AAS50866.2| ABR096Cp [Ashbya gossypii ATCC 10895]
          Length = 151

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 79/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI  I+   E  G  +V  K         +  Y  H ++PFF
Sbjct: 1   MSDERTFIAIKPDGVQRGLISQILSRFESRGYKLVGIKLVTPTENLLKQHYAEHVEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+++  M SGP+   V +G++ + + R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PKMLAYMTSGPILATVWEGKDVVKQGRVILGATNPLNSAPGTIRGDFALDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI  WF + E++
Sbjct: 121 SVESAQREIDLWFKKEELV 139


>gi|225457446|ref|XP_002263177.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297733614|emb|CBI14861.3| unnamed protein product [Vitis vinifera]
          Length = 230

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 78/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L+G I+   E  G  +   K     ++ AE+ Y   K++ FFP+
Sbjct: 82  VEETYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCPKQLAEEHYKDLKEKSFFPK 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G T+P +A  GTIR    +  G N +HGSDS 
Sbjct: 142 LIEYITSGPVVCMAWEGVGVVASARKLIGSTNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EIS WF   E+ 
Sbjct: 202 ENGKREISLWFKEGELC 218


>gi|323494801|ref|ZP_08099899.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease [Vibrio brasiliensis LMG 20546]
 gi|323499933|ref|ZP_08104892.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease [Vibrio sinaloensis DSM 21326]
 gi|323310941|gb|EGA64107.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease [Vibrio brasiliensis LMG 20546]
 gi|323315174|gb|EGA68226.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease [Vibrio sinaloensis DSM 21326]
          Length = 141

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV+RNLIG I   +E  GL ++AAK   +  +QA  FY  H+ + FF
Sbjct: 1   MALERTFSIVKPDAVERNLIGEIYHRIEKAGLQIIAAKMVRLTEEQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYAVSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|296488274|gb|DAA30387.1| nucleoside diphosphate kinase B [Bos taurus]
          Length = 150

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 65  VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 125 SAEKEINLWFKPEELI 140


>gi|74695346|sp|Q75DD1|NDK_ASHGO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
          Length = 151

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 79/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI  I+   E  G  +V  K         +  Y  H ++PFF
Sbjct: 1   MSDERTFIAIKPDGVQRGLISKILSRFESRGYKLVGIKLVTPTENLLKQHYAEHVEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+++  M SGP+   V +G++ + + R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PKMLAYMTSGPILATVWEGKDVVKQGRVILGATNPLNSAPGTIRGDFALDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI  WF + E++
Sbjct: 121 SVESAQREIDLWFKKEELV 139


>gi|241955695|ref|XP_002420568.1| nucleoside diphosphate kinase, putative [Candida dubliniensis CD36]
 gi|223643910|emb|CAX41647.1| nucleoside diphosphate kinase, putative [Candida dubliniensis CD36]
          Length = 151

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI SI+   E  G  +V  K            Y   + +PFF
Sbjct: 1   MSDERTFIAIKPDGVQRGLISSILGRFEQRGFKLVGIKLVQPTESLLRTHYEDLQSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M+SGPV   V +G++ + + R ++G T+P ++  GTIR  + I +G N  HGSD
Sbjct: 61  PSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI+ WF + E++
Sbjct: 121 SVESANKEINLWFKKEELV 139


>gi|186686304|ref|YP_001869500.1| nucleoside diphosphate kinase [Nostoc punctiforme PCC 73102]
 gi|226729836|sp|B2IX22|NDK_NOSP7 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|186468756|gb|ACC84557.1| nucleoside diphosphate kinase [Nostoc punctiforme PCC 73102]
          Length = 149

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I++  E  G  +V  KF  ++++ AE  Y +H++RPFF  
Sbjct: 1   MERTFLAIKPDGVQRGLVGEIIRRFETKGFTLVGLKFLKVSKELAEQHYGVHRERPFFGS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + S PV   V +G+  ++  R+++G T+P  +  GTIR  +GI+IG N IHGSD+ 
Sbjct: 61  LVEFITSSPVVAMVWEGDGVVASARKIIGATNPLTSEPGTIRGDFGINIGRNLIHGSDAP 120

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 121 ETAQQEIALWFKDEELV 137


>gi|113205886|ref|NP_001038075.1| nucleoside diphosphate kinase B [Sus scrofa]
 gi|115311824|sp|Q2EN76|NDKB_PIG RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=Histidine protein
           kinase NDKB
 gi|87047646|gb|ABD18456.1| nm23-H2 [Sus scrofa]
          Length = 152

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP L
Sbjct: 5   ERTFIAVKPDGVQRGLVGEIIKRFEQKGFRLVALKFLQASEELLKQHYIDLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 65  VKYMGSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SAEKEISLWFKPEELV 140


>gi|115496892|ref|NP_001069844.1| nucleoside diphosphate kinase B [Bos taurus]
 gi|115311823|sp|Q3T0Q4|NDKB_BOVIN RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=Histidine protein
           kinase NDKB
 gi|74354800|gb|AAI02301.1| Non-metastatic cells 2, protein (NM23B) expressed in [Bos taurus]
          Length = 152

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 65  VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 125 SAEKEINLWFKPEELI 140


>gi|149052074|gb|EDM03891.1| non-metastatic cell expressed protein 3 [Rattus norvegicus]
          Length = 169

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 86/136 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y+  ++RPF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELRERPFYSRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G TDP  A+ GTIR  + + +G+N IHGSDS++
Sbjct: 82  VKYMGSGPVVAMVWQGLDVVRASRALIGATDPGDAMPGTIRGDFCVEVGKNVIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SAQREIALWFREDELL 157


>gi|164662016|ref|XP_001732130.1| hypothetical protein MGL_0723 [Malassezia globosa CBS 7966]
 gi|159106032|gb|EDP44916.1| hypothetical protein MGL_0723 [Malassezia globosa CBS 7966]
          Length = 152

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 81/137 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R L+G I++  ED G  +VA K         E  Y   K +PFF
Sbjct: 1   MSSEQTYIMIKPDGVQRGLVGKIIQRFEDRGYQLVAMKLVHAGEDHLEKHYKDLKGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGPV   V +G++ + + R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  PGLIKYMSSGPVVAMVWQGKDVVKQGRALLGATNPLASAPGTIRGDYCIDVGRNICHGSD 120

Query: 121 SLKTALEEISYWFARNE 137
           S ++A  EI+ WF + +
Sbjct: 121 SPESAKAEIALWFGKQD 137


>gi|325283521|ref|YP_004256062.1| Nucleoside diphosphate kinase [Deinococcus proteolyticus MRP]
 gi|324315330|gb|ADY26445.1| Nucleoside diphosphate kinase [Deinococcus proteolyticus MRP]
          Length = 151

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/139 (43%), Positives = 84/139 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF+MIKPD V+R L   I++ +E  G   V  K   + R+ AE  Y  H  +PFF
Sbjct: 12  MPTERTFAMIKPDGVRRGLTAEILRRIELKGYRTVGLKLYQIPRETAESHYGEHSAKPFF 71

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  + SGPV    L+GE AI+  R +MG T+P  A  GTIR  +  S+GEN  HGSD
Sbjct: 72  GELVDFITSGPVVAIALEGENAIAGWRSMMGATNPANAAPGTIRGDFATSVGENVTHGSD 131

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  E++ +FA  E++
Sbjct: 132 SPESAQRELALFFAEGELL 150


>gi|166368415|ref|YP_001660688.1| nucleoside diphosphate kinase [Microcystis aeruginosa NIES-843]
 gi|189029045|sp|B0JHT4|NDK_MICAN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166090788|dbj|BAG05496.1| nucleoside diphosphate kinase [Microcystis aeruginosa NIES-843]
          Length = 149

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 87/136 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+RNL+G I++  E  G  +V  K   ++ + AE  Y +HK+RPFF  
Sbjct: 1   MERTFLMIKPDGVQRNLVGEIIQRFETKGFTLVGLKMMQVSSELAEKHYAVHKERPFFRS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   V +GE  I+  R+++G T+P  A  GTIR  +GIS+G N IHGSD  
Sbjct: 61  LVDFITSSPVVAMVWQGEGVIASARKIIGATNPLNAEPGTIRGDFGISVGRNLIHGSDGP 120

Query: 123 KTALEEISYWFARNEI 138
            TA +E+S WF+  E+
Sbjct: 121 DTAKDEVSLWFSDAEL 136


>gi|42733490|dbj|BAD11342.1| BRI1-KD interacting protein 114 [Oryza sativa Japonica Group]
          Length = 149

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   K++PFFP 
Sbjct: 1   VEQSYIMIKPDGVQRGLVGEIISRFEKKGFVLKGLKLFQCPKDLAQEHYKDLKEKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G T+P +A  GTIR    +  G N +HGSDS 
Sbjct: 61  LIEYITSGPVVCMAWEGNGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
                EI+ WF   E+ 
Sbjct: 121 DNGKREIALWFKEGELC 137


>gi|33864412|ref|NP_895972.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT
           9313]
 gi|67460705|sp|Q7V425|NDK_PROMM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|33641192|emb|CAE22322.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT
           9313]
          Length = 152

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 81/138 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G I+   E  G  +V  K    +R  A + Y +H++RPFF
Sbjct: 1   MAMERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQVTPSRDLAGEHYGVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P  A  GTIR    ++IG N IHGSD
Sbjct: 61  AGLVDFITSGPVIAMVWEGDGVIASARKLIGATKPLDAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
              TA  EI+ WF+  E+
Sbjct: 121 GPDTAQFEINLWFSAEEL 138


>gi|124027434|ref|YP_001012754.1| nucleoside diphosphate kinase [Hyperthermus butylicus DSM 5456]
 gi|166232976|sp|A2BK98|NDK_HYPBU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|123978128|gb|ABM80409.1| nucleoside diphosphate kinase [Hyperthermus butylicus DSM 5456]
          Length = 142

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 89/140 (63%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF MIKPD VKR L+G I+   E  GL + A K  W+ R++AE  Y +H+ +PFF
Sbjct: 1   MPVERTFVMIKPDGVKRGLVGEIIARFERKGLKIKALKMKWLTREEAEKLYEVHRGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  + SGPV   +L+G+ AI   R ++G TD +KA  GTIR  Y + IG N IH SD
Sbjct: 61  EDLVNFVTSGPVVAMILEGDSAIEVVRLMIGPTDGRKAPPGTIRGDYALDIGANVIHASD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S ++   E   +F+ +EI+G
Sbjct: 121 SKESYEREYKVFFSDDEIVG 140


>gi|67920317|ref|ZP_00513837.1| Nucleoside-diphosphate kinase [Crocosphaera watsonii WH 8501]
 gi|67857801|gb|EAM53040.1| Nucleoside-diphosphate kinase [Crocosphaera watsonii WH 8501]
          Length = 149

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 91/137 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +V  K   ++R+ AE+ Y +HK+RPFF  
Sbjct: 1   MERTFIMIKPDGVQRGLVGEIIGRFEAKGFTLVGLKSLSVSRELAEEHYDVHKERPFFGG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   V +G+  ++  R+++G T+P  A  GTIR  +G+S+G N IHGSD++
Sbjct: 61  LVDFICSSPVVAMVWEGDGVVASARKLIGATNPLSAEPGTIRGDFGVSVGLNLIHGSDAI 120

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF+  E++
Sbjct: 121 ETAQKEINLWFSEKELL 137


>gi|260806827|ref|XP_002598285.1| hypothetical protein BRAFLDRAFT_57540 [Branchiostoma floridae]
 gi|229283557|gb|EEN54297.1| hypothetical protein BRAFLDRAFT_57540 [Branchiostoma floridae]
          Length = 155

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 50/135 (37%), Positives = 79/135 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E++F MIKPD V+R L+G ++K  E  G  +VA KF   +    +  Y+    + F+  L
Sbjct: 7   ERSFIMIKPDGVQRGLVGEVIKRFEQKGFKLVAMKFMQASEDHMKKHYIDLASKGFYAGL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
            + M S PV   V +G   +   R ++G+T+P  +  GTIR  + + IG N +HGSDS++
Sbjct: 67  CKYMSSSPVVPMVWEGLGVVKTGRVMLGETNPADSKPGTIRGDFCVQIGRNLVHGSDSVE 126

Query: 124 TALEEISYWFARNEI 138
           +A +EI+ WF  +EI
Sbjct: 127 SAKKEIALWFKDDEI 141


>gi|159043899|ref|YP_001532693.1| nucleoside diphosphate kinase [Dinoroseobacter shibae DFL 12]
 gi|189029038|sp|A8LIX8|NDK_DINSH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|157911659|gb|ABV93092.1| nucleoside-diphosphate kinase [Dinoroseobacter shibae DFL 12]
          Length = 140

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 100/140 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA KRNL G I  + ED GL +VA K   + + QA  FY +H +RPF+
Sbjct: 1   MAIERTLSIIKPDATKRNLTGKINAKFEDAGLRIVAQKRIHLTKAQAGVFYAVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|223043276|ref|ZP_03613323.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Staphylococcus capitis SK14]
 gi|222443487|gb|EEE49585.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Staphylococcus capitis SK14]
          Length = 149

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 94/136 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E+ GL +V  K   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIENKGLKLVGGKLMQVPTELAEKHYSEHEGKPFYEK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  GTIR   G+++G N IHGSDS+
Sbjct: 61  LISFITSAPVFAMVVEGEDAVAVSRHIIGSTNPSEAAPGTIRGDLGLTVGRNIIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EIS WF  NEI
Sbjct: 121 ESAKREISLWFNSNEI 136


>gi|169658382|ref|NP_991387.2| nucleoside diphosphate kinase A 1 [Bos taurus]
 gi|169658384|ref|NP_991346.2| nucleoside diphosphate kinase A 1 [Bos taurus]
          Length = 152

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFHPEELV 140


>gi|297283207|ref|XP_001118623.2| PREDICTED: nucleoside diphosphate kinase 3-like, partial [Macaca
           mulatta]
          Length = 155

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 8   ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 67

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 68  VKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVE 127

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 128 SARREIALWFRTDELL 143


>gi|255955689|ref|XP_002568597.1| Pc21g15880 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590308|emb|CAP96485.1| Pc21g15880 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 153

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LIG I+   E+ G  +VA K    +++  E  Y     +PFF  L
Sbjct: 6   EQTFIAIKPDGVQRGLIGPIISRFENRGFKLVAMKLTSPSQEHLEKHYADLATKPFFKGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M+SGP+   V +G++A+   R ++G T+P  +  GTIR  Y I +G N  HGSDS++
Sbjct: 66  VAYMLSGPICAMVWEGKDAVKTGRVLLGATNPLASAPGTIRGDYAIDVGRNVCHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
            A +EI+ WF  +EI+
Sbjct: 126 NAKKEIALWFGASEIL 141


>gi|56461138|ref|YP_156419.1| nucleoside diphosphate kinase [Idiomarina loihiensis L2TR]
 gi|67460629|sp|Q5QYB9|NDK_IDILO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56180148|gb|AAV82870.1| Nucleoside diphosphate kinase [Idiomarina loihiensis L2TR]
          Length = 143

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +NLIG+I    E  GL +V AK   ++++QAE FY  HK+RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNLIGAIYNRFESAGLRIVGAKMMHLSKEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE+A+ KNR++MG T+P +AL GTIR  Y  +I EN++HGSD
Sbjct: 61  GALVEFMTSGPIVVQVLEGEDAVRKNRDIMGATNPAEALAGTIRADYAETIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EISY+F+  E+ 
Sbjct: 121 ATESAAREISYFFSDEEVC 139


>gi|6941068|emb|CAB72319.1| c371H6.2 (similar to NDP kinase) [Homo sapiens]
          Length = 153

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 6   ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 66  VKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 126 SARREIALWFRADELL 141


>gi|330686049|gb|EGG97672.1| nucleoside pyrophosphate kinase [Staphylococcus epidermidis VCU121]
          Length = 149

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 92/136 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E+ GL +V  K   + ++ AE  Y  H+ +PF+  
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIENKGLKLVGGKLMQVPQELAEKHYGEHEGKPFYNN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IH SDS+
Sbjct: 61  LISFITSAPVFAMVVEGEDAVAVSRHIIGSTNPSEAAPGSIRGDLGLTVGRNIIHASDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF   EI
Sbjct: 121 ESAEREINLWFKEEEI 136


>gi|30697820|ref|NP_568970.2| NDPK2 (NUCLEOSIDE DIPHOSPHATE KINASE 2); ATP binding / nucleoside
           diphosphate kinase/ protein binding [Arabidopsis
           thaliana]
 gi|12644076|sp|O64903|NDK2_ARATH RecName: Full=Nucleoside diphosphate kinase II, chloroplastic;
           Short=NDK II; Short=NDP kinase II; Short=NDPK II;
           Short=NDPK Ia; Flags: Precursor
 gi|6065740|emb|CAB58230.1| nucleotide diphosphate kinase Ia [Arabidopsis thaliana]
 gi|10177312|dbj|BAB10573.1| nucleotide diphosphate kinase Ia [Arabidopsis thaliana]
 gi|16209700|gb|AAL14407.1| AT5g63310/MDC12_28 [Arabidopsis thaliana]
 gi|17529114|gb|AAL38767.1| putative nucleotide diphosphate kinase Ia [Arabidopsis thaliana]
 gi|21436481|gb|AAM51441.1| putative nucleotide diphosphate kinase Ia [Arabidopsis thaliana]
 gi|110742634|dbj|BAE99229.1| nucleoside diphosphate kinase Ia [Arabidopsis thaliana]
 gi|332010348|gb|AED97731.1| nucleoside diphosphate kinase II [Arabidopsis thaliana]
          Length = 231

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD ++R L+G I+   E  G  ++  K     ++ AE+ Y     + FFP 
Sbjct: 83  VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPN 142

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 143 LIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSP 202

Query: 123 KTALEEISYWFARNEII 139
           +    EI  WF   E+ 
Sbjct: 203 ENGKREIGLWFKEGELC 219


>gi|198429461|ref|XP_002123476.1| PREDICTED: similar to Nucleoside diphosphate kinase B (NDP kinase
           B) (NDK B) (P18) [Ciona intestinalis]
          Length = 149

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 80/136 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  +KPD V+R L+G I++  E+ G  +VA K         +  Y     + FFP 
Sbjct: 1   MERTFIAVKPDGVQRGLVGKIIQRFEEKGFKLVALKMITATEDHLKLHYADLATKKFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV   V +G++ +   R ++G T+P  +  GTIR  + I +G N  HGSD++
Sbjct: 61  LVKYMASGPVVAMVWEGQDVVKTGRVMLGATNPADSAPGTIRGDFCIHVGRNICHGSDAV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A +EI+ WF  +E+
Sbjct: 121 ESANKEIALWFKPDEL 136


>gi|120554051|ref|YP_958402.1| nucleoside-diphosphate kinase [Marinobacter aquaeolei VT8]
 gi|166232980|sp|A1TZP6|NDK_MARAV RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|120323900|gb|ABM18215.1| nucleoside diphosphate kinase [Marinobacter aquaeolei VT8]
          Length = 142

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E   L +VAAK   + ++QAE FY  HK+RPFF
Sbjct: 1   MANERTLSIIKPDAVAKNVIGEIYSRFEKADLKIVAAKMMHLTQEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVAFMTSGPVVVQVLEGEGAILKNRELMGATNPKEAEAGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  E++Y+F  NEI 
Sbjct: 121 SAASAEREVAYFFNDNEIC 139


>gi|189235892|ref|XP_967503.2| PREDICTED: similar to putative nucleoside diphosphate kinase
           [Tribolium castaneum]
          Length = 169

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I+K  E  G  +VA KF W + +  +  Y     +PFFP L
Sbjct: 21  ERTFIMVKPDGVQRGLVGKIIKRFESKGFKLVALKFTWPSEELLKKHYADLATKPFFPGL 80

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G T+P  +  GTIR    I +G N IHGSDS++
Sbjct: 81  VKYMSSGPVVPMVWEGLNVVKTGRVMLGATNPADSAPGTIRGDLCIQVGRNIIHGSDSVE 140

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E+I
Sbjct: 141 SAKKEIGLWFTEKEVI 156


>gi|91225142|ref|ZP_01260364.1| nucleoside diphosphate kinase [Vibrio alginolyticus 12G01]
 gi|269965167|ref|ZP_06179301.1| nucleoside diphosphate kinase [Vibrio alginolyticus 40B]
 gi|91190085|gb|EAS76356.1| nucleoside diphosphate kinase [Vibrio alginolyticus 12G01]
 gi|269830153|gb|EEZ84380.1| nucleoside diphosphate kinase [Vibrio alginolyticus 40B]
          Length = 141

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+RNLIG I   +E  GL ++AAK   +   QA  FY  H+ + FF
Sbjct: 1   MALERTFSIIKPDAVERNLIGEIYNRIEKAGLRIIAAKMVHLTEDQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AI++ RE+MG T+P+ A  GT+R  Y +S+  NS+HGSD
Sbjct: 61  PPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEDAACGTLRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI ++F  +E+
Sbjct: 121 SPESAAREIEFFFPESEV 138


>gi|239997033|ref|ZP_04717557.1| nucleoside diphosphate kinase [Alteromonas macleodii ATCC 27126]
 gi|332141968|ref|YP_004427706.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327551990|gb|AEA98708.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 143

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N+IG+I    E  GL +VA+K   M+++QAE FY  HK+RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMIHMSKEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+  NRE+MG T+P  A  GT+R+ Y  SI EN++HGSD
Sbjct: 61  GALVDFMTSGPVMVQVLEGENAVLANREIMGATNPADAAAGTLRSDYAASIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EI+Y+F+  EI 
Sbjct: 121 APESAAREIAYFFSEEEIC 139


>gi|297797325|ref|XP_002866547.1| hypothetical protein ARALYDRAFT_496515 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312382|gb|EFH42806.1| hypothetical protein ARALYDRAFT_496515 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 230

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD ++R L+G I+   E  G  ++  K     ++ AE+ Y     + FFP 
Sbjct: 82  VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPN 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 142 LIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EI  WF   E+ 
Sbjct: 202 ENGKREIGLWFKEGELC 218


>gi|255723127|ref|XP_002546497.1| nucleoside diphosphate kinase [Candida tropicalis MYA-3404]
 gi|240130628|gb|EER30191.1| nucleoside diphosphate kinase [Candida tropicalis MYA-3404]
          Length = 151

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 83/139 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI SI+   E  G  +V  K          + Y   +++PFF
Sbjct: 1   MSDERTFIAIKPDGVQRGLISSILGRFEQRGFKLVGIKLVQPTESLLRNHYEDLQEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M+SGPV   V +G++ + + R ++G T+P ++  GTIR  + I +G N  HGSD
Sbjct: 61  PSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI+ WF + E++
Sbjct: 121 SVESANKEINLWFKKEELV 139


>gi|325297021|ref|NP_001191682.1| nucleoside diphosphate kinase B [Ornithorhynchus anatinus]
          Length = 152

 Score =  179 bits (454), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 83/139 (59%), Gaps = 1/139 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +VA K    + +  +  Y+  KDRPF
Sbjct: 1   MATGERTFIAIKPDGVQRGLVGDIIKRFEQKGFRLVAMKMLRASEEHLQQHYIDLKDRPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FPGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEI 138
           DS+K+A +EI  WF   E+
Sbjct: 121 DSVKSAEKEIGLWFKPEEL 139


>gi|220909279|ref|YP_002484590.1| nucleoside diphosphate kinase [Cyanothece sp. PCC 7425]
 gi|254767225|sp|B8HUM7|NDK_CYAP4 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|219865890|gb|ACL46229.1| Nucleoside-diphosphate kinase [Cyanothece sp. PCC 7425]
          Length = 149

 Score =  178 bits (453), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  +KPD V+R L+G I++  E  G  +V  K   +++  AE  Y  HK++PFFP 
Sbjct: 1   MERTFLAVKPDGVQRALVGEIIRRFEAKGFKLVGLKLMNVSKDLAEQHYGEHKEKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LVQ + SGPV   V +G+  ++  R+++G T+P  +  GTIR  YG+ IG N IHGSD++
Sbjct: 61  LVQFITSGPVVAMVWEGKGVVASARKIIGATNPLNSEPGTIRGDYGVDIGRNIIHGSDAV 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 121 ETAQREIALWFQPAELV 137


>gi|282900262|ref|ZP_06308213.1| Nucleoside diphosphate kinase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194767|gb|EFA69713.1| Nucleoside diphosphate kinase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 155

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 90/138 (65%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+TF  IKPD V+R L G I++  E  G  +V  KF  ++++ AE  Y +HK+RPFF 
Sbjct: 6   ALERTFIAIKPDGVQRGLAGEIIRRFETKGFTLVGLKFMKVSKELAEQHYDVHKERPFFA 65

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ + SGPV   V +G+  ++  R+++G T+P  +  GTIR  +GI+IG N IHGSD+
Sbjct: 66  SLVEFITSGPVVAMVWQGQGVVASARKIIGATNPLTSEPGTIRGDFGINIGRNLIHGSDA 125

Query: 122 LKTALEEISYWFARNEII 139
           ++TA  EIS WF   E++
Sbjct: 126 IETAQREISLWFKEEELV 143


>gi|119372150|sp|Q080Q3|NDK_SHEFN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 143

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H  RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFESAGLKIIASKMVQLSKEQAEGFYAEHSARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+  NRE+MG T+P +A +GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVQVLEGENAVLANREIMGATNPAEAARGTLRADYAASIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F+ +E+ 
Sbjct: 121 AVESAAREIAYFFSADEVC 139


>gi|52346190|ref|NP_001005140.1| nucleoside diphosphate kinase B [Xenopus (Silurana) tropicalis]
 gi|50603817|gb|AAH77684.1| non-metastatic cells 2, protein (NM23B) expressed in [Xenopus
           (Silurana) tropicalis]
 gi|89271986|emb|CAJ83445.1| non-metastatic cells 1, protein (NM23A) expressed in [Xenopus
           (Silurana) tropicalis]
          Length = 154

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   ++   +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLMGEIIKRFEQKGFYLVAMKFVQASKDLLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 66  VDYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFEDKELV 141


>gi|71016794|ref|XP_758923.1| hypothetical protein UM02776.1 [Ustilago maydis 521]
 gi|46098454|gb|EAK83687.1| hypothetical protein UM02776.1 [Ustilago maydis 521]
          Length = 202

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 80/135 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R ++G I+K  E+ G  + A K    + +  E  Y   K + FF
Sbjct: 51  MATEQTYIMIKPDGVQRGIVGEIIKRFENRGYKIAALKMVHASEEHLEKHYKDLKGKKFF 110

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGPV   V +G++A+   R ++G T+P  +  GTIR  + I +G N  HGSD
Sbjct: 111 PGLIKYMASGPVVCIVFEGKDAVKTGRVLLGATNPLDSAPGTIRGDFAIDVGRNVCHGSD 170

Query: 121 SLKTALEEISYWFAR 135
           S+++A  EI+ WF  
Sbjct: 171 SVESAKAEIALWFGE 185


>gi|157879424|pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate
           Kinase: X-Ray Structures Of A Phospho-Histidine
           Intermediate Of The Enzymes From Drosophila And
           Dictyostelium
 gi|157879425|pdb|1NSQ|B Chain B, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate
           Kinase: X-Ray Structures Of A Phospho-Histidine
           Intermediate Of The Enzymes From Drosophila And
           Dictyostelium
 gi|157879426|pdb|1NSQ|C Chain C, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate
           Kinase: X-Ray Structures Of A Phospho-Histidine
           Intermediate Of The Enzymes From Drosophila And
           Dictyostelium
          Length = 153

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF W +++  E  Y     RPFFP L
Sbjct: 6   ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G T+P  +L GTIR  + I +G N I GSD+++
Sbjct: 66  VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIXGSDAVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SAEKEIALWFNEKELV 141


>gi|116074086|ref|ZP_01471348.1| Nucleoside-diphosphate kinase [Synechococcus sp. RS9916]
 gi|116069391|gb|EAU75143.1| Nucleoside-diphosphate kinase [Synechococcus sp. RS9916]
          Length = 152

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R  AE+ Y +HK+RPFF
Sbjct: 1   MATERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEEHYGVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 61  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 121 APETAQFEIGLWFQASEL 138


>gi|301154914|emb|CBW14377.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Haemophilus
           parainfluenzae T3T1]
          Length = 139

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 96/137 (70%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  VVA K   + + QAE FY  H+ +PFF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGAILGRFESQGFRVVALKMVQLTKDQAEGFYAEHQGKPFFE 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+SGP+ + VL+ E A+   R ++G T+P +A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMLSGPIVVSVLEKENAVKDYRTLIGATNPAEAAEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           +++A  EI+Y+F  +EI
Sbjct: 121 VESAKREIAYFFVDSEI 137


>gi|86145591|ref|ZP_01063921.1| nucleoside diphosphate kinase [Vibrio sp. MED222]
 gi|85836562|gb|EAQ54688.1| nucleoside diphosphate kinase [Vibrio sp. MED222]
          Length = 144

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAVKRNL+G I   +E  GL ++AAK   +   QA  FY  H+ + FF
Sbjct: 1   MALERTFSIVKPDAVKRNLVGEIYHRIEKAGLQIIAAKMVSLTEAQASGFYAEHEGKDFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR  Y IS+  NS+HGSD
Sbjct: 61  GPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYAISMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|302841266|ref|XP_002952178.1| nucleoside diphosphate kinase [Volvox carteri f. nagariensis]
 gi|300262443|gb|EFJ46649.1| nucleoside diphosphate kinase [Volvox carteri f. nagariensis]
          Length = 150

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 54/135 (40%), Positives = 79/135 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+++ MIKPD V+R L+G ++K  E  G  +   K   + +  AE  Y     RPFF
Sbjct: 1   MATEQSYIMIKPDGVQRGLVGEVIKRFEQRGYTLKGLKLLNVPKDLAEKHYQDLSARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  + SGPV   V +G+  ++  R+++G T+P  +  GTIR  + I +G N IHGSD
Sbjct: 61  PALVDYICSGPVVAMVWEGKGVVATGRKMIGATNPLASEPGTIRGDFAIEVGRNVIHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S+++A  EIS WF  
Sbjct: 121 SVESAQREISLWFPE 135


>gi|33303897|gb|AAQ02462.1| non-metastatic cells nucleoside-diphosphate kinase 6 [synthetic
           construct]
          Length = 170

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 82  VKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SARREIALWFRADELL 157


>gi|325652123|ref|NP_001191692.1| nucleoside diphosphate kinase A [Taeniopygia guttata]
          Length = 153

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA K    +     + Y+  KDRPF+  L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEKKGFKLVAMKLIHASEDLLREHYIDLKDRPFYDGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           VQ M SGP+   V +G   I   R ++G+T+P  +  GTIR  + + +G+N IHGSDS++
Sbjct: 66  VQYMHSGPIVAMVWEGLNVIKTGRMMLGETNPFDSKPGTIRGDFCVQVGKNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 126 SAETEINLWFTPEELV 141


>gi|297527599|ref|YP_003669623.1| Nucleoside-diphosphate kinase [Staphylothermus hellenicus DSM
           12710]
 gi|297256515|gb|ADI32724.1| Nucleoside-diphosphate kinase [Staphylothermus hellenicus DSM
           12710]
          Length = 141

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T  +IKPD V+R LIG I+   E  GL + A K  W+ R +AE+FY +H+ +PFF
Sbjct: 1   MSIERTLVLIKPDGVRRGLIGEIISRFERKGLKIKALKMLWLTRDKAEEFYSVHRGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L++ M SGP+   VL+G+ AIS  R+++G TD ++A  GTIR  Y +S  +N +H SD
Sbjct: 61  ESLIEFMTSGPIIAMVLEGDMAISVVRKMIGPTDGREAPPGTIRGDYSLSKSQNVVHASD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A+ EI   F  +EII
Sbjct: 121 SPESAVREIGVIFKDDEII 139


>gi|188996025|ref|YP_001930276.1| Nucleoside-diphosphate kinase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931092|gb|ACD65722.1| Nucleoside-diphosphate kinase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 138

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 97/138 (70%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  + KPDAV++N++G I+  LED G  +VA K   + ++QA  FY++HKDRPF+ E
Sbjct: 1   MERTLVIAKPDAVRKNVVGKIISRLEDEGFKLVALKKVKLTKEQAGQFYIVHKDRPFYGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   M SGP    V +GE  I++ RE+MG TDP KA +GT+R  YG ++GEN++HGSDS 
Sbjct: 61  LCDFMSSGPTVPMVWEGENVIARVREIMGATDPSKAAEGTLRKLYGTNVGENAVHGSDSP 120

Query: 123 KTALEEISYWFARNEIIG 140
           ++A  EI ++F+  E++G
Sbjct: 121 ESAAYEIPFFFSGLELVG 138


>gi|299115921|emb|CBN75928.1| flagellar associated protein, nucleoside diphosphate kinase-like
           protein [Ectocarpus siliculosus]
          Length = 203

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 83/139 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+++ MIKPD V+R L+G I+   E+ G  +   K    +    +  Y    D+PFF
Sbjct: 53  MAMERSYIMIKPDGVQRGLVGKIITRFEERGYKLAGLKLKQADEALLKKHYKDLVDKPFF 112

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+L+  MISGPV     +G++ ++  R+++G+T+P  +  GTIR  + + +  N  HGSD
Sbjct: 113 PKLLAYMISGPVVCMAWEGKDVVAMGRKMLGETNPLASAPGTIRGDFCLEVWRNICHGSD 172

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 173 SVENADKEIALWFGEAEVV 191


>gi|89071229|ref|ZP_01158410.1| nucleoside diphosphate kinase [Oceanicola granulosus HTCC2516]
 gi|89043242|gb|EAR49471.1| nucleoside diphosphate kinase [Oceanicola granulosus HTCC2516]
          Length = 140

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/140 (55%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA KRNL G I  + ED GL +VA K   + ++QA +FY +HK+RPFF
Sbjct: 1   MATERTLSIIKPDATKRNLTGKINAKFEDAGLRIVAQKRIKLTQEQAGEFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGPV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  GELTEFMASGPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEIS++F+  E++G
Sbjct: 121 APETAKEEISFFFSGLELVG 140


>gi|56751618|ref|YP_172319.1| nucleoside diphosphate kinase [Synechococcus elongatus PCC 6301]
 gi|81301306|ref|YP_401514.1| nucleoside diphosphate kinase [Synechococcus elongatus PCC 7942]
 gi|1054891|gb|AAA81018.1| Ndk [Synechococcus elongatus PCC 7942]
 gi|56686577|dbj|BAD79799.1| nucleoside diphosphate kinase [Synechococcus elongatus PCC 6301]
 gi|81170187|gb|ABB58527.1| nucleoside diphosphate kinase [Synechococcus elongatus PCC 7942]
          Length = 151

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 92/138 (66%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G+I+   E  G  +V  K    +R+ AE  Y +H++RPFF
Sbjct: 1   MSVERTFIAIKPDGVQRGLVGTIIGRFEQKGFKLVGLKQLKPSRELAEQHYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ + SGP+   VL+GE  ++  R+++G T+P  A  GTIR  +G++IG N IHGSD
Sbjct: 61  NGLVEFITSGPIVAIVLEGEGVVAAARKLIGATNPLTAEPGTIRGDFGVNIGRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           +++TA +EI+ WF+  E+
Sbjct: 121 AIETAQQEIALWFSPAEL 138


>gi|298490893|ref|YP_003721070.1| nucleoside-diphosphate kinase ['Nostoc azollae' 0708]
 gi|298232811|gb|ADI63947.1| Nucleoside-diphosphate kinase ['Nostoc azollae' 0708]
          Length = 149

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 92/137 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I++  E  G  ++A KF  ++R+ AE  Y +H++RPFFP 
Sbjct: 1   MERTFLAIKPDGVQRRLVGEIIRRFETKGFTLIALKFQKVSRELAEQHYAVHRERPFFPS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V +G+  I+  R+++G T+P  +  GTIR  +GI++G N IHGSD+ 
Sbjct: 61  LVEFITSGPVVAMVWEGDGVIASARKIIGATNPLNSEPGTIRGDFGINVGRNLIHGSDAP 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 121 ETAQYEIALWFKDEELV 137


>gi|74316608|ref|YP_314348.1| nucleoside diphosphate kinase [Thiobacillus denitrificans ATCC
           25259]
 gi|90110376|sp|Q3SL74|NDK_THIDA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|74056103|gb|AAZ96543.1| nucleoside diphosphate kinase [Thiobacillus denitrificans ATCC
           25259]
          Length = 142

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/138 (56%), Positives = 105/138 (76%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDAV +N+IG IV   E  GL VVA+K   ++R++AE FY +HKDRPFF
Sbjct: 1   MAVQRTFSIIKPDAVAKNVIGKIVSRFETNGLKVVASKMKHLSRQEAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPV LQVL+GE+AI+KNR +MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVVLQVLEGEDAIAKNRTLMGATDPKKAEPGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI+Y+F  +E+
Sbjct: 121 APETAAVEIAYFFPASEV 138


>gi|314933651|ref|ZP_07841016.1| nucleoside diphosphate kinase [Staphylococcus caprae C87]
 gi|313653801|gb|EFS17558.1| nucleoside diphosphate kinase [Staphylococcus caprae C87]
          Length = 149

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 94/136 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG IV  +E+ GL +V  K   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIVSRIENKGLKLVGGKLIQVPTELAEKHYSEHEGKPFYEK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  GTIR   G+++G N IHGSDS+
Sbjct: 61  LISFITSAPVFAMVVEGEDAVAVSRHIIGSTNPSEAAPGTIRGDLGLTVGRNIIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EIS WF  NEI
Sbjct: 121 ESAQREISLWFNSNEI 136


>gi|256823059|ref|YP_003147022.1| Nucleoside-diphosphate kinase [Kangiella koreensis DSM 16069]
 gi|256796598|gb|ACV27254.1| Nucleoside-diphosphate kinase [Kangiella koreensis DSM 16069]
          Length = 143

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAV +N+IG I    E  GL +VA+K   ++R++AE FY  HK+RPFF
Sbjct: 1   MAIERTFSIVKPDAVAKNVIGEIYSRFERAGLRIVASKMIHLSREKAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE AI  NRE+MG T+P +AL+GTIR  Y +S+ EN+ HGSD
Sbjct: 61  GALVDFMTSGPVMVQVLEGENAIKANREIMGATNPAEALRGTIRADYAVSVDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EISY+F  +EI 
Sbjct: 121 SPESAEREISYFFGADEIC 139


>gi|157929896|gb|ABW04136.1| nucleoside-diphosphate kinase [Epinephelus coioides]
          Length = 151

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 81/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R LIG I+K  E  G  +VA KF     +  +  Y+  KD+PFF
Sbjct: 1   MSGERTFIAVKPDGVQRGLIGDIIKRFEQKGFKLVAMKFLQPTEELLKQHYMDLKDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L+Q M SGPV     +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSD
Sbjct: 61  SGLIQYMKSGPVVAMAWEGLNVVKTGRIMLGETNPAASNPGTIRGDFCIEVGRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A +EI  WF   E++
Sbjct: 121 SVASAEKEIGLWFKPEEVV 139


>gi|68470482|ref|XP_720745.1| hypothetical protein CaO19.11786 [Candida albicans SC5314]
 gi|68470745|ref|XP_720618.1| hypothetical protein CaO19.4311 [Candida albicans SC5314]
 gi|46442494|gb|EAL01783.1| hypothetical protein CaO19.4311 [Candida albicans SC5314]
 gi|46442628|gb|EAL01916.1| hypothetical protein CaO19.11786 [Candida albicans SC5314]
 gi|238882685|gb|EEQ46323.1| nucleoside diphosphate kinase [Candida albicans WO-1]
          Length = 151

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI SI+   E  G  +V  K            Y   + +PFF
Sbjct: 1   MSDERTFIAIKPDGVQRGLISSILGRFEQRGFKLVGIKLVQPTESLLRTHYEDLQSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M+SGPV   V +G++ + + R ++G T+P ++  GTIR  + I +G N  HGSD
Sbjct: 61  PSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI  WF + E++
Sbjct: 121 SVESANKEIDLWFKKEELV 139


>gi|27363898|ref|NP_759426.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Vibrio vulnificus
           CMCP6]
 gi|37678947|ref|NP_933556.1| nucleoside diphosphate kinase [Vibrio vulnificus YJ016]
 gi|320157277|ref|YP_004189656.1| nucleoside diphosphate kinase [Vibrio vulnificus MO6-24/O]
 gi|31340242|sp|Q8DEZ5|NDK_VIBVU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67460698|sp|Q7MNF4|NDK_VIBVY RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|27360015|gb|AAO08953.1| Nucleoside diphosphate kinase [Vibrio vulnificus CMCP6]
 gi|37197689|dbj|BAC93527.1| nucleoside diphosphate kinase [Vibrio vulnificus YJ016]
 gi|319932589|gb|ADV87453.1| nucleoside diphosphate kinase [Vibrio vulnificus MO6-24/O]
          Length = 141

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+RNLIG I   +E  GL ++AAK   +N +QA  FY  H+ + FF
Sbjct: 1   MALERTFSIIKPDAVERNLIGEIYHRIEKAGLRIIAAKMVHLNDEQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+++F  +EI 
Sbjct: 121 SPASAAREIAFFFPESEIC 139


>gi|196011649|ref|XP_002115688.1| expressed hypothetical protein [Trichoplax adhaerens]
 gi|190581976|gb|EDV22051.1| expressed hypothetical protein [Trichoplax adhaerens]
          Length = 151

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 54/139 (38%), Positives = 82/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ M+KPD V R L+G I+   E  G  +VA K    + +   + Y     +PFF
Sbjct: 1   MANERTYIMVKPDGVDRGLVGDIISRFEKRGYKLVALKLKLASEELLREHYADLAGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G++ +   R ++G+TDP K+L G+IR  Y I +G N  HGSD
Sbjct: 61  NGLVAFIGSGPVACMVWEGKDVVKTGRRMLGETDPLKSLPGSIRGDYAIDLGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI  WF  +E++
Sbjct: 121 SVESANKEIKLWFNEDELV 139


>gi|225426328|ref|XP_002269576.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147864944|emb|CAN83625.1| hypothetical protein VITISV_041718 [Vitis vinifera]
 gi|297742339|emb|CBI34488.3| unnamed protein product [Vitis vinifera]
          Length = 235

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    ++  A+  Y   K+RPFF  
Sbjct: 85  MERTFIAIKPDGVQRGLIAEILSRFERKGFKLVAIKIVVPSKDFAQKHYHDLKERPFFNG 144

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 145 LCDFLSSGPVVAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 204

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 205 ETAKDEINLWFKPEELV 221


>gi|241859205|ref|XP_002416191.1| nucleoside diphosphate kinase, putative [Ixodes scapularis]
 gi|215510405|gb|EEC19858.1| nucleoside diphosphate kinase, putative [Ixodes scapularis]
          Length = 152

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  E  G  +VA KF   + +     Y      PFF  L
Sbjct: 5   ERTFIMVKPDGVQRGLVGDIIQRFERRGYKLVAMKFMQASEELLLKHYADLAGLPFFNGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R+++G TDP KA  GTIR  + + +G N IHGSDSL 
Sbjct: 65  VKFMQSGPVVPMVWEGNNVVLTGRDMIGATDPLKAAPGTIRADFCVQVGRNIIHGSDSLP 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF+  E+I
Sbjct: 125 SAEKEIALWFSEKELI 140


>gi|226492231|ref|NP_001150161.1| nucleoside diphosphate kinase 2 [Zea mays]
 gi|195637254|gb|ACG38095.1| nucleoside diphosphate kinase 2 [Zea mays]
          Length = 222

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   KD+PFFP+
Sbjct: 74  VERSYIMIKPDGVQRGLVGEIISRFEKKGFLLKGLKLFQCPKDLAQEHYKDLKDKPFFPK 133

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G   ++  R+++G T+P +A  GTIR    +  G N +HGSDS 
Sbjct: 134 LIDYITSGPVVCMAWEGAGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 193

Query: 123 KTALEEISYWFARNEII 139
                EI  WF   E+ 
Sbjct: 194 DNGKREIELWFKEGELC 210


>gi|254427380|ref|ZP_05041087.1| Nucleoside diphosphate kinase superfamily [Alcanivorax sp. DG881]
 gi|196193549|gb|EDX88508.1| Nucleoside diphosphate kinase superfamily [Alcanivorax sp. DG881]
          Length = 143

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG IV   E  GL VVA K   ++ ++A  FY  HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEIVTRFEKAGLSVVAMKMVHLSDEKAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE+A++KNR++MG T+PK+A  GTIR  +  +I  N++HGSD
Sbjct: 61  KDLVGFMTSGPVVVQVLEGEDAVAKNRDLMGATNPKEAEAGTIRADFAETIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  E++Y+F+  E+ 
Sbjct: 121 STESAARELAYFFSDEELC 139


>gi|37693993|ref|NP_002504.2| nucleoside diphosphate kinase 3 [Homo sapiens]
 gi|332240012|ref|XP_003269184.1| PREDICTED: nucleoside diphosphate kinase 3-like [Nomascus
           leucogenys]
 gi|21264477|sp|Q13232|NDK3_HUMAN RecName: Full=Nucleoside diphosphate kinase 3; Short=NDK 3;
           Short=NDP kinase 3; AltName: Full=DR-nm23; AltName:
           Full=Nucleoside diphosphate kinase C; Short=NDPKC;
           AltName: Full=nm23-H3
 gi|71042461|pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-Diphosphate Kinase 3
 gi|71042462|pdb|1ZS6|B Chain B, Structure Of Human Nucleoside-Diphosphate Kinase 3
 gi|71042463|pdb|1ZS6|D Chain D, Structure Of Human Nucleoside-Diphosphate Kinase 3
 gi|14336763|gb|AAK61291.1|AE006639_5 nucleoside diphosphate kinase 3 [Homo sapiens]
 gi|12652979|gb|AAH00250.1| Non-metastatic cells 3, protein expressed in [Homo sapiens]
 gi|119606035|gb|EAW85629.1| non-metastatic cells 3, protein expressed in [Homo sapiens]
 gi|123983400|gb|ABM83441.1| non-metastatic cells 3, protein expressed in [synthetic construct]
 gi|157928404|gb|ABW03498.1| non-metastatic cells 3, protein expressed in [synthetic construct]
 gi|261859890|dbj|BAI46467.1| non-metastatic cells 3, protein expressed in [synthetic construct]
          Length = 169

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 82  VKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SARREIALWFRADELL 157


>gi|332992285|gb|AEF02340.1| nucleoside diphosphate kinase [Alteromonas sp. SN2]
          Length = 143

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N+IG+I    E  GL +VA+K   M+++QAE FY  HK+RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMIHMSKEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+ KNRE+MG T+P  A  GT+R+ Y  SI EN+ HGSD
Sbjct: 61  GALVDFMTSGPVMVQVLEGENAVVKNREIMGATNPADAAAGTLRSDYAASIDENACHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EI+Y+F+  EI 
Sbjct: 121 APESAAREIAYFFSEEEIC 139


>gi|254509338|ref|ZP_05121427.1| nucleoside diphosphate kinase [Vibrio parahaemolyticus 16]
 gi|219547734|gb|EED24770.1| nucleoside diphosphate kinase [Vibrio parahaemolyticus 16]
          Length = 142

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAVKRNLIG I   +E  GL +VAAK   +  +QA  FY  H+ + FF
Sbjct: 1   MALERTFSIVKPDAVKRNLIGEIYHRIEKAGLQIVAAKMVHLTEEQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR  Y +S+  NS+HGSD
Sbjct: 61  PALKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI ++F ++EI 
Sbjct: 121 SPTSAAREIEFFFPQSEIC 139


>gi|154707737|ref|YP_001424695.1| nucleoside diphosphate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|189029035|sp|A9KFV6|NDK_COXBN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|154357023|gb|ABS78485.1| nucleoside diphosphate kinase [Coxiella burnetii Dugway 5J108-111]
          Length = 139

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/138 (55%), Positives = 103/138 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL ++AAK C +++ QAE FY +HKDRPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFEKAGLKIIAAKMCHLSKPQAEKFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+LV+ M  GPV +QVL+GE AI KNRE+MG T+PK+AL GTIR  +  SI  N++HGSD
Sbjct: 61  PDLVKFMTQGPVMIQVLEGENAIVKNREIMGATNPKEALPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
             +TA EEI+++F  +EI
Sbjct: 121 GPETAKEEIAFFFKPDEI 138


>gi|3093480|gb|AAC15253.1| nucleoside diphosphate kinase type 2 [Arabidopsis thaliana]
          Length = 231

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 74/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD ++R L+G I+   E  G  ++  K     ++ AE+ Y     + FF  
Sbjct: 83  VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKELSAKSFFLT 142

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 143 LIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSP 202

Query: 123 KTALEEISYWFARNEII 139
           +    EI  WF   E+ 
Sbjct: 203 ENGKREIGLWFKEGELC 219


>gi|162949444|gb|ABY21334.1| nucleoside diphosphate kinase [Oncorhynchus masou formosanus]
          Length = 151

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 78/136 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF        +  Y   KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRRLVGDIIKRFELKGFKLVGMKFIQAPESLLKKHYADLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  Y I +G N IHGSDS++
Sbjct: 65  VSYMASGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDYCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E+ 
Sbjct: 125 SANTEINLWFKPEELC 140


>gi|91793742|ref|YP_563393.1| nucleoside-diphosphate kinase [Shewanella denitrificans OS217]
 gi|119372149|sp|Q12LK6|NDK_SHEDO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|91715744|gb|ABE55670.1| nucleoside diphosphate kinase [Shewanella denitrificans OS217]
          Length = 143

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   + ++QAE FY  H  RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFESAGLKIIASKMVHLTKEQAEGFYAEHSARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+  NRE+MG T+P +A +GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVQVLEGENAVLANREIMGATNPAEAARGTLRGDYAASIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +L++A  EI+Y+F+ +E+ 
Sbjct: 121 ALESAAREIAYFFSADEVC 139


>gi|91775977|ref|YP_545733.1| nucleoside diphosphate kinase [Methylobacillus flagellatus KT]
 gi|119372040|sp|Q1H0U5|NDK_METFK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|91709964|gb|ABE49892.1| nucleoside diphosphate kinase [Methylobacillus flagellatus KT]
          Length = 141

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 75/138 (54%), Positives = 103/138 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    ED GL ++A+K   +++  AE FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGKIYTRFEDAGLKIIASKMVQLSQADAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE A+ K+RE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVKFMISGPVVVQVLEGENAVLKHRELMGATDPKKAEPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           SL+ A  EI+Y+FA++ I
Sbjct: 121 SLENAAVEIAYFFAQSNI 138


>gi|15807484|ref|NP_296219.1| nucleoside diphosphate kinase [Deinococcus radiodurans R1]
 gi|6460321|gb|AAF12041.1|AE002079_6 nucleoside diphosphate kinase [Deinococcus radiodurans R1]
          Length = 191

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 83/137 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF+MIKPD V+R L   I+  + + G  VV  K   M R+ AE  Y  H++RPFF E
Sbjct: 54  MERTFAMIKPDGVRRGLTPEILARIHNKGYRVVGLKQMMMPRETAEQHYGEHRERPFFGE 113

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +  GPV    L+GE AI+  R +MG T+P  A  GTIR  +  S GEN  HGSDS 
Sbjct: 114 LVDFITGGPVVAIALEGENAIAGWRAMMGATNPANAAPGTIRADFATSTGENVTHGSDSP 173

Query: 123 KTALEEISYWFARNEII 139
           ++A  E++ +F   E++
Sbjct: 174 ESAERELALFFGDGELL 190


>gi|302911746|ref|XP_003050557.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731494|gb|EEU44844.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 154

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 79/138 (57%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  IKPD V+R L+G I+   E+ G  + A K     ++  E  Y     +PFFP
Sbjct: 3   STEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAIKLVTPGKEHLEKHYADLAGKPFFP 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L++ M SGP+   V +G +A+   R ++G T+P  +  GTIR  + I +G N  HGSDS
Sbjct: 63  GLIEYMNSGPICAMVWEGRDAVKTGRVILGATNPLASAPGTIRGDFAIDVGRNVCHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           ++ A +EI+ WF   E++
Sbjct: 123 VENAQKEIALWFKEGEVL 140


>gi|242083744|ref|XP_002442297.1| hypothetical protein SORBIDRAFT_08g017600 [Sorghum bicolor]
 gi|241942990|gb|EES16135.1| hypothetical protein SORBIDRAFT_08g017600 [Sorghum bicolor]
          Length = 222

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   KD+PFFP+
Sbjct: 74  VEQSYIMIKPDGVQRGLVGEIISRFEKKGFLLKGLKLFQCPKDLAQEHYKDLKDKPFFPK 133

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G+  ++  R+++G T+P +A  GTIR    +  G N +HGSDS 
Sbjct: 134 LIDYITSGPVVCMAWEGDGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 193

Query: 123 KTALEEISYWFARNEII 139
                EI+ WF   E+ 
Sbjct: 194 DNGKREIALWFKEGELC 210


>gi|218290931|ref|ZP_03494988.1| Nucleoside-diphosphate kinase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|258511658|ref|YP_003185092.1| Nucleoside-diphosphate kinase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|218239096|gb|EED06299.1| Nucleoside-diphosphate kinase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|257478384|gb|ACV58703.1| Nucleoside-diphosphate kinase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 152

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 89/135 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF M+KPD V+R L+G IV   E  GL +VAAK   ++++ AE  Y  H++RPFF
Sbjct: 4   MAREQTFVMVKPDGVQRGLVGEIVARFERKGLKLVAAKLVQVSKELAEAHYAEHRERPFF 63

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELVQ + S PVF  +L+GE AI+  R +MG T+P +A  GTIR   G++IG N +HGSD
Sbjct: 64  GELVQFITSSPVFAMILEGENAIAVVRAMMGKTNPAEAAPGTIRGDLGLTIGMNVVHGSD 123

Query: 121 SLKTALEEISYWFAR 135
           S ++A  EI  WF  
Sbjct: 124 SPESAKREIELWFPE 138


>gi|113970085|ref|YP_733878.1| nucleoside diphosphate kinase [Shewanella sp. MR-4]
 gi|114047326|ref|YP_737876.1| nucleoside diphosphate kinase [Shewanella sp. MR-7]
 gi|119372151|sp|Q0HJE6|NDK_SHESM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119372152|sp|Q0HVN6|NDK_SHESR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|113884769|gb|ABI38821.1| nucleoside diphosphate kinase [Shewanella sp. MR-4]
 gi|113888768|gb|ABI42819.1| nucleoside diphosphate kinase [Shewanella sp. MR-7]
          Length = 143

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL +VAAK   + ++QAE FY  H +R FF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVAAKMLHLTKEQAEGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  +RE++G T+P +A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAQSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL++A  EI+Y+F+  E+ 
Sbjct: 121 SLESAAREIAYFFSAEELC 139


>gi|168705067|ref|ZP_02737344.1| nucleoside diphosphate kinase [Gemmata obscuriglobus UQM 2246]
          Length = 150

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 83/139 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  ++T  ++KPDAV+R L+G I    E  GL +   K   ++R+ AE  Y +HK +PF+
Sbjct: 1   MTTQRTLILLKPDAVQRRLVGEITARFERKGLRLAGLKLVQVSRELAEKHYAVHKGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L+  + SGP    V +G EA++  R +MG TD  K+  GTIR  + +S+  N +HGSD
Sbjct: 61  ESLLTFLTSGPTVALVWEGREAVAVCRTLMGMTDGAKSPPGTIRGDFALSVQNNLVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+ WF   E++
Sbjct: 121 SLENAAIEIALWFKDEELV 139


>gi|90021077|ref|YP_526904.1| nucleoside diphosphate kinase [Saccharophagus degradans 2-40]
 gi|109892789|sp|Q21KT7|NDK_SACD2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|89950677|gb|ABD80692.1| nucleoside diphosphate kinase [Saccharophagus degradans 2-40]
          Length = 141

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV++N+IG ++   E  GL +VAAK   +  ++A  FY  H+ RPFF
Sbjct: 1   MAIERTLSIVKPDAVEKNIIGKVISRFEKAGLKIVAAKMMHLTEEKARGFYAEHEGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE AI+ NRE+MG T+P +A +GT+R  +  S+G N+++GSD
Sbjct: 61  AGLVEFMTSGPVVVQVLEGENAIALNRELMGATNPAEAAEGTLRKDFADSVGRNAVYGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  +EI 
Sbjct: 121 SPASAEREINYFFDASEIC 139


>gi|148236677|ref|NP_001084144.1| nucleoside diphosphate kinase A2 [Xenopus laevis]
 gi|6225752|sp|P70011|NDKA2_XENLA RecName: Full=Nucleoside diphosphate kinase A2; Short=NDK A2;
           Short=NDP kinase A2; AltName: Full=NM23/nucleoside
           diphosphate kinase A2
 gi|1655708|emb|CAA66476.1| NM23/nucleoside diphosphate kinase [Xenopus laevis]
 gi|56269923|gb|AAH87324.1| Nme1 protein [Xenopus laevis]
          Length = 154

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   ++      Y+  KDRPF+P L
Sbjct: 6   ERTFIAIKPDGVQRGLMGDIIKRFEQKGFRLVAMKFLQASQDLLRQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR    I +G N IHGSDS+ 
Sbjct: 66  VEYMNSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDLCIQVGRNIIHGSDSVD 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 126 SANKEIALWFKDEELV 141


>gi|85712741|ref|ZP_01043786.1| Nucleoside diphosphate kinase [Idiomarina baltica OS145]
 gi|85693473|gb|EAQ31426.1| Nucleoside diphosphate kinase [Idiomarina baltica OS145]
          Length = 143

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +NLIG+I    E  GL +VA+K   ++++QAE FY  H +RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNLIGAIYNRFESAGLRIVASKMMHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GEEAI KNRE+MG T+P  AL GT+R  Y  +I EN++HGSD
Sbjct: 61  GALVEFMTSGPIVVQVLEGEEAILKNREIMGATNPADALAGTLRADYAETIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA  EI+Y+F+  EI 
Sbjct: 121 AAETAAREIAYFFSDEEIC 139


>gi|254487604|ref|ZP_05100809.1| nucleoside diphosphate kinase [Roseobacter sp. GAI101]
 gi|214044473|gb|EEB85111.1| nucleoside diphosphate kinase [Roseobacter sp. GAI101]
          Length = 140

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 72/140 (51%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G+I K+ ED GL ++A+K   + + QA +FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGAIAKKFEDAGLRIIASKRIHLTKAQAGEFYKVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+G+ AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPIVAQVLEGDNAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|226724550|sp|B4RVH4|NDK_ALTMD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 143

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +N+IG+I    E  GL +VA+K   M+++QAE FY  HK+RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNVIGAIYNRFESAGLRIVASKMIHMSKEQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A+  NRE+MG T+P  A  GT+R+ Y  SI EN++HGSD
Sbjct: 61  GALVDFMTSGPVMVQVLEGENAVLANREIMGATNPADAASGTLRSDYAASIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + ++A  EI+Y+F+  EI 
Sbjct: 121 APESAAREIAYFFSEEEIC 139


>gi|119384483|ref|YP_915539.1| nucleoside-diphosphate kinase [Paracoccus denitrificans PD1222]
 gi|166232996|sp|A1B2U9|NDK_PARDP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119374250|gb|ABL69843.1| nucleoside diphosphate kinase [Paracoccus denitrificans PD1222]
          Length = 140

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 99/140 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA KRNL G I  + E+ GL +VA K   +   QA  FY  HK+RPF+
Sbjct: 1   MAIERTLSIIKPDATKRNLTGKINAKFEEAGLRIVAQKRIQLTLAQAGQFYAEHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI KNREVMG T+P  A +GTIR ++ +S+GENS+HGSD
Sbjct: 61  GELTEFMTSEPVVVQVLEGEGAILKNREVMGATNPANADEGTIRKEFALSVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+++F+  E++G
Sbjct: 121 SPEAAAREIAFFFSGLELVG 140


>gi|34558279|ref|NP_908094.1| nucleoside diphosphate kinase [Wolinella succinogenes DSM 1740]
 gi|67460697|sp|Q7M7Z3|NDK_WOLSU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|34483998|emb|CAE10994.1| NUCLEOSIDE DIPHOSPHATE KINASE [Wolinella succinogenes]
          Length = 137

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 97/136 (71%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV +N++G I+   E  GL V AAK   ++R  AE FY +HK+RPFF +
Sbjct: 1   MEQTLSIIKPDAVAKNVVGKIIDRFESNGLKVAAAKRLQLSRADAEQFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV   VL+GE A+ KNR++MG TDPKKA  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDFMVSGPVVAMVLEGENAVLKNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           + A  EI+++F+  EI
Sbjct: 121 ENAKIEIAFFFSGREI 136


>gi|89099140|ref|ZP_01172019.1| nucleoside diphosphate kinase [Bacillus sp. NRRL B-14911]
 gi|89086270|gb|EAR65392.1| nucleoside diphosphate kinase [Bacillus sp. NRRL B-14911]
          Length = 148

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 90/138 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+RNL+G IV   E  G  +   K   ++++ AE  Y  HK+RPFF E
Sbjct: 1   MEKTFLMVKPDGVQRNLVGEIVSRFEKKGFQLAGGKLMVISKELAEQHYGEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+PK A  GTIR  + +++G+N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGENVIATARQMMGSTNPKDAAPGTIRGDFAVTVGKNIIHGSDSP 120

Query: 123 KTALEEISYWFARNEIIG 140
           ++A  EI  +F  +E+ G
Sbjct: 121 ESAECEIGLFFNESELAG 138


>gi|302791691|ref|XP_002977612.1| hypothetical protein SELMODRAFT_443584 [Selaginella moellendorffii]
 gi|300154982|gb|EFJ21616.1| hypothetical protein SELMODRAFT_443584 [Selaginella moellendorffii]
          Length = 221

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L+G I+   E  G  +   K        A+  Y   +++PFFP+
Sbjct: 73  LEQTYVMVKPDGVQRGLVGEIISRFEKKGFRLAGLKMFQCPEDLAKKHYEELQEKPFFPK 132

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV     +G   ++  R+++G T+P +A  GTIR    +++G N IHGSDS+
Sbjct: 133 LVKYITSGPVVCMAWEGPGVVASARKLIGSTNPLQAEPGTIRGDLAVAVGRNVIHGSDSV 192

Query: 123 KTALEEISYWFARNEII 139
                EI  WF   E+ 
Sbjct: 193 ANGEREIGLWFGEAELC 209


>gi|12230332|sp|Q9M7P6|NDK_CAPAN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|7643788|gb|AAF65509.1| nucleoside diphosphate kinase [Capsicum annuum]
          Length = 148

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 54/133 (40%), Positives = 82/133 (61%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIIGRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ ++SGPV   V +G+  ++  R+++G T+P ++  GTIR  Y I IG N IHGSD++
Sbjct: 61  LVEYIVSGPVVSMVWEGKGVLTTGRKIIGATNPLESAPGTIRGDYAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPE 133


>gi|296131748|ref|YP_003638995.1| Nucleoside-diphosphate kinase [Thermincola sp. JR]
 gi|296030326|gb|ADG81094.1| Nucleoside-diphosphate kinase [Thermincola potens JR]
          Length = 149

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 83/137 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+RNLIG I+   E  GL +V  K   M+R  AE  Y  H  +PFF  
Sbjct: 1   MERTYVMIKPDGVQRNLIGEIITRFERKGLKIVGLKMLQMDRAMAEKHYAEHTGKPFFEG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   VL+G++ ++  R + G T+P  A  GTIR  Y I +G N IH SDS+
Sbjct: 61  LVSYITSGPVVAMVLEGKDVVATARAMNGATNPANAGPGTIRGDYAIEVGRNVIHASDSI 120

Query: 123 KTALEEISYWFARNEII 139
            +A  EI+ +F  NE+ 
Sbjct: 121 DSANREIAIYFTENELC 137


>gi|260433985|ref|ZP_05787956.1| nucleoside diphosphate kinase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417813|gb|EEX11072.1| nucleoside diphosphate kinase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 157

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  +LE+ GL ++A K   M ++QA  FY +HKDRPF+
Sbjct: 18  MALERTFSIIKPDATRRNLTGKINAKLEEAGLRIIAQKRIKMTKEQAGKFYEVHKDRPFY 77

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 78  DELCEFMSSAPVVVQVLEGENAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 137

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 138 APETAAVEIAYFFSGTELVG 157


>gi|37520279|ref|NP_923656.1| nucleoside diphosphate kinase [Gloeobacter violaceus PCC 7421]
 gi|67460700|sp|Q7NMQ5|NDK_GLOVI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|35211272|dbj|BAC88651.1| nucleoside diphosphate kinase [Gloeobacter violaceus PCC 7421]
          Length = 149

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 85/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I++  E  G  +V  K   ++   A+  Y  HK+RPFF  
Sbjct: 1   MERTFIAIKPDGVQRGLVGEILQRFERRGFKLVGLKLMQVSEALAQKHYAEHKERPFFGG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   VL+G+  ++  R +MG T+P  +  GTIR  YGI IG N IHGSDSL
Sbjct: 61  LVAFITSSPVVAVVLEGKGVVATARAMMGVTNPLNSPLGTIRGDYGIDIGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ WFA  E++
Sbjct: 121 ESAEREIALWFAPAELL 137


>gi|84387622|ref|ZP_00990639.1| nucleoside diphosphate kinase [Vibrio splendidus 12B01]
 gi|218708637|ref|YP_002416258.1| nucleoside diphosphate kinase [Vibrio splendidus LGP32]
 gi|254767261|sp|B7VJT4|NDK_VIBSL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|84377467|gb|EAP94333.1| nucleoside diphosphate kinase [Vibrio splendidus 12B01]
 gi|218321656|emb|CAV17608.1| Nucleoside diphosphate kinase [Vibrio splendidus LGP32]
          Length = 144

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAVKRNL+G I   +E  GL ++AAK   +   QA  FY  H+ + FF
Sbjct: 1   MALERTFSIVKPDAVKRNLVGEIYHRIEKAGLQIIAAKMVSLTEAQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR  Y IS+  NS+HGSD
Sbjct: 61  GPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRADYAISMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SPESAAREIEFFFPESEIC 139


>gi|84500996|ref|ZP_00999231.1| nucleoside diphosphate kinase [Oceanicola batsensis HTCC2597]
 gi|84391063|gb|EAQ03481.1| nucleoside diphosphate kinase [Oceanicola batsensis HTCC2597]
          Length = 140

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 103/140 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA +RNL G I  + E+ GL +VA K   ++++QA  FY +HK+RPF+
Sbjct: 1   MATERTLSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIKLSKEQAGVFYEVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI+Y+F+  E++G
Sbjct: 121 APETAAQEIAYFFSGLELVG 140


>gi|119476381|ref|ZP_01616732.1| nucleoside diphosphate kinase [marine gamma proteobacterium
           HTCC2143]
 gi|119450245|gb|EAW31480.1| nucleoside diphosphate kinase [marine gamma proteobacterium
           HTCC2143]
          Length = 142

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAV +N+IG I    E+ GLC+VA+K   ++R QAE FY  HK RPFF
Sbjct: 1   MAIERTFSIVKPDAVAKNVIGKIYSRFEEAGLCLVASKMLQLSRGQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGPV +QVL+GE AISKNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  PALIEFMTSGPVMVQVLEGESAISKNRELMGATNPKEAEAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S ++A  EI+Y+F+  ++ G
Sbjct: 121 SAESAAREIAYFFSTCDLCG 140


>gi|66864901|ref|NP_001019809.1| nucleoside diphosphate kinase B [Canis lupus familiaris]
 gi|75069661|sp|Q50KA8|NDKB_CANFA RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B; AltName: Full=Histidine protein
           kinase NDKB; AltName: Full=nm23-C2
 gi|63003109|dbj|BAD97838.1| NM23-C2 [Canis lupus familiaris]
          Length = 152

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G IVK  E  G  +VA KF   +    ++ Y+  KDRPF+P L
Sbjct: 5   ERTFIAIKPDGVQRGLVGDIVKRFEQKGFRLVAMKFLRASEDLLKEHYIDLKDRPFYPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+K
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRMMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SAEKEISLWFKPEELV 140


>gi|293391438|ref|ZP_06635772.1| nucleoside diphosphate kinase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951972|gb|EFE02091.1| nucleoside diphosphate kinase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 141

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 95/138 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M ++ T S+IKPDAVKR+L+G+I+   E  G  +VAAK   + ++QAE FY+ H+ +PFF
Sbjct: 1   MSLQLTLSIIKPDAVKRHLVGAILARFEQQGFKIVAAKMLHLTQEQAEGFYVEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M S PV + VL+ E A+   R ++G T+P+ A KGTIR  + +S  ENS+HGSD
Sbjct: 61  VSLVEYMTSAPVLVSVLEKENAVQDYRTLIGSTNPENAAKGTIRRDFALSQQENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI+Y+F  +EI
Sbjct: 121 SPESAAREIAYFFVSDEI 138


>gi|212638937|ref|YP_002315457.1| nucleoside diphosphate kinase [Anoxybacillus flavithermus WK1]
 gi|212560417|gb|ACJ33472.1| Nucleoside diphosphate kinase [Anoxybacillus flavithermus WK1]
          Length = 148

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 94/137 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R +IG IV   E  G  +V AK   ++R+ AE  Y  HK+RPFF E
Sbjct: 1   MERTFLMVKPDGVQRGVIGDIVARFERKGFQLVGAKLMQVSRELAEQHYAEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  V +GE  I+  R++MG T+P++AL GTIR  +G+++G+N IHGSDS 
Sbjct: 61  LVEFITSGPVFAMVWEGENVIATARQMMGKTNPQEALPGTIRGDFGLTVGKNIIHGSDSK 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F   E++
Sbjct: 121 ESAAREIQLFFKEEELV 137


>gi|1346673|sp|P47923|NDK2_PEA RecName: Full=Nucleoside diphosphate kinase 2, chloroplastic;
           AltName: Full=Nucleoside diphosphate kinase II;
           Short=NDK II; Short=NDP kinase II; Short=NDPK II;
           Contains: RecName: Full=Nucleoside diphosphate kinase 2
           high molecular weight; Contains: RecName:
           Full=Nucleoside diphosphate kinase 2 low molecular
           weight; Flags: Precursor
 gi|758644|emb|CAA86071.1| nucleoside diphosphate kinase II, precursor [Pisum sativum]
          Length = 230

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++ + M+KPD V+R L+G I+   E  G  +   K    +++ AE+ Y     + FFP+
Sbjct: 82  VDQAYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCSKELAEEHYKHLNQKSFFPK 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   +   R+++G TDP +A  GTIR  + +  G N IHGSDS 
Sbjct: 142 LIEYITSGPVVSMAWEGVGVVPSARKLIGATDPLQAEPGTIRGDFAVQTGRNIIHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 202 ENGEREIALWFKEGELC 218


>gi|119505392|ref|ZP_01627466.1| nucleoside diphosphate kinase [marine gamma proteobacterium
           HTCC2080]
 gi|119458847|gb|EAW39948.1| nucleoside diphosphate kinase [marine gamma proteobacterium
           HTCC2080]
          Length = 141

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E  GL +VA++   ++   A  FY  HK RPF+
Sbjct: 1   MATERTLSIIKPDAVGKNVIGEIYTRFESAGLRIVASRMMQLSDTTAGGFYAEHKGRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M SGPV +QVL+GE AI+KNR++MG T+P++A  GTIR  +  +I  N++HGSD
Sbjct: 61  DDLVKFMTSGPVVVQVLEGEGAIAKNRDLMGATNPQEAAAGTIRADFATTIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA NE+ 
Sbjct: 121 SPESAAREIAYFFAANEVC 139


>gi|33416409|gb|AAH55613.1| Nme2 protein [Danio rerio]
 gi|197247050|gb|AAI64902.1| Nme2 protein [Danio rerio]
          Length = 153

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 59/141 (41%), Positives = 83/141 (58%), Gaps = 2/141 (1%)

Query: 1   MV--IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRP 58
           M    E+TF  +KPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRP
Sbjct: 1   MAGKTERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAMKFLQASEDLLKQHYIDLKDRP 60

Query: 59  FFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHG 118
           F+P LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHG
Sbjct: 61  FYPGLVKYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIEVGRNIIHG 120

Query: 119 SDSLKTALEEISYWFARNEII 139
           SDS+ +A  EIS WF   E++
Sbjct: 121 SDSVDSANTEISLWFKPEELV 141


>gi|5053132|gb|AAC79499.2| nucleoside diphosphate kinase [Pseudomonas aeruginosa]
          Length = 150

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDAV +N+IG I+   E  GL VVA+K   ++ ++A  FY  HK+RPFF
Sbjct: 1   MALQRTFSIIKPDAVSKNVIGEILTRFEKAGLRVVASKMVQLSEREAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QV++GE+AI +NRE+MG TDPKKA  GTIR  + +SI EN++HGSD
Sbjct: 61  KDLVSFMTSGPVVVQVMEGEDAILRNRELMGATDPKKADAGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+  E+ 
Sbjct: 121 SEASAAREIAYFFSSTEVC 139


>gi|149238437|ref|XP_001525095.1| nucleoside diphosphate kinase [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451692|gb|EDK45948.1| nucleoside diphosphate kinase [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 151

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 51/139 (36%), Positives = 79/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI +I+   E+ G  +V  K            Y   + +PFF
Sbjct: 1   MSDERTFIAIKPDGVQRGLISAILGRFENRGYKLVGIKLVQPTESLLRTHYEDLQSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M+SGPV   V +G++ + + R ++G T+P  +  GTIR  + + +G N  HGSD
Sbjct: 61  PSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLASAPGTIRGDFAVDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI  WF   E++
Sbjct: 121 SVESAKKEIDLWFKPEELV 139


>gi|225709378|gb|ACO10535.1| Nucleoside diphosphate kinase B [Caligus rogercresseyi]
          Length = 152

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R LIG IVK  E  G  +VA KF   + +     Y     +PFF  L
Sbjct: 5   ERTFIMIKPDGVQRGLIGDIVKRFEQKGFKLVAMKFIQSSIEHLRKHYADLSSKPFFEGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+PK +  GTIR  + + IG N  HGSD+++
Sbjct: 65  VKYMASGPVLAMVWEGLNVVKTGRVMLGETNPKDSAPGTIRGDFCVQIGRNICHGSDAVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF  +E++
Sbjct: 125 SAEKEIALWFTPDELV 140


>gi|288931004|ref|YP_003435064.1| nucleoside-diphosphate kinase [Ferroglobus placidus DSM 10642]
 gi|288893252|gb|ADC64789.1| Nucleoside-diphosphate kinase [Ferroglobus placidus DSM 10642]
          Length = 151

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 91/137 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD VKR LIG ++K +E  GL +VA K   ++++ AE  Y  HK++PFF  
Sbjct: 1   MERTFVMVKPDGVKRGLIGEVIKRIEQKGLKIVAMKMMEVSKELAEKHYAEHKEKPFFQS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV   V++G+EA+   R ++G T+P +A  GTIR  + + IG N +H SDSL
Sbjct: 61  LISYITSGPVVAMVVEGKEAVKVMRNLVGKTNPIEASPGTIRGDFAMDIGRNIVHASDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EIS +F   EI+
Sbjct: 121 ESAEREISLFFNEEEIL 137


>gi|308050462|ref|YP_003914028.1| nucleoside diphosphate kinase [Ferrimonas balearica DSM 9799]
 gi|307632652|gb|ADN76954.1| nucleoside diphosphate kinase [Ferrimonas balearica DSM 9799]
          Length = 143

 Score =  177 bits (450), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV +NLIG+I    E  GL +VA+K   + R+QAE FY  HK+RPFF
Sbjct: 1   MALERTFSIIKPDAVAKNLIGAIYNRFESAGLKIVASKMVHLTREQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  NRE+MG T+P  A +GT+R+ Y  SI EN++HGSD
Sbjct: 61  GALVDFMTSGPIMVQVLEGENAVLANREIMGATNPADAARGTLRSDYANSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +L +A  EI+Y+F+  EI 
Sbjct: 121 ALASAEREIAYFFSAEEIC 139


>gi|88809772|ref|ZP_01125278.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 7805]
 gi|148240724|ref|YP_001226111.1| nucleoside diphosphate kinase [Synechococcus sp. WH 7803]
 gi|166233029|sp|A5GPE9|NDK_SYNPW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|88786156|gb|EAR17317.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 7805]
 gi|147849263|emb|CAK24814.1| Nucleoside diphosphate kinase [Synechococcus sp. WH 7803]
          Length = 152

 Score =  177 bits (450), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 62/138 (44%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LIG I+   E  G  +V  K    +R+ AE  Y +HK+RPFF
Sbjct: 1   MASERTFIAIKPDGVQRGLIGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    I+IG N IHGSD
Sbjct: 61  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAINIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 121 APETAQFEIGLWFQASEL 138


>gi|119485410|ref|ZP_01619738.1| Nucleoside diphosphate kinase [Lyngbya sp. PCC 8106]
 gi|119457166|gb|EAW38292.1| Nucleoside diphosphate kinase [Lyngbya sp. PCC 8106]
          Length = 149

 Score =  177 bits (450), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 57/138 (41%), Positives = 89/138 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G ++   E+ G  +V  K   ++R+ AE+ Y +HK +PFF  
Sbjct: 1   MERTFIAIKPDGVQRRLVGEVISRFEEKGFTLVGLKLMSVSRELAENHYEVHKGKPFFDG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV   V +G+  ++  R+++G T+P  A  GTIR  Y +S+G N IHGSD++
Sbjct: 61  LMKFITSGPVVAMVWEGDGVVAAARKMIGATNPLTAEPGTIRGDYAVSVGRNLIHGSDAI 120

Query: 123 KTALEEISYWFARNEIIG 140
           +TA  EIS WF   ++ G
Sbjct: 121 ETANREISLWFKEEDLSG 138


>gi|261867560|ref|YP_003255482.1| nucleoside diphosphate kinase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412892|gb|ACX82263.1| nucleoside diphosphate kinase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 141

 Score =  177 bits (450), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAVKR+L+G+I+   E  G  +VAAK   + ++QAE FY+ H+ +PFF
Sbjct: 1   MSLQRTLSIIKPDAVKRHLVGAILACFEQQGFKIVAAKMLHLTQEQAEGFYVEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M S PV + VL+ E A+   R ++G T+P+ A KGTIR  + +S  ENS+HGSD
Sbjct: 61  VSLVEYMTSAPVLVSVLEKENAVQDYRTLIGSTNPENAAKGTIRRDFALSQQENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI+Y+F  +EI
Sbjct: 121 SPESAAREIAYFFVSDEI 138


>gi|15614217|ref|NP_242520.1| nucleoside diphosphate kinase [Bacillus halodurans C-125]
 gi|18203177|sp|Q9KCB9|NDK_BACHD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|10174271|dbj|BAB05373.1| nucleoside diphosphate kinase [Bacillus halodurans C-125]
          Length = 147

 Score =  177 bits (450), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 88/136 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+RNLIG IV   E  G  ++ AK   + ++QAE  Y  HK+RPFF E
Sbjct: 1   MERTYLMIKPDGVQRNLIGEIVSRFEKKGFTLIGAKLMTVTKEQAETHYAEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+P  A  GTIR  +G+ +  N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGENVIATARKMMGATNPADAEPGTIRGDFGVQVAMNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  +F  +E+
Sbjct: 121 ESAKREIDIFFDSSEL 136


>gi|284433792|gb|ADB85102.1| nucleoside diphosphate kinase B [Jatropha curcas]
          Length = 148

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 81/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIIGRFEKKGFSLKGLKLITVDRSFAERHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  ++  R+++G T+P ++  GTIR  Y I IG N IHGSDS+
Sbjct: 61  LVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESAPGTIRGDYAIDIGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++  +EI+ WF  
Sbjct: 121 ESGRKEIALWFPE 133


>gi|228475988|ref|ZP_04060696.1| nucleoside diphosphate kinase [Staphylococcus hominis SK119]
 gi|314936398|ref|ZP_07843745.1| nucleoside diphosphate kinase [Staphylococcus hominis subsp.
           hominis C80]
 gi|228269811|gb|EEK11291.1| nucleoside diphosphate kinase [Staphylococcus hominis SK119]
 gi|313655017|gb|EFS18762.1| nucleoside diphosphate kinase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 150

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  GL +V  KF    +      Y  H ++PFF +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIERKGLKIVGGKFIIPTKDTVNIHYAEHTEKPFFHK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V++GE+A++ +R ++G T+P +A  GTIR  YG+++G N IHGSDS+
Sbjct: 61  LVSFLTSGPVFAMVVEGEDAVAVSRHIIGKTNPTEAAPGTIRGDYGLTVGRNIIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF  +EI
Sbjct: 121 ESAEREINLWFNDDEI 136


>gi|82900057|ref|XP_485703.2| PREDICTED: nucleoside diphosphate kinase B-like [Mus musculus]
 gi|94375800|ref|XP_980967.1| PREDICTED: nucleoside diphosphate kinase B-like [Mus musculus]
          Length = 181

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 58/140 (41%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  K RPF
Sbjct: 30  MANLECTFIAIKPDGVQRGLVGEIIKRFEQKGFHLVAMKFLQASEEHLKQHYIDLKVRPF 89

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 90  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 149

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +E+  WF   E++
Sbjct: 150 DSVESAEKEMHLWFKPEELM 169


>gi|307822493|ref|ZP_07652724.1| Nucleoside-diphosphate kinase [Methylobacter tundripaludum SV96]
 gi|307736097|gb|EFO06943.1| Nucleoside-diphosphate kinase [Methylobacter tundripaludum SV96]
          Length = 143

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N+IG I    E   L +VAAK   + ++QAE FY  H +R FF
Sbjct: 1   MAIERTFSIIKPDAVAKNVIGEIYSRFEKNDLKIVAAKMLHLTKEQAEGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE A+ K+R++MG T+PK+A  GTIR  +  SI EN++HGSD
Sbjct: 61  NDLVAFMISGPVIMQVLEGENAVLKHRDIMGATNPKEAAAGTIRADFASSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +++TA  EI+Y+F+ NEI 
Sbjct: 121 AVETAQREIAYFFSDNEIC 139


>gi|156063126|ref|XP_001597485.1| nucleoside diphosphate kinase [Sclerotinia sclerotiorum 1980]
 gi|154697015|gb|EDN96753.1| nucleoside diphosphate kinase [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 152

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 78/139 (56%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +   K C   ++  E  Y    D+PFF
Sbjct: 1   MSNEQTFIAIKPDGVQRGLVGPIISRFEARGYKLAGIKLCSPGKEHLEKHYADLSDKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSD
Sbjct: 61  AGLVNYMNSGPICAMVWEGRDAVKTGRTLLGATNPLASAPGTIRGDYAIDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A +EI+ WF   E++
Sbjct: 121 SVENAKKEIALWFKEGEVL 139


>gi|116667867|pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A
           Complexed With Adp
 gi|116667868|pdb|2HVE|B Chain B, S120g Mutant Of Human Nucleoside Diphosphate Kinase A
           Complexed With Adp
 gi|116667869|pdb|2HVE|C Chain C, S120g Mutant Of Human Nucleoside Diphosphate Kinase A
           Complexed With Adp
          Length = 152

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHG DS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGGDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|29654560|ref|NP_820252.1| nucleoside diphosphate kinase [Coxiella burnetii RSA 493]
 gi|161831020|ref|YP_001597108.1| nucleoside diphosphate kinase [Coxiella burnetii RSA 331]
 gi|212212360|ref|YP_002303296.1| nucleoside diphosphate kinase [Coxiella burnetii CbuG_Q212]
 gi|38372274|sp|Q83C71|NDK_COXBU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029036|sp|A9NDW8|NDK_COXBR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729794|sp|B6IZM3|NDK_COXB2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|29541828|gb|AAO90766.1| nucleoside diphosphate kinase [Coxiella burnetii RSA 493]
 gi|161762887|gb|ABX78529.1| nucleoside diphosphate kinase [Coxiella burnetii RSA 331]
 gi|212010770|gb|ACJ18151.1| nucleoside diphosphate kinase [Coxiella burnetii CbuG_Q212]
          Length = 144

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 76/137 (55%), Positives = 102/137 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL ++AAK C +++ QAE FY +HKDRPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFEKAGLKIIAAKMCHLSKPQAEKFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+LV+ M  GPV +QVL+GE AI KNRE+MG T+PK+AL GTIR  +  SI  N++HGSD
Sbjct: 61  PDLVKFMTQGPVMIQVLEGENAIVKNREIMGATNPKEALPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNE 137
             +TA EEI+++F  +E
Sbjct: 121 GPETAKEEIAFFFKPDE 137


>gi|225714774|gb|ACO13233.1| Nucleoside diphosphate kinase A [Esox lucius]
          Length = 151

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF         + Y   K+RPFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLVGDIIKRFEQKGFKLVGMKFIQAPESLLREHYADLKERPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G  A+   R ++G+T+P  +  GTIR  + I +G N IHGSDS+ 
Sbjct: 65  VSYMASGPVVAMVWEGLNAVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVD 124

Query: 124 TALEEISYWFARNEII 139
           +A  EIS WF  +E+ 
Sbjct: 125 SANTEISLWFKPDELC 140


>gi|75283426|sp|Q56E62|NDK1_TOBAC RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I
 gi|62114996|gb|AAX63738.1| nucleoside diphosphate kinase [Nicotiana tabacum]
          Length = 148

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 81/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIIGRFEKKGFSLKGLKLITVDRAFAEKHYSDLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   V +G+  ++  R+++G T+P ++  GTIR  Y I IG N IHGSD++
Sbjct: 61  LVDYIISGPVVAMVWEGKGVVTTGRKIIGATNPLESAPGTIRGDYAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPE 133


>gi|260426708|ref|ZP_05780687.1| nucleoside diphosphate kinase [Citreicella sp. SE45]
 gi|260421200|gb|EEX14451.1| nucleoside diphosphate kinase [Citreicella sp. SE45]
          Length = 140

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 72/140 (51%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDA +RNL G I  + E+ GL +VA K   + + QA +FY +H +RPF+
Sbjct: 1   MAVERTLSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIQLTKAQAGEFYKVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAAEIAYYFSGLELVG 140


>gi|149201845|ref|ZP_01878819.1| nucleoside diphosphate kinase [Roseovarius sp. TM1035]
 gi|149144893|gb|EDM32922.1| nucleoside diphosphate kinase [Roseovarius sp. TM1035]
          Length = 140

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDA KRNL G I  + ED GL +VA K   +  +QA  FY +HK+RPF+
Sbjct: 1   MAVERTLSIIKPDATKRNLTGKINAKFEDAGLRIVAQKRIQLTPEQAGVFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGPV +QVL+GE A++KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  GELCEFMASGPVVVQVLEGEGAVAKNREVMGATNPADAAAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 AAETAAVEIAYFFSGLELVG 140


>gi|146423220|ref|XP_001487541.1| nucleoside diphosphate kinase [Meyerozyma guilliermondii ATCC 6260]
 gi|146388662|gb|EDK36820.1| nucleoside diphosphate kinase [Meyerozyma guilliermondii ATCC 6260]
          Length = 151

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 80/139 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R LI SI+   E+ G  +V  K            Y   + +PFF
Sbjct: 1   MSNERTFIAIKPDGVQRGLISSILGRFENRGYKLVGIKLVQPTEDLLRTHYDDLQSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M+SGPV   V +G++ + + R ++G T+P  +  GTIR  + I +G N  HGSD
Sbjct: 61  PSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLNSAPGTIRADFAIDMGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI  WF + E++
Sbjct: 121 SVESANKEIGLWFKKEELV 139


>gi|319400818|gb|EFV89037.1| nucleoside diphosphate kinase [Staphylococcus epidermidis FRI909]
          Length = 149

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  GL +V  KF  +  + AE  Y  HK +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIEKKGLKLVGGKFMQVPMELAEKHYSEHKGKPFYDK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++ +R+++G T+P +A  GTIR  YG+++G N IHGSDS 
Sbjct: 61  LISFITSAPVFAMVVEGENAVAVSRKIIGSTNPSEAAPGTIRGDYGLNLGRNIIHGSDST 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  E+  WF  +EI
Sbjct: 121 ESAQREVKLWFTSSEI 136


>gi|321259177|ref|XP_003194309.1| nucleoside-diphosphate kinase [Cryptococcus gattii WM276]
 gi|317460780|gb|ADV22522.1| Nucleoside-diphosphate kinase, putative [Cryptococcus gattii WM276]
          Length = 152

 Score =  177 bits (449), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 79/136 (58%), Gaps = 1/136 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+T+ MIKPD V+R L+G I+   E  G  +VA K     ++  E  Y    D+PF
Sbjct: 1   MSTTEQTYIMIKPDGVQRGLVGEIIARFEKRGFKLVALKLHTPTKEHLEKHYSDLSDKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M+SGPV   V +G +A+   R ++G T+P  +  GTIR  Y + +G N  HGS
Sbjct: 61  FPRLVEYMMSGPVVCMVWEGLDAVKTGRVMLGATNPLASAPGTIRGDYALQVGMNVCHGS 120

Query: 120 DSLKTALEEISYWFAR 135
           DS++   +EI+ WF  
Sbjct: 121 DSVENGQKEIALWFPE 136


>gi|153208851|ref|ZP_01947075.1| nucleoside diphosphate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|165921436|ref|ZP_02219624.1| nucleoside diphosphate kinase [Coxiella burnetii RSA 334]
 gi|212218670|ref|YP_002305457.1| nucleoside diphosphate kinase [Coxiella burnetii CbuK_Q154]
 gi|226729793|sp|B6J7R3|NDK_COXB1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|120575702|gb|EAX32326.1| nucleoside diphosphate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|165916751|gb|EDR35355.1| nucleoside diphosphate kinase [Coxiella burnetii RSA 334]
 gi|212012932|gb|ACJ20312.1| nucleoside diphosphate kinase [Coxiella burnetii CbuK_Q154]
          Length = 139

 Score =  177 bits (449), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 76/138 (55%), Positives = 103/138 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL +++AK C +++ QAE FY +HKDRPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFEKAGLKIISAKMCHLSKPQAEKFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+LV+ M  GPV +QVL+GE AI KNRE+MG T+PK+AL GTIR  +  SI  N++HGSD
Sbjct: 61  PDLVKFMTQGPVMIQVLEGENAIVKNREIMGATNPKEALPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
             +TA EEI+++F  +EI
Sbjct: 121 GPETAKEEIAFFFKPDEI 138


>gi|254511534|ref|ZP_05123601.1| nucleoside diphosphate kinase [Rhodobacteraceae bacterium KLH11]
 gi|221535245|gb|EEE38233.1| nucleoside diphosphate kinase [Rhodobacteraceae bacterium KLH11]
          Length = 140

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   M + QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHMTKAQAGKFYDVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMSSAPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGIELVG 140


>gi|266607|sp|Q01402|NDK2_SPIOL RecName: Full=Nucleoside diphosphate kinase 2, chloroplastic;
           AltName: Full=Nucleoside diphosphate kinase II;
           Short=NDK II; Short=NDP kinase II; Short=NDPK II;
           Contains: RecName: Full=Nucleoside diphosphate kinase 2
           high molecular weight; Contains: RecName:
           Full=Nucleoside diphosphate kinase 2 low molecular
           weight; Flags: Precursor
 gi|218273|dbj|BAA02018.1| nucleoside diphosphate kinase II [Spinacia oleracea]
          Length = 233

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+R L+G I+   E  G  ++  K     ++ AE+ Y   K + F+ +
Sbjct: 85  VEETYIMIKPDGVQRGLVGEIISRFEKKGFKLIGLKMYPCPKELAEEHYKDLKAKSFYQK 144

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G   ++ +R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 145 LIDYITSGPVVCMAWEGVGVVASSRKLIGATDPLQAEPGTIRGDLAVQTGRNVVHGSDSP 204

Query: 123 KTALEEISYWFARNEII 139
                EI  WF   EI 
Sbjct: 205 DNGKREIGLWFKEGEIC 221


>gi|259419212|ref|ZP_05743129.1| nucleoside diphosphate kinase [Silicibacter sp. TrichCH4B]
 gi|259345434|gb|EEW57288.1| nucleoside diphosphate kinase [Silicibacter sp. TrichCH4B]
          Length = 140

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G+I  + E+ GL +VA K   M + QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGAINAKFEEAGLRIVAQKRIHMTKAQAGKFYEVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNRE+MG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMCSAPVVVQVLEGEGAIAKNREIMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|183599741|ref|ZP_02961234.1| hypothetical protein PROSTU_03245 [Providencia stuartii ATCC 25827]
 gi|188022001|gb|EDU60041.1| hypothetical protein PROSTU_03245 [Providencia stuartii ATCC 25827]
          Length = 141

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKP+AVK+N IG+I    E  G  +VAAK   + R+QAE FY  HK RPFF
Sbjct: 1   MTVQRTFSIIKPNAVKKNAIGAIYNRFESAGFSIVAAKMLHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ LQVL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  EGLVEFMTSGPIMLQVLEGENAVQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F  +EI 
Sbjct: 121 SVESANREIAYFFTEDEIC 139


>gi|126668576|ref|ZP_01739530.1| Nucleoside diphosphate kinase [Marinobacter sp. ELB17]
 gi|126626981|gb|EAZ97624.1| Nucleoside diphosphate kinase [Marinobacter sp. ELB17]
          Length = 142

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E+  L VVAAK   +++ QAE FY  HK+RPFF
Sbjct: 1   MANERTLSIIKPDAVAKNVIGKITSRFENADLHVVAAKMMHLSQDQAEGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +Q L+GE AI KNR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVAFMTSGPVVVQALEGEGAILKNRDLMGATNPKEAEAGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  NEI 
Sbjct: 121 SAASAEREIAYFFNDNEIC 139


>gi|87300760|ref|ZP_01083602.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 5701]
 gi|87284631|gb|EAQ76583.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 5701]
          Length = 152

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 85/138 (61%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ AE  Y +H++RPFF
Sbjct: 1   MAVERTFLAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLVPSRELAESHYGVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 61  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA+ EI  WF  +E+
Sbjct: 121 APETAVFEIGLWFEPSEL 138


>gi|71040669|gb|AAZ20283.1| nucleoside diphosphate kinase I [Arachis hypogaea]
          Length = 149

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 55/134 (41%), Positives = 81/134 (60%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF 
Sbjct: 1   MAEQTFIMIKPDGVQRGLVGEIISRFEKKGFYLKGLKLITVDRPFAERHYSDLSAKPFFN 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + I IG N IHGSDS
Sbjct: 61  GLVEYIISGPVVAMVWEGKGVVATGRKLIGATNPLASEPGTIRGDFAIDIGRNVIHGSDS 120

Query: 122 LKTALEEISYWFAR 135
           +++A +EI+ WF  
Sbjct: 121 VESATKEIALWFPE 134


>gi|307136116|gb|ADN33962.1| nucleoside diphosphate kinase [Cucumis melo subsp. melo]
          Length = 227

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 78/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T+ M+KPD V+R L+G I+   E  G  +   K     ++ AE+ Y   K + FFP 
Sbjct: 79  VDQTYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCTKELAEEHYKDLKGKSFFPG 138

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G T+P +A  GTIR    I  G N IHGSDS 
Sbjct: 139 LIEYITSGPVVCMAWEGVGVVASARKLIGVTNPLEAEPGTIRGDLAIQKGRNVIHGSDSP 198

Query: 123 KTALEEISYWFARNEII 139
           ++   E++ WF   E++
Sbjct: 199 ESGKREVALWFKEGELV 215


>gi|258619954|ref|ZP_05714994.1| nucleoside diphosphate kinase [Vibrio mimicus VM573]
 gi|258587687|gb|EEW12396.1| nucleoside diphosphate kinase [Vibrio mimicus VM573]
          Length = 142

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAVKRNLIG I   +E  GL ++AAK   ++ +QA  FY  H+ +PFF
Sbjct: 1   MALERTFSIIKPDAVKRNLIGEIYHRIEKAGLQIIAAKMVHLSEEQASGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + M SGP+ +QVL+GE AI + RE+MG T+P++A  GT+R  Y +S+  NS+HGSD
Sbjct: 61  EPLKEFMTSGPIMVQVLEGENAIIRYRELMGKTNPEEAACGTLRADYALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI ++F  +EI 
Sbjct: 121 SQASAAREIEFFFPESEIC 139


>gi|255627809|gb|ACU14249.1| unknown [Glycine max]
          Length = 149

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 55/135 (40%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF MIKPD V+R LIG I+   E  G  +   K   ++R  AE  Y     +PFF
Sbjct: 1   MA-EQTFIMIKPDGVQRGLIGEIISRFERKGFYLKGLKLVTVDRPFAEKHYADLSAKPFF 59

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  ++SGPV   + +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD
Sbjct: 60  SGLVDYIVSGPVVAMIWEGKNVVTTGRKIIGATNPAQSGPGTIRGDFAIDIGRNVIHGSD 119

Query: 121 SLKTALEEISYWFAR 135
           S+++A +EI+ WF  
Sbjct: 120 SVESANKEIALWFPE 134


>gi|149773572|ref|NP_001092456.1| nucleoside diphosphate kinase 3 [Bos taurus]
 gi|148744997|gb|AAI42383.1| NME3 protein [Bos taurus]
 gi|296473472|gb|DAA15587.1| nucleoside diphosphate kinase 3 [Bos taurus]
          Length = 169

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPFF  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFFGRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 82  VKYMGSGPVVAMVWQGLDVVRASRALIGATNPADATPGTIRGDFCIEVGKNVIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SARREIALWFRTDELL 157


>gi|330446675|ref|ZP_08310327.1| nucleoside diphosphate kinase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490866|dbj|GAA04824.1| nucleoside diphosphate kinase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 142

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAVKRNLIG+I +  E+ GL +VAAK   ++  +A+ FY  H+ +PFF
Sbjct: 1   MTIERTFSIVKPDAVKRNLIGAIYQRFENAGLKIVAAKMVHLDSAKAQGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI + RE+MG T+P++A  GTIR+ + +S+  NS+HGSD
Sbjct: 61  DDLVAFMTSGPVMVQVLEGENAIVRYRELMGKTNPEEAACGTIRSDFALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA +EI 
Sbjct: 121 SPESAAREIAYFFAEDEIC 139


>gi|167516512|ref|XP_001742597.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163779221|gb|EDQ92835.1| predicted protein [Monosiga brevicollis MX1]
          Length = 152

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 55/135 (40%), Positives = 77/135 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T+ MIKPD V+R L+G IV   E  G  + A K      +  E  Y   K + FFP L
Sbjct: 5   ERTYIMIKPDGVQRGLVGEIVARFEKKGFKLCALKLKQATEELLEQHYADLKGKKFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R+++G+T P  +L GTIR  + I +G N  HGSDS++
Sbjct: 65  VSYMASGPVVCMVWEGTNVVKSGRKLLGETRPDDSLPGTIRGDFCIEVGRNICHGSDSVE 124

Query: 124 TALEEISYWFARNEI 138
           +A +EI+ WF   E+
Sbjct: 125 SAEKEIALWFGEGEV 139


>gi|149286936|gb|ABR23367.1| nucleoside diphosphate kinase [Ornithodoros parkeri]
          Length = 153

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E++F M+KPD V+R L+G I++  E  G  +VA KF     +  +  Y     RPFF  L
Sbjct: 5   ERSFIMVKPDGVQRGLVGEIIQRFEKRGYKLVALKFMQAGEELLKKHYADLAGRPFFNGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           VQ M  GPV   V +G   ++  R+++G TDP K+  GTIR  Y + +G N IHGSDS  
Sbjct: 65  VQYMQMGPVVPMVWEGANVVATARDMIGQTDPLKSNPGTIRGDYCVQVGRNVIHGSDSTA 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFTEQELV 140


>gi|56697295|ref|YP_167661.1| nucleoside diphosphate kinase [Ruegeria pomeroyi DSS-3]
 gi|67460616|sp|Q5LQP4|NDK_SILPO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56679032|gb|AAV95698.1| nucleoside diphosphate kinase [Ruegeria pomeroyi DSS-3]
          Length = 140

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   M ++QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHMTKEQAGVFYGVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMSSAPVVVQVLEGENAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGIELVG 140


>gi|156846649|ref|XP_001646211.1| hypothetical protein Kpol_1013p24 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116885|gb|EDO18353.1| hypothetical protein Kpol_1013p24 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 152

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  +KPD V+R L+  I+   E+ G  +V  K    ++   +  Y  H  +PF
Sbjct: 1   MSNTERTFIAVKPDGVQRGLVSKILSRFEERGFKLVGLKMINASQDLLDQHYAEHVGKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           F ++   M SGP+   V +G++ +++ R ++G T+P  +  GTIR  + I +G N  HGS
Sbjct: 61  FAKMTAFMRSGPIVATVWEGKDVVNQGRRILGATNPLDSAPGTIRGDFAIDLGRNVCHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A  EI+ WF + E++
Sbjct: 121 DSVESANREINLWFKKEELV 140


>gi|311251761|ref|XP_003124767.1| PREDICTED: nucleoside diphosphate kinase 3-like [Sus scrofa]
          Length = 170

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 23  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 82

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 83  VKYMGSGPVVAMVWQGLDVVRASRALIGATNPVDATPGTIRGDFCIEVGKNVIHGSDSVE 142

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 143 SARREIALWFRADELL 158


>gi|294464762|gb|ADE77887.1| unknown [Picea sitchensis]
          Length = 268

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T+ MIKPD V+R L+G I+   E  G  +   K      + AE+ Y   K + FFP+
Sbjct: 120 VQQTYIMIKPDGVQRGLVGEIISRFEHKGFTLKGLKLFQCPTELAEEHYRDLKSKSFFPK 179

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV     +G   ++  R+++G T+P +A  GTIR    I +G N +HGSDS 
Sbjct: 180 LVKYITSGPVVCMAWEGPGIVAAARKLIGATNPLQAEPGTIRGDLAIQVGRNVVHGSDSQ 239

Query: 123 KTALEEISYWFARNEII 139
           +    E++ WF   E+ 
Sbjct: 240 ENGQREVALWFKDGELC 256


>gi|262274791|ref|ZP_06052602.1| nucleoside diphosphate kinase [Grimontia hollisae CIP 101886]
 gi|262221354|gb|EEY72668.1| nucleoside diphosphate kinase [Grimontia hollisae CIP 101886]
          Length = 143

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAVKRNLIG+I + +E  GL +VAAK   + ++QA+ FY  H+ +PF+
Sbjct: 1   MTVERTFSIVKPDAVKRNLIGAIYQRIETAGLQIVAAKMLHLTKEQAQGFYAEHEGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+G +AI + RE+MG T+P +A  GT+R  +  S+  NS+HGSD
Sbjct: 61  EGLVAFMTSGPVMVQVLEGRDAIIRYRELMGKTNPDEAACGTLRADFAESMSFNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+ +EI 
Sbjct: 121 SPASAEREIAYFFSADEIC 139


>gi|225024691|ref|ZP_03713883.1| hypothetical protein EIKCOROL_01573 [Eikenella corrodens ATCC
           23834]
 gi|224942580|gb|EEG23789.1| hypothetical protein EIKCOROL_01573 [Eikenella corrodens ATCC
           23834]
          Length = 141

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAAK   ++R++AE FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGKIYSRFESNGLKIVAAKMKHLSREEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL++ M SGPV +QVL+GE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  AELMKFMTSGPVMVQVLEGENAVAKNRELMGATNPKEAAPGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL  A  E++Y+F   EI 
Sbjct: 121 SLVNAAIEVAYFFGEQEIC 139


>gi|144900584|emb|CAM77448.1| Nucleoside diphosphate kinase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 140

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 99/140 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA +RNL G I    E+ GL +VA K   + ++QAE FY +H++R FF
Sbjct: 1   MATERTLSIIKPDATRRNLTGKINARFEENGLRIVAQKRVRLTKEQAEAFYGVHRERSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGPV +QVL+GE A+ KNRE+MG T+P  A  GTIR  +  S+  NS+HGSD
Sbjct: 61  GELVSFMISGPVVVQVLEGENAVLKNREIMGATNPANAAAGTIRADFAESVEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+Y+FA++EI+G
Sbjct: 121 SAENAATEIAYFFAQSEIVG 140


>gi|324531155|gb|ADY49137.1| Nucleoside diphosphate kinase [Ascaris suum]
          Length = 200

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPDAV+R LIG ++   E+ G  +V  K     R   E  Y   KD+PFF  L
Sbjct: 53  ERTFIAIKPDAVQRGLIGKVIARFEERGYKLVGMKMVHATRPHLEVHYQELKDKPFFKTL 112

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G + + + R ++G T+P  +  GTIR  Y I  G N +HGSDSL+
Sbjct: 113 IDYMSSGPVVAMVWEGLDVVKQGRLMLGATNPLASNPGTIRGDYSIQTGRNIVHGSDSLE 172

Query: 124 TALEEISYWFARNEII 139
           +A  EI++WF   E+I
Sbjct: 173 SAKREIAHWFKNEELI 188


>gi|324105227|gb|ADY18376.1| nucleoside diphosphate kinase [Glycera tridactyla]
          Length = 148

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 80/135 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G I+K  E  G  +VA KF     +  +  Y     +PFF  L
Sbjct: 1   EQTFIMIKPDGVQRGLVGDIIKRFEQRGFRLVAMKFTQAKEEHLKKHYEDLASKPFFGGL 60

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G+  ++  R ++G+T+P  +  GTIR  Y I IG N  HGSDS++
Sbjct: 61  VKYMASGPLVPMVWEGKGVVTTGRVMLGETNPADSKPGTIRGDYCIEIGRNICHGSDSVE 120

Query: 124 TALEEISYWFARNEI 138
           +A +EI  WF   E+
Sbjct: 121 SAKKEIKLWFTDAEL 135


>gi|294862567|gb|ADF45668.1| nucleoside diphosphate kinase 1 [Solanum tuberosum]
          Length = 238

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +VA K    +++ A+  Y    +RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIVSRFERKGFKLVAIKVVIPSKEFAKKHYHDLSERPFFNG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 148 LCDFLSSGPVLAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 208 ETAKDEINLWFKPEELV 224


>gi|257480837|gb|ACV60545.1| nucleoside diphosphate kinase [Solanum tuberosum]
          Length = 238

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +VA K    +++ A+  Y    +RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIVSRFERKGFKLVAIKVVIPSKEFAKKHYHDLSERPFFNG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 148 LCDFLSSGPVLAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 208 ETAKDEINLWFKPEELV 224


>gi|282896655|ref|ZP_06304663.1| Nucleoside diphosphate kinase [Raphidiopsis brookii D9]
 gi|281198373|gb|EFA73261.1| Nucleoside diphosphate kinase [Raphidiopsis brookii D9]
          Length = 163

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 88/138 (63%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+TF  IKPD V+R L G I++  E  G  +V  KF  ++++ AE  Y +HK+RPFF 
Sbjct: 13  ALERTFIAIKPDGVQRGLAGEIIRRFETKGFTLVGLKFMKVSKELAEQHYDVHKERPFFA 72

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ + SGPV   V +GE  +   R+++G T+P  +  GTIR  +GI+IG N IHGSD+
Sbjct: 73  SLVEFITSGPVVAMVWQGEGVVPSARKIIGATNPLTSEPGTIRGDFGINIGRNLIHGSDA 132

Query: 122 LKTALEEISYWFARNEII 139
            +TA  EIS WF   E++
Sbjct: 133 PETAQREISLWFKEEELV 150


>gi|99080798|ref|YP_612952.1| nucleoside diphosphate kinase [Ruegeria sp. TM1040]
 gi|119372153|sp|Q1GI26|NDK_SILST RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|99037078|gb|ABF63690.1| nucleoside diphosphate kinase [Ruegeria sp. TM1040]
          Length = 140

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 103/140 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G+I  + E+ GL +VA K   M + QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGAINAKFEEAGLRIVAQKRIHMTKAQAGKFYAVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNRE+MG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMSSAPVVVQVLEGEGAIAKNREIMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+Y+F+  E++G
Sbjct: 121 APETAAEEIAYFFSGLELVG 140


>gi|325296958|ref|NP_001191671.1| nucleoside diphosphate kinase A [Equus caballus]
          Length = 152

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R+L+G I+K  E  G  +VA KF   +    ++ Y   KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYNDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSME 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFQPEELV 140


>gi|146198450|dbj|BAF57896.1| c-myc transcription factor [Sus scrofa]
          Length = 152

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 86/136 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP L
Sbjct: 5   ERTFIAVKPDGVQRGLVGEIIKRFEQKGFRLVALKFLQASEELLKQHYIDLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR ++ I +G N IHGSDS+K
Sbjct: 65  VKYMGSGPVVAMVWEGLNVLKTGRVMLGETNPADSKPGTIRGEFCIQVGRNIIHGSDSVK 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SAEKEISLWFKPEELV 140


>gi|315633884|ref|ZP_07889173.1| nucleoside diphosphate kinase [Aggregatibacter segnis ATCC 33393]
 gi|315477134|gb|EFU67877.1| nucleoside diphosphate kinase [Aggregatibacter segnis ATCC 33393]
          Length = 141

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAVKR+LIG+I+   E  G  V+AAK     ++QAE FY  H+ +PFF
Sbjct: 1   MSLQRTLSIIKPDAVKRHLIGAILARFEQQGFKVIAAKMVHFTQEQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MIS PVF+ VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSD
Sbjct: 61  APLVEYMISAPVFVSVLEKENAVQDYRTLIGTTNPETAAEGTIRRDFALSQRENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SPESAAREIAYFFVDDEIC 139


>gi|77362061|ref|YP_341635.1| nucleoside diphosphate kinase [Pseudoalteromonas haloplanktis
           TAC125]
 gi|92090393|sp|Q3ID15|NDK_PSEHT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|76876972|emb|CAI89189.1| nucleoside diphosphate kinase [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 143

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV +N IG+I    E  GL +VAAK   +++++AE FY  H +RPFF
Sbjct: 1   MALERTFSIVKPDAVAKNHIGAIYNRFETAGLKIVAAKMVHLSQEKAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV + VL+GE A+ KNRE+MG T+P  AL GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVTVLEGENAVLKNREIMGATNPADALAGTLRADYADSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+FA  E+ 
Sbjct: 121 AVESAAREIAYFFADEELC 139


>gi|2498076|sp|Q96559|NDK_HELAN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|1619958|gb|AAB67996.1| nucleoside diphosphate kinase [Helianthus annuus]
          Length = 148

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 81/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   +++  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIIGRFEKKGFTLKGLKLLTVDQAFAEKHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD++
Sbjct: 61  LVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESPPGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI  WF  
Sbjct: 121 ESAKKEIGLWFPE 133


>gi|163739698|ref|ZP_02147106.1| nucleoside diphosphate kinase [Phaeobacter gallaeciensis BS107]
 gi|163743169|ref|ZP_02150551.1| nucleoside diphosphate kinase [Phaeobacter gallaeciensis 2.10]
 gi|161383586|gb|EDQ07973.1| nucleoside diphosphate kinase [Phaeobacter gallaeciensis 2.10]
 gi|161386928|gb|EDQ11289.1| nucleoside diphosphate kinase [Phaeobacter gallaeciensis BS107]
          Length = 140

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + ED GL +VA K   + + QA +FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEDAGLRIVAQKRIHLTKAQAGEFYAVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPIVAQVLEGENAIAKNREVMGATNPADAAAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|194707740|gb|ACF87954.1| unknown [Zea mays]
 gi|195605280|gb|ACG24470.1| nucleoside diphosphate kinase 2 [Zea mays]
          Length = 222

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+++ MIKPD V+R L+G I+   E  G  +   K     +  A++ Y   KD+PFFP+
Sbjct: 74  VEQSYIMIKPDGVQRGLVGEIISRFEKKGFLLKGLKLFQCPKDLAQEHYKDLKDKPFFPK 133

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPV     +G+  ++  R+++G T+P +A  GTIR    +  G N +HGSDS 
Sbjct: 134 LIDYITSGPVVCMAWEGDGVVASARKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 193

Query: 123 KTALEEISYWFARNEII 139
                EI  WF   E+ 
Sbjct: 194 DNGKREIELWFKEGEVC 210


>gi|222632788|gb|EEE64920.1| hypothetical protein OsJ_19780 [Oryza sativa Japonica Group]
          Length = 239

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    +++ A+  Y   KDRPFF  
Sbjct: 89  MERTFIAIKPDGVQRGLISEILSRFERKGFKLVAIKLVVPSKEFAQKHYHDLKDRPFFNG 148

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 149 LCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 208

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI  WF   E++
Sbjct: 209 ETAKAEIGLWFEPRELV 225


>gi|115465831|ref|NP_001056515.1| Os05g0595400 [Oryza sativa Japonica Group]
 gi|55733879|gb|AAV59386.1| putative nucleoside diphosphate kinase [Oryza sativa Japonica
           Group]
 gi|57900667|gb|AAW57792.1| putative nucleoside diphosphate kinase [Oryza sativa Japonica
           Group]
 gi|113580066|dbj|BAF18429.1| Os05g0595400 [Oryza sativa Japonica Group]
 gi|215692731|dbj|BAG88151.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215694755|dbj|BAG89946.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 239

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    +++ A+  Y   KDRPFF  
Sbjct: 89  MERTFIAIKPDGVQRGLISEILSRFERKGFKLVAIKLVVPSKEFAQKHYHDLKDRPFFNG 148

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 149 LCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 208

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI  WF   E++
Sbjct: 209 ETAKAEIGLWFEPRELV 225


>gi|18977303|ref|NP_578660.1| nucleoside diphosphate kinase [Pyrococcus furiosus DSM 3638]
 gi|22095925|sp|Q8U2A8|NDK_PYRFU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|18892974|gb|AAL81055.1| nucleoside diphosphate kinase (ndk) [Pyrococcus furiosus DSM 3638]
          Length = 161

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  +IKPDAV R LIG I+   E  GL +V  K  W++R+ AE  Y  HK +PFF  
Sbjct: 4   VERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHKGKPFFEA 63

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   PV + V++G  A+   R++ G TDPK A  GTIR  YG+ IG+   N IH S
Sbjct: 64  LIDYITKAPVVVMVVEGRYAVEVVRKMAGATDPKDAAPGTIRGDYGLDIGDAIYNVIHAS 123

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EIS +F   EI
Sbjct: 124 DSKESAEREISLYFKPEEI 142


>gi|47211278|emb|CAF90396.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 144

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  +KPD V+R ++G I+K  E  G  +VA K    +     + Y+  KDRPFFP+
Sbjct: 5   LERTFIAVKPDGVQRGIVGEIIKRFEVKGFKLVAMKMVQASEDLLMNHYIDLKDRPFFPQ 64

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV   V +G+  +   R ++G+TDP K+  GTIR  + I + +N IHGSDS+
Sbjct: 65  LVKYMSSGPVVAMVWEGKGVVKTGRVMLGETDPAKSSPGTIRGDFCIDVSKNIIHGSDSV 124

Query: 123 KTALEEISYWFARNEII 139
           ++A +EIS WF   E++
Sbjct: 125 ESANKEISLWFQEGELV 141


>gi|57866982|ref|YP_188614.1| nucleoside diphosphate kinase [Staphylococcus epidermidis RP62A]
 gi|282876099|ref|ZP_06284966.1| nucleoside diphosphate kinase [Staphylococcus epidermidis SK135]
 gi|38257852|sp|Q8CSI0|NDK_STAES RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67460609|sp|Q5HP76|NDK_STAEQ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|57637640|gb|AAW54428.1| nucleoside diphosphate kinase [Staphylococcus epidermidis RP62A]
 gi|281295124|gb|EFA87651.1| nucleoside diphosphate kinase [Staphylococcus epidermidis SK135]
 gi|329725363|gb|EGG61846.1| nucleoside pyrophosphate kinase [Staphylococcus epidermidis VCU144]
 gi|329735215|gb|EGG71507.1| nucleoside pyrophosphate kinase [Staphylococcus epidermidis VCU045]
 gi|329737389|gb|EGG73643.1| nucleoside pyrophosphate kinase [Staphylococcus epidermidis VCU028]
          Length = 149

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  GL +V  KF  +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIEKKGLKLVGGKFMQVPMELAEKHYSEHEGKPFYDK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++ +R+++G T+P +A  GTIR  YG+++G N IHGSDS 
Sbjct: 61  LISFITSAPVFAMVVEGENAVAVSRKIIGSTNPSEAAPGTIRGDYGLNLGRNIIHGSDST 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  E+  WF  +EI
Sbjct: 121 ESAQREVKLWFTSSEI 136


>gi|224058260|ref|XP_002299472.1| predicted protein [Populus trichocarpa]
 gi|222846730|gb|EEE84277.1| predicted protein [Populus trichocarpa]
          Length = 237

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    ++  A+  Y   K RPFF  
Sbjct: 87  LERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKDFAQKHYHDLKTRPFFDG 146

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 147 LCDFLSSGPVVAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 206

Query: 123 KTALEEISYWFARNEII 139
           +TA EE++ WF   E++
Sbjct: 207 ETAKEEVNLWFKPEELV 223


>gi|1246364|gb|AAA93513.1| thymidylate:zeocin resistance protein:NDP kinase fusion protein
           [Cloning vector pZEO-SG4]
          Length = 494

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 352 MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 411

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 412 DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 471

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 472 SVESAAREIAYFFGEGEVC 490


>gi|21832064|dbj|BAC05487.1| nucloside diphosphate kinase 2 [Brassica rapa]
          Length = 230

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD ++R L+G I+   E  G  ++  K     R+ AE+ Y     + FF  
Sbjct: 82  VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPRELAEEHYKDLSSKSFFSS 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 142 LIEYITSGPVVCMAWEGVGVVASARKMIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 202 ENGKREIALWFKEGELC 218


>gi|315123121|ref|YP_004065127.1| nucleoside diphosphate kinase [Pseudoalteromonas sp. SM9913]
 gi|315016881|gb|ADT70218.1| nucleoside diphosphate kinase [Pseudoalteromonas sp. SM9913]
          Length = 143

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV +N IG+I    E  GL +VAAK   +++++AE FY  H +RPFF
Sbjct: 1   MALERTFSIVKPDAVAKNHIGAIYNRFETAGLKIVAAKMVHLSQEKAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV + VL+GE A+ KNRE+MG T+P +AL GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVTVLEGENAVLKNREIMGATNPAEALAGTLRADYADSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+FA  E+ 
Sbjct: 121 AVESAAREIAYFFADEELC 139


>gi|37928159|pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A
           Complexed With Adp At 2 A Resolution
 gi|37928160|pdb|1UCN|B Chain B, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A
           Complexed With Adp At 2 A Resolution
 gi|37928161|pdb|1UCN|C Chain C, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A
           Complexed With Adp At 2 A Resolution
          Length = 152

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRP+F  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPWFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N I GSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIGGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAEKEIGLWFHPEELV 140


>gi|134298006|ref|YP_001111502.1| nucleoside diphosphate kinase [Desulfotomaculum reducens MI-1]
 gi|172044209|sp|A4J0S4|NDK_DESRM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|134050706|gb|ABO48677.1| nucleoside diphosphate kinase [Desulfotomaculum reducens MI-1]
          Length = 149

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG I+ + E  G  +V  K   ++R+ AE  Y  H  +PFF  
Sbjct: 1   MERTYLMVKPDGVQRGLIGQIISKFEQKGYKIVGLKMMQISREVAERHYGEHAGKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V++G++ ++  RE+MG T+P KA  GTIR  +G+ +G N IHGSDSL
Sbjct: 61  LVDFITSGPVVAMVIEGKDVVTTAREMMGATNPLKAAPGTIRATFGVDVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F   E+I
Sbjct: 121 ESAQREIGIFFKSEELI 137


>gi|321452882|gb|EFX64180.1| hypothetical protein DAPPUDRAFT_93797 [Daphnia pulex]
          Length = 144

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 78/131 (59%)

Query: 9   MIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMI 68
           MIKPD V+R L+G I+K  E  G  +VA KF     +  +  Y     RPFF  LV+ M 
Sbjct: 1   MIKPDGVQRGLVGEIIKRFEQKGFKLVALKFVQPTEEMLQKHYADLSGRPFFAGLVKYMA 60

Query: 69  SGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEE 128
           SGPV   V +G   +   R+++G+T+P  +  GTIR  + I +G N +HGSDS+++A +E
Sbjct: 61  SGPVVAMVWEGLNIVKTGRQMLGETNPADSKPGTIRGDFCIQVGRNIMHGSDSVESANKE 120

Query: 129 ISYWFARNEII 139
           I+ WF   E++
Sbjct: 121 IALWFKDEELV 131


>gi|302136424|gb|ADK94169.1| nucleoside diphosphate kinase [Eriocheir sinensis]
          Length = 151

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 77/138 (55%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           MV E+TF  +KPD V+R L G I+K  E  G  +V  KF        +  Y    D+PF+
Sbjct: 1   MVRERTFIAVKPDGVQRGLTGEIIKRFEAKGFKLVGMKFMQATEDHLKKHYADLADKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+     +G   +   R +MG+T P  +  GTIR  + I +G N IHGSD
Sbjct: 61  PGLCKYMSSGPLVAMCWEGTGVVKTARTMMGETRPADSKPGTIRGDFCIEVGRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A +E++ WF   E+
Sbjct: 121 SVESANKEVALWFKPEEL 138


>gi|302786506|ref|XP_002975024.1| hypothetical protein SELMODRAFT_174713 [Selaginella moellendorffii]
 gi|300157183|gb|EFJ23809.1| hypothetical protein SELMODRAFT_174713 [Selaginella moellendorffii]
          Length = 173

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 77/136 (56%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T+ M+KPD V+R L+G I+   E  G  +   K     +  A+  Y   +++PFFP+L
Sbjct: 26  EQTYVMVKPDGVQRGLVGEIISRFERKGFRLAGLKMFQCPKDLAKKHYEELQEKPFFPKL 85

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ + SGPV     +G   ++  R+++G T+P +A  GTIR    +++G N IHGSDS+ 
Sbjct: 86  VKYITSGPVVCMAWEGPGVVASARKLIGSTNPLQAEPGTIRGDLAVAVGRNVIHGSDSVA 145

Query: 124 TALEEISYWFARNEII 139
               EI  WF   E+ 
Sbjct: 146 NGEREIGLWFGEAELC 161


>gi|237756032|ref|ZP_04584613.1| nucleoside diphosphate kinase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691799|gb|EEP60826.1| nucleoside diphosphate kinase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 138

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 97/138 (70%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  + KPDAV++N++G I+  LED G  +VA K   +  +QA  FY++HKDRPF+ E
Sbjct: 1   MERTLVIAKPDAVRKNVVGKIISRLEDEGFKLVALKKVKLTNEQAGQFYIVHKDRPFYGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   M SGP+   V +GE  I++ RE+MG TDP KA +GT+R  YG ++GEN++HGSDS 
Sbjct: 61  LCDFMSSGPIVPMVWEGENVIARVREIMGATDPSKAAEGTLRKLYGTNVGENAVHGSDSP 120

Query: 123 KTALEEISYWFARNEIIG 140
           ++A  EI ++F+  E++G
Sbjct: 121 ESAAYEIPFFFSGIELVG 138


>gi|187125208|ref|NP_001119656.1| abnormal wing discs 2 [Acyrthosiphon pisum]
 gi|89473730|gb|ABD72677.1| abnormal wing disks-like protein [Acyrthosiphon pisum]
 gi|239788505|dbj|BAH70928.1| ACYPI000028 [Acyrthosiphon pisum]
          Length = 154

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 86/136 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V+R L+G I+K  E  G  +VA KF W + +  ++ Y     + FFP L
Sbjct: 7   ERTFIMIKPDGVQRGLVGKIIKRFETKGFKLVAMKFLWPSEELLKNHYADLSGKAFFPGL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G +A+   R ++G TDPK +  GTIR    I +G N IHGSD+++
Sbjct: 67  IKYMASGPVVPMVWEGLDAVKTGRFILGATDPKNSNPGTIRGDLCIQVGRNIIHGSDAVE 126

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF+  E++
Sbjct: 127 SANKEIALWFSEKEVV 142


>gi|330830072|ref|YP_004393024.1| nucleoside diphosphate kinase [Aeromonas veronii B565]
 gi|328805208|gb|AEB50407.1| Nucleoside diphosphate kinase [Aeromonas veronii B565]
          Length = 142

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAV +NLIG+I    E  GL VVA+K   M+ +QA  FY  H+ +PF+
Sbjct: 1   MAIERTFSIVKPDAVSKNLIGAIYSRFESAGLKVVASKMLHMSSEQAAGFYAEHQGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE+AI +NRE+MG T+PK+AL GT+R  Y  SI  N++HGSD
Sbjct: 61  DNLVSFMTSGPVMVQVLEGEDAIRRNREIMGATNPKEALAGTLRACYAESIDRNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +  +A  EI+Y+F+ NEI 
Sbjct: 121 APASAAREIAYFFSDNEIC 139


>gi|110834725|ref|YP_693584.1| nucleoside-diphosphate kinase [Alcanivorax borkumensis SK2]
 gi|119372017|sp|Q0VND6|NDK_ALCBS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|110647836|emb|CAL17312.1| nucleoside-diphosphate kinase [Alcanivorax borkumensis SK2]
          Length = 143

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG IV   E  GL VVA K   ++ ++A  FY  HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEIVTRFEKAGLSVVAMKMVHLSDEKAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE+A++KNR++MG T+PK+A  GTIR  +  +I  N++HGSD
Sbjct: 61  KDLVGFMTSGPVVVQVLEGEDAVAKNRDLMGATNPKEAEAGTIRADFAETIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  E++Y+F+  E+ 
Sbjct: 121 STESAAREVAYFFSDEEVC 139


>gi|24373827|ref|NP_717870.1| nucleoside diphosphate kinase [Shewanella oneidensis MR-1]
 gi|38372280|sp|Q8EEU0|NDK_SHEON RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|24348228|gb|AAN55314.1|AE015669_2 nucleoside diphosphate kinase [Shewanella oneidensis MR-1]
          Length = 143

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL +VAAK   + ++QAE FY  H +R FF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVAAKMLHLTKEQAEGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  +RE++G T+P +A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAQSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL +A  EI+Y+F+  E+ 
Sbjct: 121 SLASAEREIAYFFSAEELC 139


>gi|117926272|ref|YP_866889.1| nucleoside diphosphate kinase [Magnetococcus sp. MC-1]
 gi|117610028|gb|ABK45483.1| nucleoside diphosphate kinase [Magnetococcus sp. MC-1]
          Length = 159

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 65/139 (46%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N++G I    E  GL ++A+K   +  + A  FY +HK RPF+
Sbjct: 18  MTIERTFSIIKPDAVAKNVVGEIQSRFEKAGLRIIASKMIRLTPEIAGKFYEVHKARPFY 77

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +L   M SGPV +QVL+G+ A+ KNR++MG T+PK A  GTIR  +  SI  N++HGSD
Sbjct: 78  NDLCSYMSSGPVVVQVLEGDGAVLKNRDIMGATNPKDAAPGTIRADFAESIDANAVHGSD 137

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA +EI+++F+  E+ 
Sbjct: 138 APETAAQEIAFFFSGTELC 156


>gi|290979720|ref|XP_002672581.1| nucleoside diphosphate kinase [Naegleria gruberi]
 gi|284086159|gb|EFC39837.1| nucleoside diphosphate kinase [Naegleria gruberi]
          Length = 151

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPDAV+R LIG I+   E  G  +VA K      + A   Y  H  +PFF
Sbjct: 1   MSSERTFIALKPDAVQRGLIGPIITRFEQKGFKLVAMKLITPTAELASKHYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ + SGPV   V +G+  I+  R+++G T P ++  GTIR  + I++G N IHGSD
Sbjct: 61  AGLVEFLTSGPVCAMVWEGQGVIAAARKLIGVTKPLESAPGTIRGDFAINVGRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S  +A  EI+ WF   EI
Sbjct: 121 STTSAEAEIALWFKPEEI 138


>gi|226088575|dbj|BAH37032.1| nucleoside diphosphate kinase 2 [Pisum sativum]
          Length = 230

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++ + M+KPD V+R L+G I+   E  G  +   K    +++ AE+ Y     + FFP+
Sbjct: 82  VDQAYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCSKELAEEHYKHLNQKSFFPK 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   +   R+++G TDP +A  GTIR  + +  G N IHGSDS 
Sbjct: 142 LIEYITSGPVVSMAWEGVGIVPSARKLIGATDPLQAEPGTIRGDFAVQTGRNIIHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 202 ENGKREIALWFKEGELC 218


>gi|332534668|ref|ZP_08410499.1| nucleoside diphosphate kinase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332035880|gb|EGI72362.1| nucleoside diphosphate kinase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 143

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDAV +N IG+I    E  GL +VAAK   +++++AE FY  H +RPFF
Sbjct: 1   MALERTFSIVKPDAVAKNHIGAIYNRFETAGLKIVAAKMVHLSQEKAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV + VL+GE A+ KNRE+MG T+P +AL GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPVMVTVLEGENAVLKNREIMGATNPAEALAGTLRADYADSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+FA  E+ 
Sbjct: 121 AVESAAREIAYFFADEELC 139


>gi|225719608|gb|ACO15650.1| Nucleoside diphosphate kinase B [Caligus clemensi]
          Length = 152

 Score =  176 bits (448), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPD V R LIG IVK  E  G  +VA KF   + +     Y     +PFF  L
Sbjct: 5   ERTFIMIKPDGVHRGLIGDIVKRFEQKGFKLVAMKFMQASIEHLRKHYADLSSKPFFEGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G  A+   R ++G+T+PK +  GTIR  + + IG N  HGSD+++
Sbjct: 65  VKYMASGPVLTMVWEGLNAVKTGRVMLGETNPKDSAPGTIRGDFCVQIGRNICHGSDAVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF  +E++
Sbjct: 125 SAEKEIALWFTPDELV 140


>gi|328876823|gb|EGG25186.1| nucleoside diphosphate kinase [Dictyostelium fasciculatum]
          Length = 161

 Score =  176 bits (447), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V R L+G I+   +  G  +V  K    ++  AE  Y  HK+RPFF  L
Sbjct: 5   ERTFIAIKPDGVARGLVGEIISRFQRKGYTLVGLKQVVPSKDLAESHYEEHKERPFFSGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+ +I+  R ++G T+P  +  GTIR  +G+ +G N IHGSDS  
Sbjct: 65  VSFITSGPVVAMVWEGKGSIAMARAMIGATNPLASAPGTIRGDFGVDVGRNIIHGSDSAD 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 125 SAKREIALWFKSCELL 140


>gi|302692498|ref|XP_003035928.1| hypothetical protein SCHCODRAFT_74436 [Schizophyllum commune H4-8]
 gi|300109624|gb|EFJ01026.1| hypothetical protein SCHCODRAFT_74436 [Schizophyllum commune H4-8]
          Length = 151

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 54/139 (38%), Positives = 82/139 (58%), Gaps = 1/139 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M + E+T+ MIKPD V+R L+G I++  E+ G  +VA K    + +  E  Y     +PF
Sbjct: 1   MSVNERTYIMIKPDGVQRGLVGKIIQRFEERGFKLVAMKLVHASVEHLEKHYGDLAGKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G +A+   R ++G T+P  +  G+IR  + +++G N  HGS
Sbjct: 61  FPGLVKYMASGPVVAMVWQGLDAVKTGRSMLGATNPLASAPGSIRGDFALAVGRNICHGS 120

Query: 120 DSLKTALEEISYWFARNEI 138
           DS++ A +EI  WF    I
Sbjct: 121 DSVENAEKEIKLWFPEGTI 139


>gi|289207916|ref|YP_003459982.1| nucleoside-diphosphate kinase [Thioalkalivibrio sp. K90mix]
 gi|288943547|gb|ADC71246.1| Nucleoside-diphosphate kinase [Thioalkalivibrio sp. K90mix]
          Length = 143

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E  GL +VAA+   ++R+QAE FY +HK+RPFF
Sbjct: 1   MAAERTLSIIKPDAVAKNVIGEIYSRFEKAGLQIVAARMMQLSREQAEGFYDVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE AI+KNRE+MG T+PK+A  GTIR  +  SI EN++HGSD
Sbjct: 61  NDLVEFMISGPVMVQVLEGEGAIAKNREIMGATNPKEAAPGTIRADFATSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA  EI ++F  + + 
Sbjct: 121 AAETAAREIEFFFGNDGVC 139


>gi|197128291|gb|ACH44789.1| putative nucleoside diphosphate kinase variant 1 [Taeniopygia
           guttata]
          Length = 153

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRPFFP L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFVHASEDLLKQHYIDLKDRPFFPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+ 
Sbjct: 66  VKYMNSGPIVAMVWEGLNVVKTVRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVG 125

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E+I
Sbjct: 126 SAQKEINLWFKPAELI 141


>gi|152990144|ref|YP_001355866.1| nucleoside-diphosphate kinase [Nitratiruptor sp. SB155-2]
 gi|166232992|sp|A6Q200|NDK_NITSB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|151422005|dbj|BAF69509.1| nucleoside-diphosphate kinase [Nitratiruptor sp. SB155-2]
          Length = 137

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 99/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV +N+IG I+   E  GL + A K   +++  A  FY +HK+RPFF +
Sbjct: 1   MERTLSIIKPDAVAKNVIGKIIDRFETNGLRIAAMKKIQLSKNDAAKFYEVHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV + VL+GE A++KNRE+MG TDPK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDYMTSGPVVVMVLEGENAVAKNRELMGATDPKEAKPGTIRADFAESIEANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A +EI+++FA+ EI+
Sbjct: 121 ENAQKEIAFFFAQREIL 137


>gi|50424677|ref|XP_460928.1| DEHA2F12980p [Debaryomyces hansenii CBS767]
 gi|49656597|emb|CAG89282.1| DEHA2F12980p [Debaryomyces hansenii]
          Length = 152

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LI SI+   E+ G  +V  K          + Y   + +PFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLINSILGRFENRGYKLVGIKLVQPTESLLREHYDDLQSKPFFPSL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M+SGPV   V +G++ + + R ++G T+P ++  GTIR  + + +G N  HGSDS++
Sbjct: 65  LSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAVDMGRNVCHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF + E++
Sbjct: 125 SAEKEIGLWFKKEELV 140


>gi|226088573|dbj|BAH37031.1| nucleoside diphosphate kinase 2 [Pisum sativum]
          Length = 230

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++ + M+KPD V+R L+G I+   E  G  +   K    +++ AE+ Y     + FFP+
Sbjct: 82  VDQAYIMVKPDGVQRGLVGEIISRFEKKGFKLTGLKLFQCSKELAEEHYKHLNQKSFFPK 141

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   +   R+++G TDP +A  GTIR  + +  G N IHGSDS 
Sbjct: 142 LIEYITSGPVVSMAWEGVGIVPSARKLIGATDPLQAEPGTIRGDFAVQTGRNIIHGSDSP 201

Query: 123 KTALEEISYWFARNEII 139
           +    EI+ WF   E+ 
Sbjct: 202 ENGEREIALWFKEGELC 218


>gi|302333079|gb|ADL23272.1| nucleoside diphosphate kinase superfamily [Staphylococcus aureus
           subsp. aureus JKD6159]
          Length = 149

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 94/136 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG ++  +E  GL +V AK   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGAKLMQVPMELAETHYGEHQGKPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF  NEI
Sbjct: 121 ESAEREINLWFNENEI 136


>gi|297564608|ref|YP_003683580.1| Nucleoside-diphosphate kinase [Meiothermus silvanus DSM 9946]
 gi|296849057|gb|ADH62072.1| Nucleoside-diphosphate kinase [Meiothermus silvanus DSM 9946]
          Length = 138

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 88/138 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L G I+  +E  G  +VA K   ++++ AE  Y  HK +PFF  
Sbjct: 1   MERTYIMVKPDGVRRGLTGEIISRIERKGFKIVAMKKMLISQQTAETHYGEHKGKPFFEG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V++G +A+S+ R +MG T P +A  GTIR  Y  ++ EN IHGSDS 
Sbjct: 61  LVRFITSGPVVAMVVEGPQAVSEMRRLMGATRPWEAAPGTIRADYATTVDENVIHGSDSP 120

Query: 123 KTALEEISYWFARNEIIG 140
           ++A  EI  +F   EIIG
Sbjct: 121 ESAAREIGIFFKPEEIIG 138


>gi|90579369|ref|ZP_01235179.1| nucleoside diphosphate kinase [Vibrio angustum S14]
 gi|90440202|gb|EAS65383.1| nucleoside diphosphate kinase [Vibrio angustum S14]
          Length = 143

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 105/139 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAVKRNLIG+I +  E+ GL +VAAK   ++  +A+ FY  H+ +PFF
Sbjct: 1   MTIERTFSIVKPDAVKRNLIGAIYQRFENAGLNIVAAKMLHLDSAKAQGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI++ RE+MG T+P++A  GTIR+ + +S+  NS+HGSD
Sbjct: 61  DDLVAFMTSGPVMVQVLEGENAITRYRELMGKTNPEEAACGTIRSDFALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA +EI 
Sbjct: 121 SPESAAREIAYFFAEDEIC 139


>gi|50306511|ref|XP_453229.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642363|emb|CAH00325.1| KLLA0D03696p [Kluyveromyces lactis]
          Length = 152

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R LI  I+   ED G  +V  K         ++ Y     +PF
Sbjct: 1   MSNTERTFIAIKPDGVQRGLISKILARFEDRGYKLVGIKLVTPTEALLKEHYADLVSKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP L+  M SGPV   V +G++ + + R ++G T+P ++  GTIR  + I +G N  HGS
Sbjct: 61  FPSLLSYMTSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIEVGRNVCHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +EI  WF + E+I
Sbjct: 121 DSVESAEKEIGLWFKKEELI 140


>gi|225713076|gb|ACO12384.1| Nucleoside diphosphate kinase A 1 [Lepeophtheirus salmonis]
          Length = 415

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 86/135 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPDAV+R+LIG ++K  E  G  ++A KF   ++   E  Y+  + +PFF +L
Sbjct: 58  ERTFIMLKPDAVQRSLIGEVIKRFETRGFKLIALKFMRASKSLLEQHYIDLEKKPFFRDL 117

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G + +   R ++G T+P  +  GTIR  + + IG N IHGSDS +
Sbjct: 118 VEYMSSGPLVPMVWEGLDVVKLGRAMLGATNPFDSSPGTIRGDFCLDIGRNIIHGSDSTE 177

Query: 124 TALEEISYWFARNEI 138
            A +EIS WF+ NE+
Sbjct: 178 AASKEISLWFSPNEL 192


>gi|15599002|ref|NP_252496.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa PAO1]
 gi|107103327|ref|ZP_01367245.1| hypothetical protein PaerPA_01004396 [Pseudomonas aeruginosa PACS2]
 gi|116051832|ref|YP_789325.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152987482|ref|YP_001346691.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa PA7]
 gi|218889909|ref|YP_002438773.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa LESB58]
 gi|254236711|ref|ZP_04930034.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa C3719]
 gi|254242497|ref|ZP_04935819.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa 2192]
 gi|296387678|ref|ZP_06877153.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa PAb1]
 gi|313109225|ref|ZP_07795193.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa 39016]
 gi|12230891|sp|Q59636|NDK_PSEAE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|122260979|sp|Q02RW1|NDK_PSEAB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166233004|sp|A6V0V6|NDK_PSEA7 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729845|sp|B7UWI4|NDK_PSEA8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|9949980|gb|AAG07194.1|AE004798_17 nucleoside diphosphate kinase [Pseudomonas aeruginosa PAO1]
 gi|115587053|gb|ABJ13068.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168642|gb|EAZ54153.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa C3719]
 gi|126195875|gb|EAZ59938.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa 2192]
 gi|150962640|gb|ABR84665.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa PA7]
 gi|218770132|emb|CAW25894.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa LESB58]
 gi|310881695|gb|EFQ40289.1| nucleoside diphosphate kinase [Pseudomonas aeruginosa 39016]
          Length = 143

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV +N+IG I+   E  GL VVAAK   ++ ++A  FY  HK+RPFF
Sbjct: 1   MALQRTLSIIKPDAVSKNVIGEILTRFEKAGLRVVAAKMVQLSEREAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE+AI+KNRE+MG TDPKKA  GTIR  + +SI EN++HGSD
Sbjct: 61  KDLVSFMTSGPVVVQVLEGEDAIAKNRELMGATDPKKADAGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+FA  E+ 
Sbjct: 121 SEASAAREIAYFFAATEVC 139


>gi|126136631|ref|XP_001384839.1| nucleoside diphosphate kinase [Scheffersomyces stipitis CBS 6054]
 gi|126092061|gb|ABN66810.1| nucleoside diphosphate kinase [Scheffersomyces stipitis CBS 6054]
          Length = 152

 Score =  176 bits (447), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LI SI+   E+ G  +V  K          + Y   + +PFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLISSIIGRFENRGFKLVGIKLVQPTESLLREHYDDLQSKPFFPSL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M+SGPV   V +G++ + + R ++G T+P ++  GTIR  + I +G N  HGSDS++
Sbjct: 65  LSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIDMGRNVCHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF + E++
Sbjct: 125 SANKEIGLWFKKEELV 140


>gi|224500849|ref|ZP_03669198.1| hypothetical protein LmonF1_14703 [Listeria monocytogenes Finland
           1988]
          Length = 147

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDGVQRGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y I    N IHGSDS 
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA +EI+
Sbjct: 121 ESAQREIQLFFAPDEIL 137


>gi|157832164|pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside
           Diphosphate Kinase At 1,8 Angstroms Resolution
          Length = 154

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 8   ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 67

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+P  +  G+IR  +G+ +G N IHGSDS++
Sbjct: 68  VSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVE 127

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 128 SANREIALWFKPEELL 143


>gi|127987|sp|P27950|NDK_GINCI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|213271|gb|AAA49312.1| nucleoside diphosphate kinase [Ginglymostoma cirratum]
          Length = 151

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R ++G ++K  E  G  +VA KF    +   E  Y    D+PF+P+L
Sbjct: 4   ERTFIAVKPDGVQRCIVGEVIKRFEQKGFKLVAMKFLQAPKDLLEKHYCELSDKPFYPKL 63

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 64  IKYMSSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 123

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF R E++
Sbjct: 124 SAKKEISLWFKREELV 139


>gi|224069619|ref|XP_002191746.1| PREDICTED: similar to nucleoside-diphosphate kinase 3 [Taeniopygia
           guttata]
          Length = 262

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 52/135 (38%), Positives = 84/135 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I++  E  GL +V  K    + +  ++ Y+  +DRPF+  L
Sbjct: 115 ERTFVAIKPDGVQRRLVGEIIRRFERKGLQLVGMKLLQASEELLKEHYIALRDRPFYSRL 174

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G + +   R ++G+T+P ++  GTIR  + + + +N IHGSDS+ 
Sbjct: 175 VKYMSSGPIVAMVWQGLDVVKTVRTMIGETNPAESRPGTIRGDFCVEVSKNVIHGSDSVD 234

Query: 124 TALEEISYWFARNEI 138
           +A +EIS WF   E+
Sbjct: 235 SARQEISLWFRPEEL 249


>gi|56965987|pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
           Arabidopsis
 gi|56965988|pdb|1S57|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
           Arabidopsis
 gi|56965989|pdb|1S57|C Chain C, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
           Arabidopsis
 gi|56965990|pdb|1S57|D Chain D, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
           Arabidopsis
 gi|56965991|pdb|1S57|E Chain E, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
           Arabidopsis
 gi|56965992|pdb|1S57|F Chain F, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From
           Arabidopsis
 gi|56965993|pdb|1S59|A Chain A, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
           Dgtp From Arabidopsis
 gi|56965994|pdb|1S59|B Chain B, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
           Dgtp From Arabidopsis
 gi|56965995|pdb|1S59|C Chain C, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
           Dgtp From Arabidopsis
 gi|56965996|pdb|1S59|D Chain D, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
           Dgtp From Arabidopsis
 gi|56965997|pdb|1S59|E Chain E, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
           Dgtp From Arabidopsis
 gi|56965998|pdb|1S59|F Chain F, Structure Of Nucleoside Diphosphate Kinase 2 With Bound
           Dgtp From Arabidopsis
          Length = 153

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD ++R L+G I+   E  G  ++  K     ++ AE+ Y     + FFP 
Sbjct: 5   VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPN 64

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 65  LIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSP 124

Query: 123 KTALEEISYWFARNEII 139
           +    EI  WF   E+ 
Sbjct: 125 ENGKREIGLWFKEGELC 141


>gi|323439530|gb|EGA97251.1| nucleoside diphosphate kinase [Staphylococcus aureus O11]
 gi|323442231|gb|EGA99862.1| nucleoside diphosphate kinase [Staphylococcus aureus O46]
          Length = 149

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 92/136 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG ++  +E  GL +V  K   +  + AE  Y  H+ +PF+  
Sbjct: 1   MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF  NEI
Sbjct: 121 ESAEREINLWFNENEI 136


>gi|242373776|ref|ZP_04819350.1| nucleoside diphosphate kinase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348513|gb|EES40115.1| nucleoside diphosphate kinase [Staphylococcus epidermidis
           M23864:W1]
          Length = 159

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 95/136 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG IV  +E+ GL +V  K   + ++ AE  Y  H+ +PF+ +
Sbjct: 11  VERTFLMIKPDAVQRNLIGEIVSRIENKGLKLVGGKLMQVPKELAEKHYSEHEGKPFYEK 70

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  GTIR   G+++G N IHGSDS+
Sbjct: 71  LISFITSAPVFAMVVEGEDAVAVSRHIIGSTNPSEAAPGTIRGDLGLTVGRNIIHGSDSV 130

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  WF+ NEI
Sbjct: 131 ESAQREIKLWFSSNEI 146


>gi|320449116|ref|YP_004201212.1| nucleoside diphosphate kinase [Thermus scotoductus SA-01]
 gi|320149285|gb|ADW20663.1| nucleoside diphosphate kinase [Thermus scotoductus SA-01]
          Length = 137

 Score =  176 bits (447), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I+   E  G  +V  K   + ++ AE  Y  H+++PFFP 
Sbjct: 1   MERTFVMVKPDGVRRGLVGEILARFERKGFRIVGLKLLQITQELAERHYAEHREKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   VL+G   +++ R++MG T PK AL GTIR  +  +I EN IHGS SL
Sbjct: 61  LVSFITSGPVVAMVLEGPNVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSASL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+ +F   E++
Sbjct: 121 EDASREIALFFRPEELL 137


>gi|318040728|ref|ZP_07972684.1| nucleoside diphosphate kinase [Synechococcus sp. CB0101]
          Length = 151

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ AE  Y +H++RPFF
Sbjct: 1   MA-ERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAESHYGVHRERPFF 59

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 60  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 119

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 120 APETAQFEIGLWFQPSEL 137


>gi|221129629|ref|XP_002165205.1| PREDICTED: similar to nucleoside diphosphate kinase [Hydra
           magnipapillata]
          Length = 225

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V R LI  I+K  E  G  +V  K    +       Y   KD+PF+P 
Sbjct: 74  VEQTFIMIKPDGVARGLIAEIIKRFEQRGYKLVGLKMLVPSESLLSVHYGDLKDKPFYPG 133

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V +G+  +S+ R+++G+TDP K+  G+IR  + I +G N IHGSDS+
Sbjct: 134 LVKHISSGPVVAMVWEGKAVVSQGRQMLGETDPLKSKPGSIRGDFSIDLGRNIIHGSDSV 193

Query: 123 KTALEEISYWFARNEII 139
           ++A +EI+ WF ++EI+
Sbjct: 194 ESAEQEIALWFTKDEIV 210


>gi|149194085|ref|ZP_01871183.1| NUCLEOSIDE DIPHOSPHATE KINASE [Caminibacter mediatlanticus TB-2]
 gi|149136038|gb|EDM24516.1| NUCLEOSIDE DIPHOSPHATE KINASE [Caminibacter mediatlanticus TB-2]
          Length = 137

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 98/137 (71%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV +N+IG I+   E  GL + A K   + ++ A  FY +HK+RPFF +
Sbjct: 1   MEQTLSIIKPDAVAKNVIGKIIDRFESNGLRIAAMKKIKLTKEDAAKFYEVHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L + M SGPV + VL+GE A++KNRE+MG TDPK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LCEYMSSGPVVVMVLEGENAVAKNRELMGATDPKEAKPGTIRADFAESIEANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A +EI+++FA  EI+
Sbjct: 121 ENAKKEIAFFFAGREIL 137


>gi|255292043|dbj|BAH90524.1| nucleoside diphosphate kinase [uncultured bacterium]
 gi|255292511|dbj|BAH89626.1| nucleoside diphosphate kinase [uncultured bacterium]
 gi|255293033|dbj|BAH90128.1| nucleoside diphosphate kinase [uncultured bacterium]
          Length = 143

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG+I    E  GL ++AA+   ++R+QAE FY +H++RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGAIYSRFEQAGLKIIAARMEHLSREQAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE A++ +R++MG TDP KA  GTIR  +  +I +N++HGSD
Sbjct: 61  NDLVSFMISGPVMIQALEGENAVALHRDLMGATDPAKAAPGTIRADFASTIDQNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+Y+F   +I 
Sbjct: 121 SLENAATEIAYFFGDGQIC 139


>gi|1346675|sp|P47920|NDKB_FLABI RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B;
           Short=NDP kinase B
 gi|499112|gb|AAA19005.1| nucleoside diphosphate kinase [Flaveria bidentis]
          Length = 148

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 81/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E TF MIKPD V+R L+G I+   E  G  +   K   +++  AE  Y     +PFF  
Sbjct: 1   MEHTFIMIKPDGVQRGLVGEIIGRFEKKGFSLKGLKLLTVDQAFAEKHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD++
Sbjct: 61  LVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESAPGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESAKKEIALWFPE 133


>gi|94985789|ref|YP_605153.1| nucleoside-diphosphate kinase [Deinococcus geothermalis DSM 11300]
 gi|94556070|gb|ABF45984.1| Nucleoside-diphosphate kinase [Deinococcus geothermalis DSM 11300]
          Length = 149

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF+MIKPD V+R L   I+  ++  G  VV  K   ++R+ AE  Y  H++RPFF E
Sbjct: 12  MERTFAMIKPDGVRRGLTPEILARIQKKGYRVVGLKQMLISRELAERHYAEHRERPFFGE 71

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV    L+GE AI+  R +MG T+P  A  GTIR  +  + GEN  HGSDS 
Sbjct: 72  LVDFITSGPVVAIALEGENAIAGWRAMMGATNPANAAPGTIRADFATTTGENVTHGSDSP 131

Query: 123 KTALEEISYWFARNEII 139
           ++A  E+S +F  +E++
Sbjct: 132 ESAARELSLFFREDELL 148


>gi|16331190|ref|NP_441918.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 gi|2498071|sp|P74494|NDK_SYNY3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|1653684|dbj|BAA18596.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
          Length = 149

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 85/136 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG IV   E  G  +VA K   ++++ AE  Y    D+PFF  
Sbjct: 1   MERTFIMIKPDGVQRQLIGEIVGRFEKKGFKLVAMKVMTVSQELAEKHYEALNDKPFFSG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + S PV   V +G   +S +R+++G TDP  A  GTIR  YG+S+G N IHGSD++
Sbjct: 61  LVNFICSSPVVAMVWEGNSIVSTSRQMIGATDPHAAAPGTIRGDYGVSVGRNIIHGSDAI 120

Query: 123 KTALEEISYWFARNEI 138
           +TA  EIS WF   E+
Sbjct: 121 ETAKREISLWFKDEEV 136


>gi|192359340|ref|YP_001981964.1| nucleotide diphosphate kinase [Cellvibrio japonicus Ueda107]
 gi|226729785|sp|B3PDL7|NDK_CELJU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|190685505|gb|ACE83183.1| nucleotide diphosphate kinase [Cellvibrio japonicus Ueda107]
          Length = 141

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAVK N IG+IV   E  GL V+A +   +   QAE FY  HK R F+
Sbjct: 1   MAVEQTFSIIKPDAVKNNHIGAIVARFEKAGLKVIAQRMLQLTPAQAEGFYAEHKGRSFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  M SGPV +QVL GE AI+ NRE+MG TDP KA  GTIR  + +S+  N++HGSD
Sbjct: 61  DELVAFMTSGPVVVQVLYGENAIALNRELMGATDPTKAAPGTIRADFSMSMPANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  +E++
Sbjct: 121 SPISAAREIAYFFPTHEVV 139


>gi|1353658|gb|AAC44154.1| nucleoside diphosphate kinase Ndk [Pseudomonas aeruginosa]
          Length = 143

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV +N+IG I+   E  GL VVAAK   ++ ++A  FY  HK RPFF
Sbjct: 1   MALQRTLSIIKPDAVSKNVIGEILTRFEKAGLRVVAAKMVQLSEREAGGFYAEHKARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE+AI+KNRE+MG TDPKKA  GTIR  + +SI EN++HGSD
Sbjct: 61  KDLVSFMTSGPVVVQVLEGEDAIAKNRELMGATDPKKADAGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI Y+FA  E+ 
Sbjct: 121 SEASAAREIVYFFADTEVC 139


>gi|3063661|gb|AAC14280.1| nucleoside diphosphate kinase Ia [Arabidopsis thaliana]
          Length = 152

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 75/137 (54%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD ++R L+G I+   E  G  ++  K     ++ AE+ Y     + FFP 
Sbjct: 4   VEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPN 63

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV     +G   ++  R+++G TDP +A  GTIR    +  G N +HGSDS 
Sbjct: 64  LIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSP 123

Query: 123 KTALEEISYWFARNEII 139
           +    EI  WF   E+ 
Sbjct: 124 ENGKREIGLWFKEGELC 140


>gi|317968209|ref|ZP_07969599.1| nucleoside diphosphate kinase [Synechococcus sp. CB0205]
          Length = 152

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ AE  Y +H++RPFF
Sbjct: 1   MAAERTFIAIKPDGVQRGLVGEILGRFERKGFKMVGLKQLTPSRELAESHYGVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 61  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 121 APETAQFEIGLWFQASEL 138


>gi|291297352|ref|YP_003508750.1| Nucleoside-diphosphate kinase [Meiothermus ruber DSM 1279]
 gi|290472311|gb|ADD29730.1| Nucleoside-diphosphate kinase [Meiothermus ruber DSM 1279]
          Length = 138

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 84/138 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L G I+  +E  G  +VA K   + R+ AE  Y  H+ +PFF  
Sbjct: 1   MERTYIMVKPDGVRRGLTGEIINRIERKGFKIVAMKKMVIPRETAETHYGEHRGKPFFEG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V++G   I++ R +MG T P +A  GTIR  +  ++ EN IHGSDS 
Sbjct: 61  LVNFITSGPVVAMVVEGPGVIAEMRRLMGATRPWEAAPGTIRADFATTVDENVIHGSDSP 120

Query: 123 KTALEEISYWFARNEIIG 140
           ++A  EI  +F   EIIG
Sbjct: 121 ESAQREIGIFFKPEEIIG 138


>gi|126736378|ref|ZP_01752120.1| Nucleoside-diphosphate kinase [Roseobacter sp. CCS2]
 gi|126714199|gb|EBA11068.1| Nucleoside-diphosphate kinase [Roseobacter sp. CCS2]
          Length = 140

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 106/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA KRNL G I  + ED GL +VA+K   +   QA+ FY +H +RPFF
Sbjct: 1   MAIQRTFSIIKPDATKRNLTGQIAAKFEDAGLRIVASKRIQLTLAQAQQFYGVHAERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + MIS P+ +QVL+GE+AI+KNREVMG T+P  A  GTIR ++ +SIGENS+HGSD
Sbjct: 61  DELCEFMISEPIVVQVLEGEDAIAKNREVMGATNPADAAPGTIRKEFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|15924459|ref|NP_371993.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927050|ref|NP_374583.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           N315]
 gi|49483656|ref|YP_040880.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57650424|ref|YP_186353.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           COL]
 gi|82751066|ref|YP_416807.1| nucleoside diphosphate kinase [Staphylococcus aureus RF122]
 gi|148267953|ref|YP_001246896.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150394017|ref|YP_001316692.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151221590|ref|YP_001332412.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979788|ref|YP_001442047.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509636|ref|YP_001575295.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140964|ref|ZP_03565457.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315976|ref|ZP_04839189.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|253732111|ref|ZP_04866276.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|255006255|ref|ZP_05144856.2| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257425533|ref|ZP_05601958.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428192|ref|ZP_05604590.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430822|ref|ZP_05607204.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433580|ref|ZP_05609938.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436422|ref|ZP_05612469.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           M876]
 gi|257795476|ref|ZP_05644455.1| nucleoside diphosphate kinase [Staphylococcus aureus A9781]
 gi|258413284|ref|ZP_05681560.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9763]
 gi|258420609|ref|ZP_05683551.1| nucleoside diphosphate kinase [Staphylococcus aureus A9719]
 gi|258426804|ref|ZP_05688024.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9299]
 gi|258444802|ref|ZP_05693131.1| nucleoside-diphosphate kinase [Staphylococcus aureus A8115]
 gi|258447364|ref|ZP_05695508.1| nucleoside diphosphate kinase [Staphylococcus aureus A6300]
 gi|258449751|ref|ZP_05697852.1| nucleoside-diphosphate kinase [Staphylococcus aureus A6224]
 gi|258451127|ref|ZP_05699162.1| nucleoside diphosphate kinase [Staphylococcus aureus A5948]
 gi|258454579|ref|ZP_05702543.1| nucleoside-diphosphate kinase [Staphylococcus aureus A5937]
 gi|262048992|ref|ZP_06021871.1| nucleoside diphosphate kinase [Staphylococcus aureus D30]
 gi|262051639|ref|ZP_06023859.1| nucleoside diphosphate kinase [Staphylococcus aureus 930918-3]
 gi|282892965|ref|ZP_06301200.1| nucleoside diphosphate kinase [Staphylococcus aureus A8117]
 gi|282904050|ref|ZP_06311938.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282905815|ref|ZP_06313670.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908785|ref|ZP_06316603.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911046|ref|ZP_06318848.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914258|ref|ZP_06322045.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282916735|ref|ZP_06324493.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919181|ref|ZP_06326916.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282921715|ref|ZP_06329432.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9765]
 gi|282924365|ref|ZP_06332039.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282927996|ref|ZP_06335605.1| nucleoside diphosphate kinase [Staphylococcus aureus A10102]
 gi|283770540|ref|ZP_06343432.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           H19]
 gi|283958232|ref|ZP_06375683.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284024467|ref|ZP_06378865.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           132]
 gi|293501284|ref|ZP_06667135.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510245|ref|ZP_06668953.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293526840|ref|ZP_06671524.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294848432|ref|ZP_06789178.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9754]
 gi|295407218|ref|ZP_06817018.1| nucleoside-diphosphate kinase [Staphylococcus aureus A8819]
 gi|295427977|ref|ZP_06820609.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275334|ref|ZP_06857841.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297244642|ref|ZP_06928525.1| nucleoside diphosphate kinase [Staphylococcus aureus A8796]
 gi|297591053|ref|ZP_06949691.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|304380948|ref|ZP_07363607.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|56749123|sp|Q6GGU2|NDK_STAAR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56750007|sp|P68869|NDK_STAAM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56750008|sp|P68870|NDK_STAAU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56750009|sp|P99068|NDK_STAAN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67460608|sp|Q5HFV4|NDK_STAAC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|90110375|sp|Q2YY87|NDK_STAAB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|109892792|sp|Q2FGX3|NDK_STAA3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119372155|sp|Q2FYG7|NDK_STAA8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166233026|sp|A7X2H3|NDK_STAA1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|172048890|sp|A6QH18|NDK_STAAE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029058|sp|A6U1T7|NDK_STAA2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029059|sp|A5ISZ7|NDK_STAA9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029060|sp|A8Z448|NDK_STAAT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|987497|gb|AAB41906.1| nucleoside diphosphate kinase [Staphylococcus aureus]
 gi|13701268|dbj|BAB42562.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247240|dbj|BAB57631.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|49241785|emb|CAG40476.1| putative nucleoside diphosphate kinase [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|57284610|gb|AAW36704.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           COL]
 gi|82656597|emb|CAI81020.1| nucleoside-diphosphate kinase [Staphylococcus aureus RF122]
 gi|147741022|gb|ABQ49320.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149946469|gb|ABR52405.1| Nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|150374390|dbj|BAF67650.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721923|dbj|BAF78340.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160368445|gb|ABX29416.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724158|gb|EES92887.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|257271990|gb|EEV04128.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275033|gb|EEV06520.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278950|gb|EEV09569.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281673|gb|EEV11810.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284704|gb|EEV14824.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           M876]
 gi|257789448|gb|EEV27788.1| nucleoside diphosphate kinase [Staphylococcus aureus A9781]
 gi|257839848|gb|EEV64316.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9763]
 gi|257843557|gb|EEV67964.1| nucleoside diphosphate kinase [Staphylococcus aureus A9719]
 gi|257849965|gb|EEV73923.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9299]
 gi|257850295|gb|EEV74248.1| nucleoside-diphosphate kinase [Staphylococcus aureus A8115]
 gi|257853555|gb|EEV76514.1| nucleoside diphosphate kinase [Staphylococcus aureus A6300]
 gi|257856999|gb|EEV79899.1| nucleoside-diphosphate kinase [Staphylococcus aureus A6224]
 gi|257861182|gb|EEV83995.1| nucleoside diphosphate kinase [Staphylococcus aureus A5948]
 gi|257862962|gb|EEV85726.1| nucleoside-diphosphate kinase [Staphylococcus aureus A5937]
 gi|259160480|gb|EEW45504.1| nucleoside diphosphate kinase [Staphylococcus aureus 930918-3]
 gi|259162924|gb|EEW47487.1| nucleoside diphosphate kinase [Staphylococcus aureus D30]
 gi|269940960|emb|CBI49344.1| putative nucleoside diphosphate kinase [Staphylococcus aureus
           subsp. aureus TW20]
 gi|282313752|gb|EFB44145.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316991|gb|EFB47365.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319222|gb|EFB49574.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           D139]
 gi|282322326|gb|EFB52650.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324741|gb|EFB55051.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327049|gb|EFB57344.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331107|gb|EFB60621.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282590293|gb|EFB95373.1| nucleoside diphosphate kinase [Staphylococcus aureus A10102]
 gi|282593977|gb|EFB98966.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9765]
 gi|282595668|gb|EFC00632.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282764962|gb|EFC05087.1| nucleoside diphosphate kinase [Staphylococcus aureus A8117]
 gi|283460687|gb|EFC07777.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           H19]
 gi|283470680|emb|CAQ49891.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Staphylococcus aureus subsp. aureus ST398]
 gi|283790381|gb|EFC29198.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817149|gb|ADC37636.1| Nucleoside diphosphate kinase [Staphylococcus aureus 04-02981]
 gi|290920398|gb|EFD97462.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291096289|gb|EFE26550.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467189|gb|EFF09707.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824458|gb|EFG40881.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9754]
 gi|294967931|gb|EFG43960.1| nucleoside-diphosphate kinase [Staphylococcus aureus A8819]
 gi|295128335|gb|EFG57969.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297178672|gb|EFH37918.1| nucleoside diphosphate kinase [Staphylococcus aureus A8796]
 gi|297575939|gb|EFH94655.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|298694758|gb|ADI97980.1| Nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           ED133]
 gi|302751299|gb|ADL65476.1| nucleoside diphosphate kinase superfamily [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304340534|gb|EFM06469.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312438128|gb|ADQ77199.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312829859|emb|CBX34701.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129184|gb|EFT85179.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315195365|gb|EFU25752.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315197785|gb|EFU28119.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|329314145|gb|AEB88558.1| Nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723172|gb|EGG59703.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           21189]
 gi|329727119|gb|EGG63575.1| nucleoside pyrophosphate kinase [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329731324|gb|EGG67690.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 149

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG ++  +E  GL +V  K   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF  NEI
Sbjct: 121 ESAEREINLWFNENEI 136


>gi|254430648|ref|ZP_05044351.1| nucleoside diphosphate kinase [Cyanobium sp. PCC 7001]
 gi|197625101|gb|EDY37660.1| nucleoside diphosphate kinase [Cyanobium sp. PCC 7001]
          Length = 161

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 84/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ AE+ Y +H++RPFF
Sbjct: 10  MAAERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAENHYGVHRERPFF 69

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    I+IG N IHGSD
Sbjct: 70  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAINIGRNVIHGSD 129

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 130 APETAAFEIGLWFQPSEL 147


>gi|158336865|ref|YP_001518040.1| nucleoside diphosphate kinase [Acaryochloris marina MBIC11017]
 gi|189030818|sp|B0C4I0|NDK_ACAM1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|158307106|gb|ABW28723.1| nucleoside diphosphate kinase [Acaryochloris marina MBIC11017]
          Length = 149

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  +KPD V+R L+G I+   E  G  +V  K   ++R+ AE  Y  HK++PFF  
Sbjct: 1   MERTFLAVKPDGVQRGLVGEIISRYEAKGFTLVGLKLMVVSRELAEQHYGEHKEKPFFSG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V +G+  ++  R+++G T+P  +  GTIR  +GI IG N IHGSD++
Sbjct: 61  LVDFITSGPVVAMVWEGKGVVAAARKIIGATNPLGSEPGTIRGDFGIDIGRNIIHGSDAV 120

Query: 123 KTALEEISYWFARNEI 138
           +TA  EIS WF   E+
Sbjct: 121 ETAQREISLWFKSEEL 136


>gi|114765301|ref|ZP_01444418.1| nucleoside diphosphate kinase [Pelagibaca bermudensis HTCC2601]
 gi|114542281|gb|EAU45310.1| nucleoside diphosphate kinase [Roseovarius sp. HTCC2601]
          Length = 140

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   + + QA +FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHLTKAQAGEFYKVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A +GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPADAAEGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+Y+F+  E++G
Sbjct: 121 APETAAEEIAYFFSGLELVG 140


>gi|110680299|ref|YP_683306.1| nucleoside diphosphate kinase [Roseobacter denitrificans OCh 114]
 gi|119372147|sp|Q164H3|NDK_ROSDO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|109456415|gb|ABG32620.1| nucleoside diphosphate kinase [Roseobacter denitrificans OCh 114]
          Length = 140

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   M + QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHMTKAQAGVFYAVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPVVVQVLEGEGAIAKNREVMGATNPADAAPGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+Y+F+  E++G
Sbjct: 121 APETAAEEIAYFFSGMELVG 140


>gi|46446000|ref|YP_007365.1| nucleoside-diphosphate kinase [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46399641|emb|CAF23090.1| probable nucleoside-diphosphate kinase [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 242

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 95/137 (69%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+T S+IKPDAV+ N IG I+   E  GL + A K   + + QA  FY IHKDRPF+ 
Sbjct: 103 ASEQTLSIIKPDAVQNNYIGEIISRFEQAGLKIAAIKMTTLTKDQASKFYAIHKDRPFYN 162

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           +LV  M SGPV + VL+G +AI+KNRE+MG TDPKKA KGT+R  +  S+  N++HGSDS
Sbjct: 163 DLVNFMSSGPVVVMVLEGNQAIAKNRELMGATDPKKAEKGTLRADFAESMSRNAVHGSDS 222

Query: 122 LKTALEEISYWFARNEI 138
            +TA EE+ ++F  +EI
Sbjct: 223 SETAEEEVLFFFKPDEI 239


>gi|146308519|ref|YP_001188984.1| nucleoside diphosphate kinase [Pseudomonas mendocina ymp]
 gi|330504683|ref|YP_004381552.1| nucleoside diphosphate kinase [Pseudomonas mendocina NK-01]
 gi|166233005|sp|A4XY36|NDK_PSEMY RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|145576720|gb|ABP86252.1| nucleoside diphosphate kinase [Pseudomonas mendocina ymp]
 gi|328918969|gb|AEB59800.1| nucleoside diphosphate kinase [Pseudomonas mendocina NK-01]
          Length = 143

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDAV +N+IG I    E  GL VVA+K   ++ ++A  FY  H +R FF
Sbjct: 1   MAVQRTFSIIKPDAVAKNVIGEITTRFEKAGLRVVASKMVQLSEREAAGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE+A+ KNRE+MG T+PK+A  GTIR  + +SI EN++HGSD
Sbjct: 61  KDLVAFMTSGPVIVQVLEGEDAVLKNRELMGATNPKEAAPGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+  E+ 
Sbjct: 121 SEASAAREIAYFFSATELC 139


>gi|157163948|ref|YP_001466313.1| nucleoside diphosphate kinase (NDK; NDP kinase; nucleoside-2-P
           kinase) [Campylobacter concisus 13826]
 gi|166232958|sp|A7ZC05|NDK_CAMC1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|112800851|gb|EAT98195.1| nucleoside diphosphate kinase [Campylobacter concisus 13826]
          Length = 137

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 101/137 (73%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T S+IKPDAVK+N++G I+   E  GL + AAK   +++  A+ FY +HKDRPFF +
Sbjct: 1   MQRTLSIIKPDAVKKNVVGKIIDRFESNGLRIAAAKKIKLSKCDAKAFYAVHKDRPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV + VL+GE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDFMVSGPVVVMVLEGENAVAKNRELMGATNPKEAAPGTIRADFADSIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A+ EI+++FA  EI 
Sbjct: 121 ENAVNEINFFFASREIC 137


>gi|294140369|ref|YP_003556347.1| nucleoside diphosphate kinase [Shewanella violacea DSS12]
 gi|293326838|dbj|BAJ01569.1| nucleoside diphosphate kinase [Shewanella violacea DSS12]
          Length = 143

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 65/139 (46%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNNIGAIYNRFETAGLKIIASKMVHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +Q L+GE A+  +R+++G T+P  A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVSFMTSGPIMVQALEGENAVLAHRDILGATNPADAAPGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  E++Y+F+  E+ 
Sbjct: 121 SVASAEREVAYFFSTEELC 139


>gi|237751544|ref|ZP_04582024.1| nucleoside diphosphate kinase [Helicobacter bilis ATCC 43879]
 gi|229372910|gb|EEO23301.1| nucleoside diphosphate kinase [Helicobacter bilis ATCC 43879]
          Length = 137

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 106/137 (77%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAVK+N+IG I+   ED GL + AAK   +++ +A++FY +HKDRPF+ +
Sbjct: 1   MEQTLSIIKPDAVKKNVIGKIITRFEDNGLRIAAAKKVQLSKCEAKEFYAVHKDRPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+G+ AI+KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDS 
Sbjct: 61  LVEFMISGPVVVMVLEGDNAIAKNRELMGATNPKEAAPGTIRADFADSIDANAVHGSDSK 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++FA+++I+
Sbjct: 121 ENAAIEIAFFFAKSKIL 137


>gi|37525328|ref|NP_928672.1| nucleoside diphosphate kinase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|67460699|sp|Q7N710|NDK_PHOLL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|36784755|emb|CAE13665.1| nucleoside-diphosphate kinase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 141

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AVK+N IG+I    E  G  ++AAK   + R+QAE FY  HK RPFF
Sbjct: 1   MTVERTFSIIKPNAVKKNAIGAIYARFESAGFKIIAAKMLHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  DGLVEFMTSGPIVVQVLEGENAVQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F  +EI 
Sbjct: 121 AVESANREIAYFFTEDEIC 139


>gi|116206354|ref|XP_001228986.1| hypothetical protein CHGG_02470 [Chaetomium globosum CBS 148.51]
 gi|88183067|gb|EAQ90535.1| hypothetical protein CHGG_02470 [Chaetomium globosum CBS 148.51]
          Length = 152

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 53/140 (37%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G+I+   E  G  +VA K     ++  E  Y     +PF
Sbjct: 1   MSTSERTFIAIKPDGVQRGLVGNIIGRFETRGFKLVALKLVSPGKEHLEKHYSDLSSKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           F +LV  M SGP+   V +G +A+   R ++G T+P  +  GTIR    + +G N  HGS
Sbjct: 61  FKDLVTYMNSGPIVAMVWEGLDAVKTGRAMLGATNPLSSAPGTIRGDLCLQMGRNVCHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A +EI+ WF   ++I
Sbjct: 121 DSVESANKEIALWFKDEDLI 140


>gi|89072698|ref|ZP_01159263.1| nucleoside diphosphate kinase [Photobacterium sp. SKA34]
 gi|89051518|gb|EAR56972.1| nucleoside diphosphate kinase [Photobacterium sp. SKA34]
          Length = 143

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 105/138 (76%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAVKRNLIG+I +  E+ GL +VAAK   ++  +A+ FY  H+ +PFF
Sbjct: 1   MTIERTFSIVKPDAVKRNLIGAIYQRFENAGLNIVAAKMLHLDSAKAQGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI++ RE+MG T+P++A  GTIR+ + +S+  NS+HGSD
Sbjct: 61  DDLVAFMTSGPVMVQVLEGENAITRYRELMGKTNPEEAACGTIRSDFALSMRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI+Y+FA +EI
Sbjct: 121 SPESAAREIAYFFAEDEI 138


>gi|110634329|ref|YP_674537.1| nucleoside diphosphate kinase [Mesorhizobium sp. BNC1]
 gi|119372038|sp|Q11GV3|NDK_MESSB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|110285313|gb|ABG63372.1| nucleoside diphosphate kinase [Chelativorans sp. BNC1]
          Length = 140

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 90/140 (64%), Positives = 110/140 (78%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+I K LED GL VVA+K  WM+R+QAE FY +HKDRPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAITKMLEDAGLKVVASKRVWMSRRQAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR  + +SIGENS+HGSD
Sbjct: 61  DELCEFMSSGPTVIQVLEGENAIAKNREVMGATNPANAAEGTIRKVFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI YWF+  EI+G
Sbjct: 121 APETAEQEIRYWFSETEIVG 140


>gi|253988863|ref|YP_003040219.1| nucleoside diphosphate kinase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780313|emb|CAQ83474.1| nucleoside diphosphate kinase [Photorhabdus asymbiotica]
          Length = 168

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AVK+N IGSI    E  G  ++AAK   + R+QAE FY  HK RPFF
Sbjct: 28  MTVERTFSIIKPNAVKKNAIGSIYARFESAGFKIIAAKMLHLTREQAEGFYAEHKGRPFF 87

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 88  DGLVEFMTSGPIVVQVLEGENAVQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 147

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F  +EI 
Sbjct: 148 AVESANREIAYFFTEDEIC 166


>gi|307151253|ref|YP_003886637.1| Nucleoside-diphosphate kinase [Cyanothece sp. PCC 7822]
 gi|306981481|gb|ADN13362.1| Nucleoside-diphosphate kinase [Cyanothece sp. PCC 7822]
          Length = 148

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/134 (43%), Positives = 86/134 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G +++  E  G  +V  K   ++R+ AE  Y +H++RPFF  
Sbjct: 1   MERTFVMVKPDGVQRALVGEVIRRFEAKGFTLVGLKMVQVSRELAEKHYDVHRERPFFGS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +IS PV   V +G+  I+  R+++G T+P  A  GTIR  YG+ IG N IHGSD+ 
Sbjct: 61  LVNFIISAPVVAMVWEGKGVIAAARKIIGATNPLNAEPGTIRGDYGVDIGRNLIHGSDAP 120

Query: 123 KTALEEISYWFARN 136
           +TA +E+S WF   
Sbjct: 121 ETAAQEVSLWFGDE 134


>gi|185132749|ref|NP_001116998.1| nucleoside diphosphate kinase [Salmo salar]
 gi|2895763|gb|AAC03020.1| nucleoside diphosphate kinase [Salmo salar]
          Length = 151

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF        ++ Y   KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRRLVGDIIKRFELKGFKMVGMKFIKAPESLLKEHYADLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VSYMTSGPVVAMVWEGFNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E+ 
Sbjct: 125 SANTEINLWFKPEELC 140


>gi|288556091|ref|YP_003428026.1| nucleoside diphosphate kinase [Bacillus pseudofirmus OF4]
 gi|288547251|gb|ADC51134.1| nucleoside diphosphate kinase [Bacillus pseudofirmus OF4]
          Length = 147

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 65/136 (47%), Positives = 85/136 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ MIKPD V+RNLIG +V   E  G  +V AK   + +  AE  Y  HK+RPFF E
Sbjct: 1   MERTYLMIKPDGVQRNLIGEVVSRFEKKGFTLVGAKLMTVTKDLAETHYAEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  IS  R +MG T+P +A  GTIR  YG+ +  N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGENVISTARTMMGATNPAEAAPGTIRGDYGVQVAMNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  +F   E+
Sbjct: 121 ESAKREIGIFFEDAEL 136


>gi|222424465|dbj|BAH20188.1| AT4G11010 [Arabidopsis thaliana]
          Length = 238

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVIVPSKDFAQKHYHDLKERPFFNG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +G+  I   R+++G TDP+K+  GTIR    +++G N IHGSD  
Sbjct: 148 LCDFLSSGPVIAMVWEGDGVIRYGRKLIGATDPQKSEPGTIRGDLAVTVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EIS WF   E++
Sbjct: 208 ETAKDEISLWFKPQELV 224


>gi|67460706|sp|Q7VEG3|NDK_PROMA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 151

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G I+   E  G  +V  K    +++ AE  Y +HK+RPFF
Sbjct: 1   MSVERTFLAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLIPSKELAEKHYGVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I   R+++G T P +A  GTIR   GI+IG N IHGSD
Sbjct: 61  TGLVGFITSGPVVAMVWEGDGVILSARKLIGATKPLEAEPGTIRGDLGINIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
             +TA  EI  WF  +E+
Sbjct: 121 GPETASFEIDLWFNSSEL 138


>gi|58267614|ref|XP_570963.1| nucleoside-diphosphate kinase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134112027|ref|XP_775549.1| hypothetical protein CNBE2630 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258208|gb|EAL20902.1| hypothetical protein CNBE2630 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227197|gb|AAW43656.1| nucleoside-diphosphate kinase, putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 152

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 79/134 (58%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+T+ MIKPD V+R L+G I+   E  G  +VA K    +++  E  Y    ++PFFP
Sbjct: 3   TTEQTYIMIKPDGVQRGLVGEIIGRFEKRGFKLVALKLHTPSKEHLEKHYSDLSEKPFFP 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L++ M+SGPV   V +G +A+   R ++G T+P  +  GTIR  Y + +G N  HGSDS
Sbjct: 63  RLIEYMMSGPVVCMVWEGLDAVKTGRVMLGATNPLASAPGTIRGDYALQVGMNVCHGSDS 122

Query: 122 LKTALEEISYWFAR 135
           ++   +EI+ WF  
Sbjct: 123 VENGQKEIALWFPE 136


>gi|46123189|ref|XP_386148.1| hypothetical protein FG05972.1 [Gibberella zeae PH-1]
          Length = 238

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 78/136 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+   E+ G  + A K     ++  E  Y     +PFF  L
Sbjct: 89  EQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAIKLMTPGKEHLEKHYADLAGKPFFAGL 148

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGP+   V +G +A+   R ++G T+P  +  GTIR  Y I +G N  HGSDS++
Sbjct: 149 IEYMNSGPICAMVWEGRDAVKTGRSILGATNPLASSPGTIRGDYAIDVGRNVCHGSDSVE 208

Query: 124 TALEEISYWFARNEII 139
            A +EI+ WF   E++
Sbjct: 209 NAQKEIALWFKEGEVV 224


>gi|197725753|gb|ACH73072.1| nucleoside diphosphate kinase [Epinephelus coioides]
          Length = 148

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R +IG ++K  E  G  +V  K    + K   + Y+  KDRPFFP L
Sbjct: 6   ERTFIAIKPDGVQRGIIGEVIKRFEMKGFKLVGMKMLHASEKLLNEHYIDLKDRPFFPTL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G+  +   R ++G+T+P  +  GTIR  + I + +N IHGSDS++
Sbjct: 66  IKYMSSGPVVAMVWEGKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF  +E++
Sbjct: 126 SANKEISLWFTDDELV 141


>gi|113953095|ref|YP_731929.1| nucleoside diphosphate kinase [Synechococcus sp. CC9311]
 gi|119372156|sp|Q0I6J3|NDK_SYNS3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|113880446|gb|ABI45404.1| nucleoside diphosphate kinase [Synechococcus sp. CC9311]
          Length = 152

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E++F  IKPD V+R L+G I+   E  G  +V  K    +R+ AE  Y +HK+RPFF
Sbjct: 1   MAAERSFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    I+IG N IHGSD
Sbjct: 61  GGLVDFITSGPVVAMVWEGDGVITSARKMIGATKPLEAEPGTIRGDLAINIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 121 APETAEFEIGLWFNPSEL 138


>gi|54307954|ref|YP_128974.1| nucleoside diphosphate kinase [Photobacterium profundum SS9]
 gi|67460677|sp|Q6LU53|NDK_PHOPR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|46912380|emb|CAG19172.1| putative nucleoside diphosphate kinase [Photobacterium profundum
           SS9]
          Length = 142

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 105/139 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IEKTFS+IKPDAVKRNLIG+I +  E+ GL +VA+K   ++  +A+ FY  H+++PFF
Sbjct: 1   MTIEKTFSIIKPDAVKRNLIGAIYQRFENAGLKIVASKMVHLDATKAQGFYAEHEEKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGPV +QVL+GE+AI + RE+MG T+P+ A  GTIR+ + +S+  NS+HGSD
Sbjct: 61  NELVEFMTSGPVMVQVLEGEDAIHRYRELMGTTNPENAACGTIRSDFALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SPESAAREIAYFFTEDEIC 139


>gi|15237018|ref|NP_192839.1| NDPK3 (NUCLEOSIDE DIPHOSPHATE KINASE 3); ATP binding / nucleoside
           diphosphate kinase [Arabidopsis thaliana]
 gi|6225753|sp|O49203|NDK3_ARATH RecName: Full=Nucleoside diphosphate kinase III,
           chloroplastic/mitochondrial; Short=NDK III; Short=NDP
           kinase III; Short=NDPK III; Flags: Precursor
 gi|2829275|gb|AAC00512.1| nucleoside diphosphate kinase 3 [Arabidopsis thaliana]
 gi|3513740|gb|AAC33956.1| contains similarity to nucleoside diphosphate kinases (Pfam:
           NDK.hmm, score: 301.12) [Arabidopsis thaliana]
 gi|4539375|emb|CAB40069.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana]
 gi|7267799|emb|CAB81202.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana]
 gi|14334560|gb|AAK59688.1| putative nucleoside diphosphate kinase ndpk3 [Arabidopsis thaliana]
 gi|17065632|gb|AAL33810.1| putative nucleoside diphosphate kinase 3 [Arabidopsis thaliana]
 gi|332657561|gb|AEE82961.1| nucleoside diphosphate kinase III [Arabidopsis thaliana]
          Length = 238

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVIVPSKDFAQKHYHDLKERPFFNG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +G+  I   R+++G TDP+K+  GTIR    +++G N IHGSD  
Sbjct: 148 LCDFLSSGPVIAMVWEGDGVIRYGRKLIGATDPQKSEPGTIRGDLAVTVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EIS WF   E++
Sbjct: 208 ETAKDEISLWFKPQELV 224


>gi|20218817|emb|CAC84493.1| putative nucleoside diphosphate kinase [Pinus pinaster]
          Length = 235

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +VA K    +++ AE  Y   K+RPFF  
Sbjct: 86  LERTFIAIKPDGVQRGLISEIVSRFERKGYKLVAIKLVVPSKQFAEQHYEDLKERPFFNG 145

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L + + SGPV   V +G+  I   R+++G TDP+ +  GTIR    I +G N IHGSD  
Sbjct: 146 LCEFLSSGPVLAMVWEGQGVIKYGRKLIGATDPQNSEPGTIRGDLAIIVGRNIIHGSDGP 205

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 206 ETAKNEINLWFKPEELV 222


>gi|47026989|gb|AAT08712.1| nucleoside diphosphate kinase [Hyacinthus orientalis]
          Length = 159

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  + A K   + R  AE  Y     +PFF  
Sbjct: 12  MEQTFIMIKPDGVQRGLVGEIISRFEKKGFYLKAMKLITVERSFAEKHYEDLSSKPFFGG 71

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  +   R+++G T+P  +  GTIR  Y I +G N IHGSD++
Sbjct: 72  LVEYIISGPVVAMVWEGKNVVLTGRKIIGATNPADSAPGTIRGDYAIMVGRNIIHGSDAV 131

Query: 123 KTALEEISYWFAR 135
           ++A +EI  WF  
Sbjct: 132 ESARKEIGLWFPE 144


>gi|255021261|ref|ZP_05293310.1| Nucleoside diphosphate kinase [Acidithiobacillus caldus ATCC 51756]
 gi|254969272|gb|EET26785.1| Nucleoside diphosphate kinase [Acidithiobacillus caldus ATCC 51756]
          Length = 142

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAVK+N IG+I+   E  GL V+AA+   ++   A  FY +HKDRPF+
Sbjct: 1   MAVERTLSIIKPDAVKKNAIGAILSRFEQAGLQVIAARMLQLSAADAGGFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL   M SGPV + VL+GE AI+KNRE+MG T+PK A  GTIR  +  +I  N++HGSD
Sbjct: 61  GELCAFMSSGPVLVSVLEGEGAIAKNRELMGATNPKDAAPGTIRADFAENIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S +TA  EI+Y+F++ E+ 
Sbjct: 121 SAETAAWEIAYFFSKRELC 139


>gi|237753246|ref|ZP_04583726.1| nucleoside diphosphate kinase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375513|gb|EEO25604.1| nucleoside diphosphate kinase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 137

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 99/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV++N+IG IV   E  GL + A K   ++R  A++FY +HK+RPFF +
Sbjct: 1   MEQTLSIIKPDAVQKNVIGKIVDRFESNGLRIAAMKKIRLSRNDAKEFYAVHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV + VL+G  A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDFMVSGPVVVMVLEGLNAVAKNRELMGATNPKEAAAGTIRADFADSIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  E++++F+  EI 
Sbjct: 121 ENAQREVAFFFSTREIC 137


>gi|254412326|ref|ZP_05026100.1| Nucleoside diphosphate kinase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180636|gb|EDX75626.1| Nucleoside diphosphate kinase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 149

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+RNL+G I++ LE  G  +V  K   ++R+ AE  Y +HKD+ FF  
Sbjct: 1   MERTFLMIKPDGVQRNLVGEIIQRLETKGFTLVGLKLMSVSRELAEQHYAVHKDKGFFAG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV   V +GE  I+  R+++G T+P  A  GTIR  +G+++G N IHGSD  
Sbjct: 61  LIEFITSGPVVAMVWEGEGIIASARKIIGATNPLSAEPGTIRGDFGVTVGRNLIHGSDGS 120

Query: 123 KTALEEISYWFARNEII 139
            TA EEI  WF   E++
Sbjct: 121 DTAKEEIKLWFKDEELV 137


>gi|254477799|ref|ZP_05091185.1| nucleoside diphosphate kinase [Ruegeria sp. R11]
 gi|214032042|gb|EEB72877.1| nucleoside diphosphate kinase [Ruegeria sp. R11]
          Length = 140

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 72/140 (51%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   + + QA +FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHLTKAQAGEFYKVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPIVAQVLEGENAIAKNREVMGATNPADAAAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|209734222|gb|ACI67980.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|223646792|gb|ACN10154.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|223672649|gb|ACN12506.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|303659625|gb|ADM15964.1| Nucleoside diphosphate kinase A [Salmo salar]
          Length = 151

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF        ++ Y   KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRRLVGDIIKRFELKGFKMVGMKFIKAPESLLKEHYADLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VSYMTSGPVVAMVWEGFNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E+ 
Sbjct: 125 SANTEINLWFKPEELC 140


>gi|145512904|ref|XP_001442363.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124409716|emb|CAK74966.1| unnamed protein product [Paramecium tetraurelia]
          Length = 152

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 88/136 (64%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  ED G  +VA KF   ++      Y   K+RPFFP L
Sbjct: 5   ERTFIMVKPDGVQRRLVGKIIQRFEDRGFKLVALKFVAPDQGLLTQHYADLKERPFFPSL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ + SGPV   V +G++A+   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  LKYVSSGPVAAMVWEGKDAVKTGRVMLGETNPLASKPGTIRGDFAIDVGRNVIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 125 SANKEISLWFQPQELV 140


>gi|66822329|ref|XP_644519.1| nucleoside diphosphate kinase [Dictyostelium discoideum AX4]
 gi|66822753|ref|XP_644731.1| nucleoside diphosphate kinase [Dictyostelium discoideum AX4]
 gi|127985|sp|P22887|NDKC_DICDI RecName: Full=Nucleoside diphosphate kinase, cytosolic; Short=NDK;
           Short=NDP kinase
 gi|515221|pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of
           Nucleoside Diphosphate Kinase
 gi|515222|pdb|1NDP|B Chain B, Adenosine 5'-Diphosphate Binding And The Active Site Of
           Nucleoside Diphosphate Kinase
 gi|2098340|pdb|1KDN|A Chain A, Structure Of Nucleoside Diphosphate Kinase
 gi|2098341|pdb|1KDN|B Chain B, Structure Of Nucleoside Diphosphate Kinase
 gi|2098342|pdb|1KDN|C Chain C, Structure Of Nucleoside Diphosphate Kinase
 gi|3660290|pdb|2BEF|A Chain A, Crystal Structure Of Ndp Kinase Complexed With Mg, Adp,
           And Bef3
 gi|3660291|pdb|2BEF|B Chain B, Crystal Structure Of Ndp Kinase Complexed With Mg, Adp,
           And Bef3
 gi|3660292|pdb|2BEF|C Chain C, Crystal Structure Of Ndp Kinase Complexed With Mg, Adp,
           And Bef3
 gi|4929929|pdb|1BUX|A Chain A, 3'-Phosphorylated Nucleotides Binding To Nucleoside
           Diphosphate Kinase
 gi|4929930|pdb|1BUX|B Chain B, 3'-Phosphorylated Nucleotides Binding To Nucleoside
           Diphosphate Kinase
 gi|4929931|pdb|1BUX|C Chain C, 3'-Phosphorylated Nucleotides Binding To Nucleoside
           Diphosphate Kinase
 gi|5542091|pdb|1B99|A Chain A, 3'-Fluoro-Uridine Diphosphate Binding To Nucleoside
           Diphosphate Kinase
 gi|5542092|pdb|1B99|B Chain B, 3'-Fluoro-Uridine Diphosphate Binding To Nucleoside
           Diphosphate Kinase
 gi|5542093|pdb|1B99|C Chain C, 3'-Fluoro-Uridine Diphosphate Binding To Nucleoside
           Diphosphate Kinase
 gi|5542094|pdb|1B99|D Chain D, 3'-Fluoro-Uridine Diphosphate Binding To Nucleoside
           Diphosphate Kinase
 gi|5542095|pdb|1B99|E Chain E, 3'-Fluoro-Uridine Diphosphate Binding To Nucleoside
           Diphosphate Kinase
 gi|5542096|pdb|1B99|F Chain F, 3'-Fluoro-Uridine Diphosphate Binding To Nucleoside
           Diphosphate Kinase
 gi|10835834|pdb|1F6T|A Chain A, Structure Of The Nucleoside Diphosphate KinaseALPHA-
           Borano(Rp)-Tdp.Mg Complex
 gi|10835835|pdb|1F6T|B Chain B, Structure Of The Nucleoside Diphosphate KinaseALPHA-
           Borano(Rp)-Tdp.Mg Complex
 gi|10835836|pdb|1F6T|C Chain C, Structure Of The Nucleoside Diphosphate KinaseALPHA-
           Borano(Rp)-Tdp.Mg Complex
 gi|14488651|pdb|1HIY|A Chain A, Binding Of Nucleotides To Ndp Kinase
 gi|14488652|pdb|1HIY|B Chain B, Binding Of Nucleotides To Ndp Kinase
 gi|14488653|pdb|1HIY|C Chain C, Binding Of Nucleotides To Ndp Kinase
 gi|60593465|pdb|1S5Z|A Chain A, Ndp Kinase In Complex With Adenosine Phosphonoacetic Acid
 gi|60593466|pdb|1S5Z|B Chain B, Ndp Kinase In Complex With Adenosine Phosphonoacetic Acid
 gi|60593467|pdb|1S5Z|C Chain C, Ndp Kinase In Complex With Adenosine Phosphonoacetic Acid
 gi|60593468|pdb|1S5Z|D Chain D, Ndp Kinase In Complex With Adenosine Phosphonoacetic Acid
 gi|60593469|pdb|1S5Z|E Chain E, Ndp Kinase In Complex With Adenosine Phosphonoacetic Acid
 gi|60593470|pdb|1S5Z|F Chain F, Ndp Kinase In Complex With Adenosine Phosphonoacetic Acid
 gi|157832093|pdb|1NDC|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Complexed
           With Dtdp And Mg2+ At 2 A Resolution
 gi|167843|gb|AAA33231.1| nucleoside diphosphate kinase Gip17 (EC 2.7.4.6) [Dictyostelium
           discoideum]
 gi|349363|gb|AAA16161.1| nucleoside diphosphate kinase [Dictyostelium discoideum]
 gi|60472642|gb|EAL70593.1| nucleoside diphosphate kinase [Dictyostelium discoideum AX4]
 gi|60472803|gb|EAL70752.1| nucleoside diphosphate kinase [Dictyostelium discoideum AX4]
          Length = 155

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 9   ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 68

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+P  +  G+IR  +G+ +G N IHGSDS++
Sbjct: 69  VSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVE 128

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 129 SANREIALWFKPEELL 144


>gi|319638407|ref|ZP_07993169.1| nucleoside diphosphate kinase [Neisseria mucosa C102]
 gi|317400156|gb|EFV80815.1| nucleoside diphosphate kinase [Neisseria mucosa C102]
          Length = 141

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV++N+IG I    E+ GL ++AAK   ++ ++A++FY +HK RPF+
Sbjct: 1   MAIERTISIIKPDAVEKNVIGKIYSRFEENGLRIIAAKMKQLSEREAKEFYAVHKGRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M   PV +QVL+GE A++KNRE+MG T+P  A  GTIR  +  S+  N++HGSD
Sbjct: 61  EDLVKFMTRNPVMIQVLEGENAVAKNRELMGATNPADAAPGTIRADFAESVSVNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F+++EI 
Sbjct: 121 SVENAAIEIAYFFSQSEIC 139


>gi|19570344|dbj|BAB86292.1| nucleoside diphosphate kinase 1 [Brassica rapa]
 gi|19744165|dbj|BAB86841.1| NDPK I [Brassica rapa]
          Length = 148

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/133 (40%), Positives = 78/133 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIICRFEKKGFTLKGLKLITVDRPFAEKHYQDLSAKPFFSS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   + +G+  +   R+++G T+P  +  GTIR  Y I IG N IHGSDS+
Sbjct: 61  LVDYIISGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDYAIDIGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++A +E + WF  
Sbjct: 121 ESANKEAALWFPD 133


>gi|154253770|ref|YP_001414594.1| nucleoside-diphosphate kinase [Parvibaculum lavamentivorans DS-1]
 gi|171769686|sp|A7HYF4|NDK_PARL1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|154157720|gb|ABS64937.1| Nucleoside-diphosphate kinase [Parvibaculum lavamentivorans DS-1]
          Length = 140

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I+   E  GL VVA+K   M + QAE FY +HK+RPFF
Sbjct: 1   MALERTFSIIKPDATRRNLTGKIIDRFESAGLRVVASKRIHMTKAQAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE A++KNRE+MG T+P  A  GTIR  +  SI  NS+HGSD
Sbjct: 61  NDLVSFMISGPVVVQVLEGENAVAKNREIMGATNPANADAGTIRKDFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI Y+F   EI+G
Sbjct: 121 APETAAEEIKYFFKDEEIVG 140


>gi|301507718|gb|ADK77879.1| nucleoside diphosphate kinase [Camellia sinensis]
          Length = 147

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 80/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   + R  AE  Y     +PFF  
Sbjct: 1   MEQTFVMIKPDGVQRGLVGEIICRFEKKGFTLKGLKLQSVERAFAEKHYADLSSKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSD++
Sbjct: 61  LVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPSDSAPGTIRGDFAVEIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPE 133


>gi|197285704|ref|YP_002151576.1| nucleoside diphosphate kinase [Proteus mirabilis HI4320]
 gi|227356215|ref|ZP_03840604.1| nucleoside diphosphate kinase [Proteus mirabilis ATCC 29906]
 gi|226729844|sp|B4EZT7|NDK_PROMH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|194683191|emb|CAR43833.1| nucleoside diphosphate kinase [Proteus mirabilis HI4320]
 gi|227163679|gb|EEI48595.1| nucleoside diphosphate kinase [Proteus mirabilis ATCC 29906]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKP+AVK+N+IG+I    E  G  +VAAK   + R+QAE FY  HK RPFF
Sbjct: 1   MAIQRTFSIIKPNAVKKNVIGAIYNRFESAGFSIVAAKMLHLTREQAEGFYEEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE AI ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENAIQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  NEI 
Sbjct: 121 SEASAAREIAYFFTENEIC 139


>gi|120598685|ref|YP_963259.1| nucleoside diphosphate kinase [Shewanella sp. W3-18-1]
 gi|146293237|ref|YP_001183661.1| nucleoside diphosphate kinase [Shewanella putrefaciens CN-32]
 gi|166233021|sp|A4Y7C9|NDK_SHEPC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166233023|sp|A1RJ60|NDK_SHESW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|120558778|gb|ABM24705.1| nucleoside diphosphate kinase [Shewanella sp. W3-18-1]
 gi|145564927|gb|ABP75862.1| nucleoside diphosphate kinase [Shewanella putrefaciens CN-32]
 gi|319426250|gb|ADV54324.1| Nucleoside-diphosphate kinase [Shewanella putrefaciens 200]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL +VAAK   + ++QAE FY  H +R FF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVAAKMLHLTKEQAEGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  +RE++G T+P +A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F+  E+ 
Sbjct: 121 AVESAAREIAYFFSAEELC 139


>gi|119510058|ref|ZP_01629198.1| Nucleoside diphosphate kinase [Nodularia spumigena CCY9414]
 gi|119465245|gb|EAW46142.1| Nucleoside diphosphate kinase [Nodularia spumigena CCY9414]
          Length = 149

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+  I++  E  G  +V  KF  ++R+ AE  Y +HK+RPFF  
Sbjct: 1   MERTFLAIKPDGVQRGLVAEIIRRYETKGFTLVGMKFMKVSRELAEQHYDVHKERPFFSS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V +G+  ++  R+++G T+P  A  GTIR  +GI+IG N IHGSD+L
Sbjct: 61  LVDFITSGPVVAMVWEGDGVVASARKIIGATNPLTAEPGTIRGDFGINIGRNLIHGSDAL 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 121 ETAHREIALWFKEEELV 137


>gi|325652116|ref|NP_001191690.1| nucleoside diphosphate kinase A [Gallus gallus]
          Length = 153

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I++  E  G  +VA K    +     + Y+  KDRPF+  L
Sbjct: 6   ERTFIAIKPDGVQRGLVGEIIRRFEQKGFKLVAMKLTHASEDLLREHYIDLKDRPFYAGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           VQ M SGP+   V +G   I   R ++G+T+P  +  GTIR    + +G N IHGSDSL+
Sbjct: 66  VQYMHSGPIVAMVWEGLNVIKTGRVMLGETNPMDSKPGTIRGDLCVQVGRNIIHGSDSLE 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF+  E++
Sbjct: 126 SAEAEINLWFSPEELV 141


>gi|2498077|sp|P93554|NDK1_SACOF RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I; AltName: Full=PP18
 gi|1777930|gb|AAB40609.1| nucleoside diphosphate kinase [Saccharum hybrid cultivar H50-7209]
          Length = 149

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E TF MIKPD V+R LIG I+   E  G  + A K   + R  AE  Y     +PFF  
Sbjct: 1   MESTFIMIKPDGVQRGLIGEIISRFEKKGFYLKALKLVNVERSFAEKHYADLSSKPFFQG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSDS+
Sbjct: 61  LVDYIISGPVVAMVWEGKSVVTTGRKIIGATNPLVSEPGTIRGDFAVDIGRNVIHGSDSI 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESANKEIALWFPE 133


>gi|302773528|ref|XP_002970181.1| hypothetical protein SELMODRAFT_171292 [Selaginella moellendorffii]
 gi|300161697|gb|EFJ28311.1| hypothetical protein SELMODRAFT_171292 [Selaginella moellendorffii]
          Length = 151

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 77/136 (56%), Gaps = 1/136 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E++F MIKPD V+R L+G I+   E  G  +   +   + +  AE  Y     +PF
Sbjct: 1   MATMEQSFIMIKPDGVQRGLVGEIIARFEKKGFTLKGLRLMQIEKSFAEKHYADLSAKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           F  LV+ + SGPV   V +G+  +   R+++G T+P  +  GTIR  + I +G N IHGS
Sbjct: 61  FGGLVEYVTSGPVVAMVWEGKGVVETGRKIIGATNPAASAPGTIRGDFAIDVGRNVIHGS 120

Query: 120 DSLKTALEEISYWFAR 135
           DS+  A +EI+ WF  
Sbjct: 121 DSVDNAKKEIALWFPD 136


>gi|188533170|ref|YP_001906967.1| nucleoside diphosphate kinase [Erwinia tasmaniensis Et1/99]
 gi|226729807|sp|B2VE97|NDK_ERWT9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|188028212|emb|CAO96070.1| Nucleoside diphosphate kinase [Erwinia tasmaniensis Et1/99]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N+IG+I    E  G  +V +K   ++++QAE FY  H+ +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNVIGAIFSRFESAGFKIVGSKMLHLSKEQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV + VL+G+ A+ ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPVVVSVLEGDNAVQRHRDLMGATNPANALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F   EI 
Sbjct: 121 SAESAAREIAYFFGEGEIC 139


>gi|259907714|ref|YP_002648070.1| nucleoside diphosphate kinase [Erwinia pyrifoliae Ep1/96]
 gi|292489051|ref|YP_003531938.1| Nucleoside diphosphate kinase [Erwinia amylovora CFBP1430]
 gi|292900180|ref|YP_003539549.1| nucleoside diphosphate kinase [Erwinia amylovora ATCC 49946]
 gi|224963336|emb|CAX54821.1| Nucleoside diphosphate kinase [Erwinia pyrifoliae Ep1/96]
 gi|283477568|emb|CAY73484.1| ndk [Erwinia pyrifoliae DSM 12163]
 gi|291200028|emb|CBJ47153.1| nucleoside diphosphate kinase [Erwinia amylovora ATCC 49946]
 gi|291554485|emb|CBA22017.1| Nucleoside diphosphate kinase [Erwinia amylovora CFBP1430]
 gi|310764778|gb|ADP09728.1| nucleoside diphosphate kinase [Erwinia sp. Ejp617]
 gi|312173206|emb|CBX81461.1| Nucleoside diphosphate kinase [Erwinia amylovora ATCC BAA-2158]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N+IG+I    E  G  +V +K   ++++QAE FY  H+ +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNVIGAIFNRFESAGFKIVGSKMLHLSKEQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV + VL+G+ A+ ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPVVVSVLEGDNAVQRHRDLMGATNPANALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F   EI 
Sbjct: 121 SAESAAREIAYFFGEGEIC 139


>gi|254480211|ref|ZP_05093459.1| Nucleoside diphosphate kinase superfamily protein [marine gamma
           proteobacterium HTCC2148]
 gi|214039773|gb|EEB80432.1| Nucleoside diphosphate kinase superfamily protein [marine gamma
           proteobacterium HTCC2148]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N++G I    E  GL +VA++   ++   A  FY  H++RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNIVGKIYSRFESNGLHIVASRMLRLSDVVAGGFYGEHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M SGPV +QVL+GE AI+KNRE+MG T+P++A +GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVEFMTSGPVVVQVLEGEGAIAKNRELMGATNPQEAAEGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA ++I 
Sbjct: 121 SPESAAREIAYFFAASDIC 139


>gi|124024773|ref|YP_001013889.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL1A]
 gi|166233000|sp|A2BZG4|NDK_PROM1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|123959841|gb|ABM74624.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL1A]
          Length = 151

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 84/139 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R LI  I+   E  G  +V  K    +++ AE  Y +HKDRPFF
Sbjct: 1   MTLERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKELAEKHYGVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +GE  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 61  SGLVDFITSGPVVAMVWEGEGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
              TA+ EI+ WF  NE++
Sbjct: 121 GSDTAVFEINLWFQENELV 139


>gi|9652119|gb|AAF91407.1|AF271362_1 nucleoside diphosphate kinase [Lolium perenne]
          Length = 150

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/134 (39%), Positives = 79/134 (58%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF MIKPD V+R LIG I+   E  G  +   K   + +  AE  Y     +PFF 
Sbjct: 1   MAEQTFIMIKPDGVQRGLIGEIISRFEKKGFYLKGLKLQNVEKSFAEQHYADLSSKPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ ++SGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSDS
Sbjct: 61  GLVEYIVSGPVVAMVWEGKSVVATGRKIIGATNPLASEPGTIRGDFAVDIGRNVIHGSDS 120

Query: 122 LKTALEEISYWFAR 135
           ++ A +EI+ WF  
Sbjct: 121 VENARKEIALWFPE 134


>gi|70726446|ref|YP_253360.1| nucleoside diphosphate kinase [Staphylococcus haemolyticus
           JCSC1435]
 gi|92090399|sp|Q4L6H1|NDK_STAHJ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|68447170|dbj|BAE04754.1| nucleoside diphosphate kinase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 149

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDA++RNL+G I+  +E  GL +V AK   + +  AE+ Y  H D+PF+ +
Sbjct: 1   MERTFLMIKPDAIQRNLVGEIISRIERKGLKLVGAKLMTVPQALAEEHYSEHTDKPFYGK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A+  +R ++G T+P +A  G+IR   G+++G N IHGSDS+
Sbjct: 61  LISFITSAPVFAMVVEGEDAVDVSRHIIGKTNPSEATPGSIRGDLGLTVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF   E+
Sbjct: 121 ESAQREINLWFKEEEL 136


>gi|16803968|ref|NP_465453.1| nucleoside diphosphate kinase [Listeria monocytogenes EGD-e]
 gi|47097439|ref|ZP_00234986.1| nucleoside diphosphate kinase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224501272|ref|ZP_03669579.1| hypothetical protein LmonFR_01905 [Listeria monocytogenes FSL
           R2-561]
 gi|254827186|ref|ZP_05231873.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL N3-165]
 gi|254899374|ref|ZP_05259298.1| hypothetical protein LmonJ_06159 [Listeria monocytogenes J0161]
 gi|254912487|ref|ZP_05262499.1| nucleoside diphosphate kinase [Listeria monocytogenes J2818]
 gi|254936814|ref|ZP_05268511.1| nucleoside diphosphate kinase [Listeria monocytogenes F6900]
 gi|255017109|ref|ZP_05289235.1| hypothetical protein LmonF_03643 [Listeria monocytogenes FSL
           F2-515]
 gi|255025693|ref|ZP_05297679.1| hypothetical protein LmonocytFSL_03930 [Listeria monocytogenes FSL
           J2-003]
 gi|284802374|ref|YP_003414239.1| hypothetical protein LM5578_2130 [Listeria monocytogenes 08-5578]
 gi|284995516|ref|YP_003417284.1| hypothetical protein LM5923_2081 [Listeria monocytogenes 08-5923]
 gi|20138833|sp|Q8Y5X4|NDK_LISMO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|16411382|emb|CAD00007.1| ndk [Listeria monocytogenes EGD-e]
 gi|47014194|gb|EAL05180.1| nucleoside diphosphate kinase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258599569|gb|EEW12894.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL N3-165]
 gi|258609409|gb|EEW22017.1| nucleoside diphosphate kinase [Listeria monocytogenes F6900]
 gi|284057936|gb|ADB68877.1| hypothetical protein LM5578_2130 [Listeria monocytogenes 08-5578]
 gi|284060983|gb|ADB71922.1| hypothetical protein LM5923_2081 [Listeria monocytogenes 08-5923]
 gi|293590469|gb|EFF98803.1| nucleoside diphosphate kinase [Listeria monocytogenes J2818]
          Length = 147

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y I    N IHGSDS 
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA +EI+
Sbjct: 121 ESAQREIQLFFAPDEIL 137


>gi|332296647|ref|YP_004438570.1| Nucleoside diphosphate kinase [Thermodesulfobium narugense DSM
           14796]
 gi|332179750|gb|AEE15439.1| Nucleoside diphosphate kinase [Thermodesulfobium narugense DSM
           14796]
          Length = 152

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  +IKPDAVKR L   I+   ED GL +V  K   +++++A + Y  HK +PFF  
Sbjct: 1   MERTLVLIKPDAVKRQLTSKILSRFEDKGLKIVGLKLMQLSKEKAMEHYAEHKKKPFFDN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGP+   VL+G++A++  R +MG T+P+ A  GTIR  + + +G N IHGSDS+
Sbjct: 61  LVSFITSGPIVAIVLEGKDAVTVVRTMMGTTNPRDAAPGTIRGDFAMDLGRNVIHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
            +A  EI  +F  +E++
Sbjct: 121 YSAEREIKIFFEEDEVL 137


>gi|294637695|ref|ZP_06715972.1| nucleoside diphosphate kinase [Edwardsiella tarda ATCC 23685]
 gi|291089125|gb|EFE21686.1| nucleoside diphosphate kinase [Edwardsiella tarda ATCC 23685]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KP+AV +N+IG+I    E  GL +VAAK   + R+QAE FY  H++RPFF
Sbjct: 1   MTLERTFSIVKPNAVAKNVIGAIYARFEAAGLSIVAAKMVHLTREQAEGFYAEHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE+A+ +NRE+MG T+P+ AL GT+R  Y  S+ EN++HGSD
Sbjct: 61  TGLVNFMTSGPIMVQVLEGEDAVRRNREIMGATNPENALAGTLRADYADSLTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+ +E+ 
Sbjct: 121 SPASAEREIAYFFSADELC 139


>gi|148910173|gb|ABR18168.1| unknown [Picea sitchensis]
          Length = 235

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 81/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +VA K    +++ AE  Y   K+RPFF  
Sbjct: 86  LERTFIAIKPDGVQRGLISEIVSRFERKGYKLVAIKLVVPSKEFAEQHYYDLKERPFFNG 145

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L + + SGPV   V +G+  I   R+++G TDP+ +  GTIR    I +G N IHGSD L
Sbjct: 146 LCEFLSSGPVLAMVWEGQGVIKYGRKLIGATDPQNSEPGTIRGDLAIIVGRNIIHGSDGL 205

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 206 ETAKNEINLWFKPEELV 222


>gi|317049140|ref|YP_004116788.1| Nucleoside-diphosphate kinase [Pantoea sp. At-9b]
 gi|316950757|gb|ADU70232.1| Nucleoside-diphosphate kinase [Pantoea sp. At-9b]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N+IG+I    E  G  +V AK   + ++QAE FY  HK RPFF
Sbjct: 1   MAIERTFSIVKPNAVAKNVIGAIYNRFESAGFKIVGAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV + VL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPVVVSVLEGENAVQRHRDLMGATNPDNALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA NE+ 
Sbjct: 121 STESAAREIAYFFAENEVC 139


>gi|224136442|ref|XP_002326861.1| predicted protein [Populus trichocarpa]
 gi|118482881|gb|ABK93355.1| unknown [Populus trichocarpa]
 gi|222835176|gb|EEE73611.1| predicted protein [Populus trichocarpa]
          Length = 148

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   + +  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFTLKGLKLLTVEQSFAEKHYEDLATKPFFSG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   + +G+  ++  R+++G T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 61  LVEYIISGPVVAMIWEGKGVVATGRKIIGATNPSASEPGTIRGDFAIHVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI  WF  
Sbjct: 121 ESATKEIGLWFPE 133


>gi|303257587|ref|ZP_07343599.1| nucleoside diphosphate kinase [Burkholderiales bacterium 1_1_47]
 gi|330999628|ref|ZP_08323337.1| nucleoside diphosphate kinase [Parasutterella excrementihominis YIT
           11859]
 gi|302859557|gb|EFL82636.1| nucleoside diphosphate kinase [Burkholderiales bacterium 1_1_47]
 gi|329574134|gb|EGG55710.1| nucleoside diphosphate kinase [Parasutterella excrementihominis YIT
           11859]
          Length = 142

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 76/138 (55%), Positives = 103/138 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E   L +VA+K  W++R++AE FY +H++RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFESNNLKIVASKMKWLSRQEAEAFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPV +QVL+GE AI KNRE+MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVQIQVLEGENAIMKNRELMGATDPKKAAKGTIRADFAQSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S +TA  EI+++F + +I
Sbjct: 121 SPETAAVEIAFFFPQMDI 138


>gi|170726136|ref|YP_001760162.1| nucleoside diphosphate kinase [Shewanella woodyi ATCC 51908]
 gi|226729861|sp|B1KNJ0|NDK_SHEWM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|169811483|gb|ACA86067.1| Nucleoside-diphosphate kinase [Shewanella woodyi ATCC 51908]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/139 (46%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNNIGAIYNRFETAGLKIIASKMVHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +Q L+GE A+  +R+++G T+P +A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQTLEGENAVLAHRDILGATNPAEAAPGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  E++Y+F+  E+ 
Sbjct: 121 SVASAEREVAYFFSAEELC 139


>gi|154550673|gb|ABS83502.1| expressed in non-metastatic cells 2 protein [Mus musculus]
          Length = 144

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/134 (44%), Positives = 82/134 (61%)

Query: 6   TFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQ 65
           TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP LV+
Sbjct: 1   TFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVK 60

Query: 66  AMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTA 125
            M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+++A
Sbjct: 61  YMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESA 120

Query: 126 LEEISYWFARNEII 139
            +EI  WF   E+I
Sbjct: 121 EKEIHLWFKPEELI 134


>gi|113474915|ref|YP_720976.1| nucleoside diphosphate kinase [Trichodesmium erythraeum IMS101]
 gi|119372157|sp|Q116S1|NDK_TRIEI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|110165963|gb|ABG50503.1| nucleoside diphosphate kinase [Trichodesmium erythraeum IMS101]
          Length = 149

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G I+   E  G  +V  K   + ++ AE  Y +HK+RPFF  
Sbjct: 1   MERTFIAIKPDGVQRGLVGQIISRFETKGFTLVGLKIMTVTKELAEKHYDVHKERPFFSS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGP+   V +GE  ++  R+++G T+P  A  GTIR  YGIS+G N IHGSD++
Sbjct: 61  LIEFIKSGPLVAMVWEGEGVVASARKIIGATNPLTAEPGTIRGDYGISLGRNLIHGSDAI 120

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 121 ETAQTEINLWFKEEELV 137


>gi|146283365|ref|YP_001173518.1| nucleoside diphosphate kinase [Pseudomonas stutzeri A1501]
 gi|166233007|sp|A4VNX5|NDK_PSEU5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|145571570|gb|ABP80676.1| nucleoside diphosphate kinase [Pseudomonas stutzeri A1501]
 gi|327481757|gb|AEA85067.1| nucleoside diphosphate kinase [Pseudomonas stutzeri DSM 4166]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDAV +N+IG I    E  GL VVA+K   ++ ++A  FY  H +R FF
Sbjct: 1   MALQRTFSIIKPDAVAKNVIGEITTRFEKAGLRVVASKMVQLSEREAAGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE A++KNRE+MG T+PK+A  GTIR  + +SI EN++HGSD
Sbjct: 61  KDLVAFMTSGPVIVQVLEGENAVAKNRELMGATNPKEAAPGTIRADFAVSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+FA  E+ 
Sbjct: 121 SEASAAREIAYFFAATEVC 139


>gi|325296919|ref|NP_001191452.1| nucleoside diphosphate kinase A [Monodelphis domestica]
          Length = 152

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LIG IVK  E  G  +VA KF   +     + Y+  KDRPF+  L
Sbjct: 5   ERTFIAIKPDGVQRGLIGEIVKRFEQKGFHLVALKFMQASEDLLREHYIDLKDRPFYAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GT+R  + I  G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRMMVGETNPADSKPGTVRGDFCIQSGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF  NE++
Sbjct: 125 SAEKEIGLWFHPNELV 140


>gi|226480472|emb|CAX78900.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
          Length = 148

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I++  E  G  ++A K    + +  +  Y   K  PFF  
Sbjct: 1   MERTFIMVKPDGVQRGLVGEIIQRFERRGYKLIAVKMIHASEQLLQTHYEALKSLPFFTN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV   V +G +A+   R ++G T P+ +  G+IR  +   +G N +HGSDS+
Sbjct: 61  LVAYMSSGPVVPMVFEGRKAVENGRTMLGATRPEASCPGSIRGDFCQDVGRNVVHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ WF+  E+ 
Sbjct: 121 ESANREINLWFSPQELC 137


>gi|85706351|ref|ZP_01037445.1| nucleoside diphosphate kinase [Roseovarius sp. 217]
 gi|85669124|gb|EAQ23991.1| nucleoside diphosphate kinase [Roseovarius sp. 217]
          Length = 140

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDA KRNL G I  + ED GL +VA K   +  +QA  FY +HK+RPF+
Sbjct: 1   MAVERTLSIIKPDATKRNLTGKINAKFEDAGLRIVAQKRIQLTPEQAGVFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGPV +QVL+GE A++KNREVMG T+P  A  GT+R ++  S+GENS+HGSD
Sbjct: 61  GELCEFMASGPVVVQVLEGEGAVAKNREVMGATNPADAAAGTVRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 ATETAAVEIAYFFSGLELVG 140


>gi|242035053|ref|XP_002464921.1| hypothetical protein SORBIDRAFT_01g028830 [Sorghum bicolor]
 gi|241918775|gb|EER91919.1| hypothetical protein SORBIDRAFT_01g028830 [Sorghum bicolor]
          Length = 149

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E TF MIKPD V+R LIG I+   E  G  + A K   + R  AE  Y     +PFF  
Sbjct: 1   MESTFIMIKPDGVQRGLIGEIISRFEKKGFYLKALKLVNVERSFAEKHYADLSSKPFFQG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSDS+
Sbjct: 61  LVDYIISGPVVAMVWEGKSVVTTGRKIIGATNPLASEPGTIRGDFAVDIGRNVIHGSDSI 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESANKEIALWFPE 133


>gi|18859071|ref|NP_571003.1| nucleoside diphosphate kinase 3 [Danio rerio]
 gi|166158092|ref|NP_001107454.1| hypothetical protein LOC100135302 [Xenopus (Silurana) tropicalis]
 gi|6644115|gb|AAF20912.1|AF202054_1 nucleoside diphosphate kinase-Z3 [Danio rerio]
 gi|50369514|gb|AAH76156.1| Ndpkz3 protein [Danio rerio]
 gi|156914931|gb|AAI52689.1| Ndpkz3 protein [Danio rerio]
 gi|163915749|gb|AAI57600.1| LOC100135302 protein [Xenopus (Silurana) tropicalis]
          Length = 169

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 82/137 (59%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+TF  +KPD V+R L+G I++  E  G  +V  K    +  Q    Y   +++PF+ 
Sbjct: 20  ANERTFLAVKPDGVQRRLVGEIIRRFERKGFKLVGMKLLQASEAQLRQHYWELREKPFYN 79

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M SGP+   V +G + +   R+++G+T+P  +L GTIR  Y + +G N IHGSDS
Sbjct: 80  GLVKYMSSGPIVAMVWQGLDVVKTARKMLGETNPADSLPGTIRGDYCVEVGRNVIHGSDS 139

Query: 122 LKTALEEISYWFARNEI 138
           +++A  EIS WF  +E+
Sbjct: 140 VESAAREISLWFEDHEL 156


>gi|118484128|gb|ABK93947.1| unknown [Populus trichocarpa]
          Length = 148

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   + +  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFTLKGLKLQTVEQSFAEKHYEDLAKKPFFAG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LVQ +ISGPV   + +G+  ++  R+++G T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 61  LVQYIISGPVVGMIWEGKGVVATGRKIIGATNPAASEPGTIRGDFAIDVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI  WF  
Sbjct: 121 ESATKEIGLWFPE 133


>gi|126174602|ref|YP_001050751.1| nucleoside diphosphate kinase [Shewanella baltica OS155]
 gi|153000897|ref|YP_001366578.1| nucleoside diphosphate kinase [Shewanella baltica OS185]
 gi|160875605|ref|YP_001554921.1| nucleoside diphosphate kinase [Shewanella baltica OS195]
 gi|217973146|ref|YP_002357897.1| nucleoside diphosphate kinase [Shewanella baltica OS223]
 gi|304408975|ref|ZP_07390596.1| Nucleoside-diphosphate kinase [Shewanella baltica OS183]
 gi|307302978|ref|ZP_07582733.1| Nucleoside-diphosphate kinase [Shewanella baltica BA175]
 gi|166233018|sp|A3D569|NDK_SHEB5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166233019|sp|A6WNX6|NDK_SHEB8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029054|sp|A9L3Q1|NDK_SHEB9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|254767250|sp|B8E9E1|NDK_SHEB2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|125997807|gb|ABN61882.1| nucleoside diphosphate kinase [Shewanella baltica OS155]
 gi|151365515|gb|ABS08515.1| Nucleoside-diphosphate kinase [Shewanella baltica OS185]
 gi|160861127|gb|ABX49661.1| Nucleoside-diphosphate kinase [Shewanella baltica OS195]
 gi|217498281|gb|ACK46474.1| Nucleoside-diphosphate kinase [Shewanella baltica OS223]
 gi|304352796|gb|EFM17193.1| Nucleoside-diphosphate kinase [Shewanella baltica OS183]
 gi|306913338|gb|EFN43760.1| Nucleoside-diphosphate kinase [Shewanella baltica BA175]
 gi|315267793|gb|ADT94646.1| Nucleoside-diphosphate kinase [Shewanella baltica OS678]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL +VA+K   + ++QAE FY  H +R FF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVASKMLHLTKEQAEGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  +RE++G T+P +A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F+  E+ 
Sbjct: 121 AVESAAREIAYFFSAEELC 139


>gi|18266786|sp|O58429|NDK_PYRHO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 157

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 3/138 (2%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T  +IKPDAV R LIG I+   E  GL +V  K  W++R+ AE  Y  H+++PFF  L
Sbjct: 5   ERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKAL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGSD 120
           +  +   PV + VL+G  A+   R++ G TDPK A  GTIR  +G+ + +   N IH SD
Sbjct: 65  IDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASD 124

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EIS +F   E+
Sbjct: 125 SKESAEREISLFFKPEEL 142


>gi|253999429|ref|YP_003051492.1| nucleoside diphosphate kinase [Methylovorus sp. SIP3-4]
 gi|313201451|ref|YP_004040109.1| nucleoside-diphosphate kinase [Methylovorus sp. MP688]
 gi|253986108|gb|ACT50965.1| Nucleoside-diphosphate kinase [Methylovorus sp. SIP3-4]
 gi|312440767|gb|ADQ84873.1| Nucleoside-diphosphate kinase [Methylovorus sp. MP688]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 70/138 (50%), Positives = 102/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    ED GL +VA++   +++ +AE FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGKIYTRFEDAGLKIVASRLAQLSQAEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE A+  +R++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  ADLVKFMISGPVVIQVLEGENAVLAHRDLMGATDPKKAAPGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A  EI+Y+F  +++
Sbjct: 121 SVENAAIEIAYFFPASQV 138


>gi|163746441|ref|ZP_02153799.1| Nucleoside-diphosphate kinase [Oceanibulbus indolifex HEL-45]
 gi|161380326|gb|EDQ04737.1| Nucleoside-diphosphate kinase [Oceanibulbus indolifex HEL-45]
          Length = 140

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G+IVK+ ED GL VVA K   + + QA +FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGAIVKKFEDAGLRVVAQKRIHLTKAQAGEFYKVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPIVAQVLEGENAIAKNREVMGATNPADAEAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|145299534|ref|YP_001142375.1| nucleoside diphosphate kinase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166232944|sp|A4SP05|NDK_AERS4 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|142852306|gb|ABO90627.1| nucleoside diphosphate kinase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 142

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAV +NLIG+I    E  GL V+AAK   M+ +QA  FY  H+ +PF+
Sbjct: 1   MAIERTFSIVKPDAVSKNLIGAIYNRFESAGLKVIAAKMLHMSSEQAAGFYAEHQGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE+AI ++RE+MG T+PK+AL GT+R  Y  SI  N++HGSD
Sbjct: 61  DGLVSFMTSGPVMVQVLEGEDAIRRHREIMGATNPKEALAGTLRACYAESIDRNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +  +A  EI+Y+F+ +EI 
Sbjct: 121 APASAAREIAYFFSDDEIC 139


>gi|239500769|ref|ZP_04660079.1| Nucleoside diphosphate kinase [Acinetobacter baumannii AB900]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 94/139 (67%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N IG I    E  GL +VA K   +++  AE FY  HK+R FF
Sbjct: 1   MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +RE++G T+PK+A  GTIR  + +SI EN+ HGSD
Sbjct: 61  GDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+F  NEI 
Sbjct: 121 SVASAEREIAYFFDDNEIC 139


>gi|212710619|ref|ZP_03318747.1| hypothetical protein PROVALCAL_01685 [Providencia alcalifaciens DSM
           30120]
 gi|212686700|gb|EEB46228.1| hypothetical protein PROVALCAL_01685 [Providencia alcalifaciens DSM
           30120]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKP+AVK+N+IG+I    E  G  +VAAK   + R+QAE FY  HK RPFF
Sbjct: 1   MAVQRTFSIIKPNAVKKNVIGAIYNRFESAGFKIVAAKMMHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ LQVL+GE AI ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPIMLQVLEGENAIQRHRDLMGATNPDNALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA +EI 
Sbjct: 121 SEESAAREIAYFFAADEIC 139


>gi|213511196|ref|NP_001134716.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|209735398|gb|ACI68568.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|223647142|gb|ACN10329.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|223673015|gb|ACN12689.1| Nucleoside diphosphate kinase A [Salmo salar]
 gi|303660927|gb|ADM16016.1| Nucleoside diphosphate kinase A [Salmo salar]
          Length = 152

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +VA K    +    +  Y+  KD PF
Sbjct: 1   MSNTERTFIAIKPDGVQRGLVGDIIKRFEQRGFRLVAMKMIQASEDLVKQHYIDLKDMPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           +  L   M SGPV   + +G   +   R ++G+T+P  +  G+IR  + I++G N IHGS
Sbjct: 61  YGGLCAFMHSGPVVAMIWEGLNVVKNGRLMLGETNPADSKPGSIRGDFCITLGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DSL +A +EI+ WF   E++
Sbjct: 121 DSLDSANKEIALWFKPEEMV 140


>gi|119774438|ref|YP_927178.1| nucleoside diphosphate kinase [Shewanella amazonensis SB2B]
 gi|166233017|sp|A1S552|NDK_SHEAM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119766938|gb|ABL99508.1| nucleoside diphosphate kinase [Shewanella amazonensis SB2B]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++AAK   + ++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFESAGLKIIAAKMVHLTKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  NRE+MG T+P +A +GT+R  Y  SI EN++HGSD
Sbjct: 61  GALVSFMTSGPIMVQVLEGENAVLANREIMGATNPAQAARGTLRADYAASIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +L +A  EI+Y+FA +E+ 
Sbjct: 121 ALASAEREIAYFFAADELC 139


>gi|297181693|gb|ADI17875.1| nucleoside diphosphate kinase [uncultured Chloroflexi bacterium
           HF0200_06I16]
          Length = 151

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  ++KPD V+R LIGSI+  LE  GL +V  K   ++   A   Y  H DRPFF  
Sbjct: 1   MERTLVLVKPDGVQRGLIGSIISRLEQRGLKLVGMKLMQVDDALARRHYEEHVDRPFFGG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV     +   A+   R  MG T+P  +  GTIR   G+ IG N +HGSDS 
Sbjct: 61  LVDFITSGPVVAMAWESNGAVEAVRSTMGQTNPTTSPPGTIRGDLGLDIGRNLVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  E+  +F+ +E++
Sbjct: 121 ESAQRELLLFFSESELL 137


>gi|296219278|ref|XP_002755808.1| PREDICTED: nucleoside diphosphate kinase 3-like [Callithrix
           jacchus]
          Length = 169

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF   L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFHGRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 82  VKYMASGPVVAMVWQGLDVVRASRALIGATNPADAQPGTIRGDFCIEVGKNLIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 142 SARREIALWFRAEELL 157


>gi|90410869|ref|ZP_01218883.1| nucleoside diphosphate kinase [Photobacterium profundum 3TCK]
 gi|90328082|gb|EAS44393.1| nucleoside diphosphate kinase [Photobacterium profundum 3TCK]
          Length = 142

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IEKTFS++KPDAVKRNLIG+I +  E+ GL +VA+K   ++  +A+ FY  H+ +PFF
Sbjct: 1   MTIEKTFSIVKPDAVKRNLIGAIYQRFENAGLKIVASKMVHLDATKAQGFYAEHEGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGPV +QVL+GE+AI + RE+MG T+P+ A  GTIR+ + +S+  NS+HGSD
Sbjct: 61  NELVEFMTSGPVMVQVLEGEDAIHRYRELMGTTNPENAACGTIRSDFALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SPESAAREIAYFFTEDEIC 139


>gi|127513238|ref|YP_001094435.1| nucleoside-diphosphate kinase [Shewanella loihica PV-4]
 gi|166233020|sp|A3QFC8|NDK_SHELP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|126638533|gb|ABO24176.1| nucleoside diphosphate kinase [Shewanella loihica PV-4]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIIASKMVHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+  NRE+MG T+P +A +GT+R  +  SI EN++HGSD
Sbjct: 61  GALVEFMTSGPIMVQVLEGENAVLANREIMGATNPAEAARGTLRADFADSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++ +A  EI+Y+F+  E+ 
Sbjct: 121 AVASAEREIAYFFSAEELC 139


>gi|325577352|ref|ZP_08147800.1| nucleoside diphosphate kinase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160676|gb|EGC72798.1| nucleoside diphosphate kinase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 139

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 97/137 (70%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKR+LIG+I+   E  G  VVA K   + ++QAE FY  H+ +PFF 
Sbjct: 1   MTERTFSIIKPDAVKRHLIGAILGRFESQGFRVVALKMVQLTKEQAEGFYAEHQGKPFFD 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+SGP+ + VL+ E A+   R ++G T+P +A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMLSGPIVVSVLEKENAVKDYRTLIGSTNPAEAAEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           +++A  EI+Y+F  +EI
Sbjct: 121 IESAKREIAYFFVDSEI 137


>gi|325919432|ref|ZP_08181458.1| nucleoside diphosphate kinase [Xanthomonas gardneri ATCC 19865]
 gi|325550098|gb|EGD20926.1| nucleoside diphosphate kinase [Xanthomonas gardneri ATCC 19865]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYSRFEKAGLKIVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +Q L+GE A++ +R+++G T+PK A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVVIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA  E++
Sbjct: 121 SVENAANEVAYFFAATEVV 139


>gi|198283709|ref|YP_002220030.1| nucleoside diphosphate kinase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667431|ref|YP_002426338.1| nucleoside diphosphate kinase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226724545|sp|B7JC26|NDK_ACIF2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226724546|sp|B5EJE9|NDK_ACIF5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|198248230|gb|ACH83823.1| Nucleoside-diphosphate kinase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519644|gb|ACK80230.1| nucleoside diphosphate kinase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV++N IG+I+   E  GL + AAK   ++R  A  FY +H+ RPF+
Sbjct: 1   MAVERTLSIIKPDAVQKNAIGAILGRFEKAGLRIAAAKMLHLSRDDAGGFYAVHQARPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL   M SGPV + VL+GE AI+KNR++MG T+PK A  GTIR  +  SI  N++HGSD
Sbjct: 61  GELCDFMSSGPVLVTVLEGEGAIAKNRDLMGATNPKDAAAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S +TA  EISY+F + EI
Sbjct: 121 SAETAAWEISYFFGQREI 138


>gi|260771399|ref|ZP_05880324.1| nucleoside diphosphate kinase [Vibrio furnissii CIP 102972]
 gi|260613525|gb|EEX38719.1| nucleoside diphosphate kinase [Vibrio furnissii CIP 102972]
 gi|315180980|gb|ADT87894.1| nucleoside diphosphate kinase [Vibrio furnissii NCTC 11218]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+RNLIG I   +E  G+ +VAAK   +   QA  FY  H+ + FF
Sbjct: 1   MALERTFSIIKPDAVERNLIGEIYHRIEKAGMRIVAAKMLHLTEAQASGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AI++ RE+MG T+P++A  GT+R  Y IS+  NS+HGSD
Sbjct: 61  PGLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTLRADYAISMRLNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI ++F  +E+ 
Sbjct: 121 SPASAAREIEFFFPESELC 139


>gi|169634408|ref|YP_001708144.1| nucleoside diphosphate kinase (NDK) (NDP kinase) (nucleoside-2-P
           kinase) [Acinetobacter baumannii SDF]
 gi|169797247|ref|YP_001715040.1| nucleoside diphosphate kinase (NDK) (NDP kinase) (nucleoside-2-P
           kinase) [Acinetobacter baumannii AYE]
 gi|184156827|ref|YP_001845166.1| nucleoside diphosphate kinase [Acinetobacter baumannii ACICU]
 gi|213155959|ref|YP_002318004.1| nucleoside diphosphate kinase [Acinetobacter baumannii AB0057]
 gi|215484688|ref|YP_002326923.1| Nucleoside diphosphate kinase [Acinetobacter baumannii AB307-0294]
 gi|260549077|ref|ZP_05823298.1| nucleoside diphosphate kinase [Acinetobacter sp. RUH2624]
 gi|260556129|ref|ZP_05828348.1| nucleoside diphosphate kinase [Acinetobacter baumannii ATCC 19606]
 gi|293610292|ref|ZP_06692593.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|301346478|ref|ZP_07227219.1| nucleoside diphosphate kinase [Acinetobacter baumannii AB056]
 gi|301510160|ref|ZP_07235397.1| nucleoside diphosphate kinase [Acinetobacter baumannii AB058]
 gi|301594217|ref|ZP_07239225.1| nucleoside diphosphate kinase [Acinetobacter baumannii AB059]
 gi|332851248|ref|ZP_08433321.1| nucleoside diphosphate kinase [Acinetobacter baumannii 6013150]
 gi|332866103|ref|ZP_08436831.1| nucleoside diphosphate kinase [Acinetobacter baumannii 6013113]
 gi|332873242|ref|ZP_08441199.1| nucleoside diphosphate kinase [Acinetobacter baumannii 6014059]
 gi|226724540|sp|B7H073|NDK_ACIB3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226724541|sp|B7I5G3|NDK_ACIB5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226724542|sp|B2I3E1|NDK_ACIBC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226724543|sp|B0VKS3|NDK_ACIBS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226724544|sp|B0V4U1|NDK_ACIBY RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226724702|sp|A3M207|NDK_ACIBT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|169150174|emb|CAM88068.1| nucleoside diphosphate kinase (NDK) (NDP kinase) (Nucleoside-2-P
           kinase) [Acinetobacter baumannii AYE]
 gi|169153200|emb|CAP02292.1| nucleoside diphosphate kinase (NDK) (NDP kinase) (Nucleoside-2-P
           kinase) [Acinetobacter baumannii]
 gi|183208421|gb|ACC55819.1| Nucleoside diphosphate kinase [Acinetobacter baumannii ACICU]
 gi|193076306|gb|ABO10951.2| nucleoside diphosphate kinase [Acinetobacter baumannii ATCC 17978]
 gi|213055119|gb|ACJ40021.1| nucleoside diphosphate kinase [Acinetobacter baumannii AB0057]
 gi|213987150|gb|ACJ57449.1| Nucleoside diphosphate kinase [Acinetobacter baumannii AB307-0294]
 gi|260407805|gb|EEX01277.1| nucleoside diphosphate kinase [Acinetobacter sp. RUH2624]
 gi|260410184|gb|EEX03483.1| nucleoside diphosphate kinase [Acinetobacter baumannii ATCC 19606]
 gi|292827524|gb|EFF85888.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|322506719|gb|ADX02173.1| Nucleoside diphosphate kinase [Acinetobacter baumannii 1656-2]
 gi|323516593|gb|ADX90974.1| nucleoside diphosphate kinase [Acinetobacter baumannii TCDC-AB0715]
 gi|325124473|gb|ADY83996.1| nucleoside diphosphate kinase (NDK) [Acinetobacter calcoaceticus
           PHEA-2]
 gi|332730128|gb|EGJ61455.1| nucleoside diphosphate kinase [Acinetobacter baumannii 6013150]
 gi|332734849|gb|EGJ65942.1| nucleoside diphosphate kinase [Acinetobacter baumannii 6013113]
 gi|332738754|gb|EGJ69624.1| nucleoside diphosphate kinase [Acinetobacter baumannii 6014059]
          Length = 143

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N IG I    E  GL +VA K   +++  AE FY  HK+R FF
Sbjct: 1   MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +RE++G T+PK+A  GTIR  + +SI EN+ HGSD
Sbjct: 61  GDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+FA NEI 
Sbjct: 121 SVASAEREIAYFFADNEIC 139


>gi|92090375|sp|Q6MEA9|NDK1_PARUW RecName: Full=Nucleoside diphosphate kinase 1; Short=NDK 1;
           Short=NDP kinase 1; AltName: Full=Nucleoside-2-P kinase
           1
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV+ N IG I+   E  GL + A K   + + QA  FY IHKDRPF+
Sbjct: 1   MASEQTLSIIKPDAVQNNYIGEIISRFEQAGLKIAAIKMTTLTKDQASKFYAIHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+G +AI+KNRE+MG TDPKKA KGT+R  +  S+  N++HGSD
Sbjct: 61  NDLVNFMSSGPVVVMVLEGNQAIAKNRELMGATDPKKAEKGTLRADFAESMSRNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S +TA EE+ ++F  +EI
Sbjct: 121 SSETAEEEVLFFFKPDEI 138


>gi|84516306|ref|ZP_01003666.1| Nucleoside diphosphate kinase [Loktanella vestfoldensis SKA53]
 gi|84510002|gb|EAQ06459.1| Nucleoside diphosphate kinase [Loktanella vestfoldensis SKA53]
          Length = 140

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 109/140 (77%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA KRNL G+IV + E+ GL +VA+K   +   QA+ FY +HKDRPFF
Sbjct: 1   MAIQRTFSIIKPDATKRNLTGAIVAKFEEAGLRIVASKRIHLTLAQAQQFYGVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + MIS P+ +QVL+GE+AI+KNREVMG T+P  A  GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELCEFMISEPIVVQVLEGEDAIAKNREVMGATNPADAAPGTIRKEFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|261345337|ref|ZP_05972981.1| nucleoside diphosphate kinase [Providencia rustigianii DSM 4541]
 gi|282566378|gb|EFB71913.1| nucleoside diphosphate kinase [Providencia rustigianii DSM 4541]
          Length = 141

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKP+AVK+N+IG+I    E+ G  +VAAK   + R+QAE FY  HK RPFF
Sbjct: 1   MAVQRTFSIIKPNAVKKNVIGAIYNRFENAGFSIVAAKMMHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ LQVL+GE AI ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPIMLQVLEGENAIQRHRDLMGATNPDNALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SEESAAREIAYFFTADEIC 139


>gi|119372025|sp|Q1IXQ0|NDK_DEIGD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 138

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF+MIKPD V+R L   I+  ++  G  VV  K   ++R+ AE  Y  H++RPFF E
Sbjct: 1   MERTFAMIKPDGVRRGLTPEILARIQKKGYRVVGLKQMLISRELAERHYAEHRERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV    L+GE AI+  R +MG T+P  A  GTIR  +  + GEN  HGSDS 
Sbjct: 61  LVDFITSGPVVAIALEGENAIAGWRAMMGATNPANAAPGTIRADFATTTGENVTHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  E+S +F  +E++
Sbjct: 121 ESAARELSLFFREDELL 137


>gi|50295020|ref|XP_449921.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49529235|emb|CAG62901.1| unnamed protein product [Candida glabrata]
          Length = 152

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LIG I+   E  G  +V  K    ++K  E  Y  H  +PFF  +
Sbjct: 5   ERTFIAIKPDGVQRGLIGKILGRFETRGYKLVGIKLIQADQKLLEQHYAEHIGKPFFGPM 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
              M SGP+   V +G++A+ + R ++G T+P ++  GTIR  +GI +G N  HGSDS++
Sbjct: 65  TAFMSSGPILATVWEGKDAVKQGRAMLGATNPTQSAPGTIRGDFGIDLGRNVCHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI  WF + E++
Sbjct: 125 SANREIGIWFKKEELV 140


>gi|159480348|ref|XP_001698246.1| flagellar associated protein, nucleoside diphosphate kinase-like
           protein [Chlamydomonas reinhardtii]
 gi|158273744|gb|EDO99531.1| flagellar associated protein, nucleoside diphosphate kinase-like
           protein [Chlamydomonas reinhardtii]
          Length = 150

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 78/135 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+++ MIKPD V+R L+G ++K  E  G  +   K   + +  AE  Y     RPFF
Sbjct: 1   MATEQSYIMIKPDGVQRGLVGEVIKRFEQRGYTLKGLKLMNVEKSLAEKHYEDLSARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  + SGPV   V +G+  ++  R+++G T+P  +  GTIR  + I +G N IHGSD
Sbjct: 61  PALVDYICSGPVVAMVWEGKGVVATGRKMIGATNPLASEPGTIRGDFAIEVGRNVIHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S+++A  EI  WF  
Sbjct: 121 SVESATREIGLWFPE 135


>gi|297621761|ref|YP_003709898.1| Nucleoside diphosphate kinase [Waddlia chondrophila WSU 86-1044]
 gi|297377062|gb|ADI38892.1| Nucleoside diphosphate kinase [Waddlia chondrophila WSU 86-1044]
          Length = 143

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPD + +N++G ++ +LE  GL +VAAK   + ++QA+ FY +HK+RPFF
Sbjct: 1   MATERTLSIIKPDGIGKNVVGEVISKLEKGGLKIVAAKMLHLTQEQAQGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+G++AI KNRE+MG T+P +A  GTIR ++  +I EN +HGSD
Sbjct: 61  NDLVAFMTSGPVMVMVLEGDDAILKNREIMGATNPAEANPGTIRAEFATTIDENVVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S +TA  EI+++F+  EI 
Sbjct: 121 SPETAKTEINFFFSPEEIC 139


>gi|118487555|gb|ABK95604.1| unknown [Populus trichocarpa]
          Length = 148

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   + +  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFTLKGLKLQTVEQSFAEKHYEDLAKKPFFAG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LVQ +ISGPV   + +G+  ++  R+++G T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 61  LVQYIISGPVVAMIWEGKGVVATGRKIIGATNPAASEPGTIRGDFAIDVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI  WF  
Sbjct: 121 ESATKEIGLWFPE 133


>gi|21283087|ref|NP_646175.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486308|ref|YP_043529.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297207872|ref|ZP_06924305.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911957|ref|ZP_07129400.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|23821868|sp|Q8NWN1|NDK_STAAW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|56749119|sp|Q6G994|NDK_STAAS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|21204527|dbj|BAB95223.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49244751|emb|CAG43187.1| putative nucleoside diphosphate kinase [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|296887446|gb|EFH26346.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300886203|gb|EFK81405.1| nucleoside-diphosphate kinase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 149

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 92/136 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG ++  +E  GL +V  K   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
            +A  EI+ WF  NEI
Sbjct: 121 DSAEREINLWFNENEI 136


>gi|85101495|ref|XP_961162.1| nucleoside diphosphate kinase, variant [Neurospora crassa OR74A]
 gi|30316340|sp|Q9UUY8|NDK_NEUCR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|21622341|emb|CAD37041.1| nucleoside-diphosphate kinase [Neurospora crassa]
 gi|28922702|gb|EAA31926.1| nucleoside diphosphate kinase, variant [Neurospora crassa OR74A]
          Length = 152

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 50/135 (37%), Positives = 79/135 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G+I+   E+ G  +VA K     +   E  Y     +PFF  L
Sbjct: 5   EQTFIAVKPDGVQRGLVGNIISRFENRGFKLVAMKLTQPGQAHLEKHYEDLNTKPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGP+   V +G++A+   R ++G T+P  +  GTIR  + + +G N  HGSDS++
Sbjct: 65  IKYMNSGPICAMVWEGKDAVKTGRTILGATNPLASAPGTIRGDFALDMGRNVCHGSDSVE 124

Query: 124 TALEEISYWFARNEI 138
            A +EI+ WF   E+
Sbjct: 125 NAKKEIALWFKPEEL 139


>gi|194696816|gb|ACF82492.1| unknown [Zea mays]
 gi|195608726|gb|ACG26193.1| nucleoside diphosphate kinase 1 [Zea mays]
 gi|195609188|gb|ACG26424.1| nucleoside diphosphate kinase 1 [Zea mays]
 gi|195616172|gb|ACG29916.1| nucleoside diphosphate kinase 1 [Zea mays]
 gi|195622856|gb|ACG33258.1| nucleoside diphosphate kinase 1 [Zea mays]
 gi|223943855|gb|ACN26011.1| unknown [Zea mays]
          Length = 149

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E TF MIKPD V+R LIG I+   E  G  + A K   + R  AE  Y     +PFF  
Sbjct: 1   MESTFIMIKPDGVQRGLIGEIISRFEKKGFYLKALKLVNVERSFAEKHYADLASKPFFQG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSDS+
Sbjct: 61  LVDYIISGPVVAMVWEGKSVVTTGRKIIGATNPLASEPGTIRGDFAVDIGRNVIHGSDSI 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESANKEIALWFPE 133


>gi|254513996|ref|ZP_05126057.1| nucleoside-diphosphate kinase [gamma proteobacterium NOR5-3]
 gi|219676239|gb|EED32604.1| nucleoside-diphosphate kinase [gamma proteobacterium NOR5-3]
          Length = 142

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N IG I    E  GL +VAAK   ++   A  FY  H++RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNHIGEIYARFEGAGLRIVAAKMLRLSDAVAGGFYAEHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGPV +QVL+GE A++ NR++MG T+P++A  GTIR  +  SI  N++HGSD
Sbjct: 61  PALIEFMTSGPVVVQVLEGENAVATNRDLMGATNPQEAAAGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+FA +E+ 
Sbjct: 121 STTSAAREIAYFFASSEVC 139


>gi|254466257|ref|ZP_05079668.1| nucleoside diphosphate kinase [Rhodobacterales bacterium Y4I]
 gi|206687165|gb|EDZ47647.1| nucleoside diphosphate kinase [Rhodobacterales bacterium Y4I]
          Length = 140

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   M ++QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHMTKEQAGKFYEVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMSSAPVVVQVLEGENAIAKNREVMGATNPADAAAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGIELVG 140


>gi|302793166|ref|XP_002978348.1| hypothetical protein SELMODRAFT_109077 [Selaginella moellendorffii]
 gi|300153697|gb|EFJ20334.1| hypothetical protein SELMODRAFT_109077 [Selaginella moellendorffii]
          Length = 148

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 50/133 (37%), Positives = 76/133 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E++F MIKPD V+R L+G I+   E  G  +   +   + +  AE  Y     +PFF  
Sbjct: 1   MEQSFIMIKPDGVQRGLVGEIIARFEKKGFTLKGLRLMQIEKSFAEKHYADLSAKPFFGG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   V +G+  +   R+++G T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 61  LVEYVTSGPVVAMVWEGKGVVETGRKIIGATNPAASAPGTIRGDFAIDVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
             A +EI+ WF  
Sbjct: 121 DNAKKEIALWFPD 133


>gi|9931512|gb|AAG02199.1|AF288689_1 nucleoside diphosphate kinase C [Mus musculus]
 gi|9931516|gb|AAG02201.1|AF288691_1 nucleoside diphosphate kinase C [Mus musculus]
 gi|148690436|gb|EDL22383.1| expressed in non-metastatic cells 3 [Mus musculus]
          Length = 169

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y+  +++PF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G TDP  A+ GTIR  + + +G+N IHGSDS++
Sbjct: 82  VKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCVEVGKNVIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 142 SAHREIALWFREAELL 157


>gi|269203094|ref|YP_003282363.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           ED98]
 gi|262075384|gb|ACY11357.1| nucleoside diphosphate kinase [Staphylococcus aureus subsp. aureus
           ED98]
          Length = 149

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG ++  +E  GL +V  K   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMEHAETHYGEHQGKPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI+ WF  NEI
Sbjct: 121 ESAEREINLWFNENEI 136


>gi|168056626|ref|XP_001780320.1| NDPK3a nucleotide diphosphate kinase 3protein [Physcomitrella
           patens subsp. patens]
 gi|162668268|gb|EDQ54879.1| NDPK3a nucleotide diphosphate kinase 3protein [Physcomitrella
           patens subsp. patens]
          Length = 151

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 74/139 (53%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R LI  I+   E  G  +VA K     ++ A   Y     RPFF
Sbjct: 1   MQLERTFIAIKPDGVQRGLISEIIGRFERKGYKLVAIKLIVPTKEFAAQHYDDLSSRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L   + SGPV   V +G+  I   R+++G T P+ +  GTIR    + +  N IHGSD
Sbjct: 61  NGLCDFLSSGPVVAMVWEGQGVIKYGRKLIGATSPQASEPGTIRGDLCVQVSRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
             +TA+ EI  WF   E++
Sbjct: 121 GPETAVNEIGLWFKPEELV 139


>gi|119364622|sp|Q5N1M1|NDK_SYNP6 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119364623|sp|P50590|NDK_SYNE7 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 149

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 91/136 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R L+G+I+   E  G  +V  K    +R+ AE  Y +H++RPFF  
Sbjct: 1   MERTFIAIKPDGVQRGLVGTIIGRFEQKGFKLVGLKQLKPSRELAEQHYAVHRERPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGP+   VL+GE  ++  R+++G T+P  A  GTIR  +G++IG N IHGSD++
Sbjct: 61  LVEFITSGPIVAIVLEGEGVVAAARKLIGATNPLTAEPGTIRGDFGVNIGRNIIHGSDAI 120

Query: 123 KTALEEISYWFARNEI 138
           +TA +EI+ WF+  E+
Sbjct: 121 ETAQQEIALWFSPAEL 136


>gi|148653703|ref|YP_001280796.1| nucleoside diphosphate kinase [Psychrobacter sp. PRwf-1]
 gi|172048560|sp|A5WGQ5|NDK_PSYWF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|148572787|gb|ABQ94846.1| nucleoside diphosphate kinase [Psychrobacter sp. PRwf-1]
          Length = 143

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV  N IG+I    E+ GL +V AK   ++ ++A  FY  HK+RPF+
Sbjct: 1   MAIERTLSIIKPDAVGGNHIGAIYSRFEEAGLKIVGAKMLHLDDEKAGGFYAEHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE AI+K+RE+MG T+P +A +GTIR  +  SI EN++HGSD
Sbjct: 61  NDLVSFMTSGPVVVSVLEGENAIAKHREIMGATNPAEAAEGTIRKDFASSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F+ NE++
Sbjct: 121 SAESAKREIAYFFSDNEVL 139


>gi|255321141|ref|ZP_05362307.1| nucleoside diphosphate kinase [Acinetobacter radioresistens SK82]
 gi|262380170|ref|ZP_06073325.1| nucleoside diphosphate kinase [Acinetobacter radioresistens SH164]
 gi|255301695|gb|EET80946.1| nucleoside diphosphate kinase [Acinetobacter radioresistens SK82]
 gi|262298364|gb|EEY86278.1| nucleoside diphosphate kinase [Acinetobacter radioresistens SH164]
          Length = 143

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 94/139 (67%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S++KPDAV +N IG I    E  GL +VA K   + + +AE FY  HK+R FF
Sbjct: 1   MAVERTLSIVKPDAVAKNHIGDIFARFEKAGLKIVATKMKHLTQAEAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +R+++G T+PK+A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GDLVAFMTSGPVVVSVLEGENAVLAHRDILGATNPKEAAPGTIRADFATSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+FA NEI 
Sbjct: 121 SVASAEREIAYFFADNEIC 139


>gi|18413214|ref|NP_567346.1| NDPK1; ATP binding / nucleoside diphosphate kinase [Arabidopsis
           thaliana]
 gi|332657342|gb|AEE82742.1| nucleoside diphosphate kinase 1 [Arabidopsis thaliana]
          Length = 169

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 77/134 (57%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+TF MIKPD V+R LIG ++   E  G  +   K   + R  AE  Y     + FF 
Sbjct: 20  TMEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFS 79

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  ++SGPV   + +G+  +   R+++G T+P  +  GTIR  + I IG N IHGSDS
Sbjct: 80  GLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDS 139

Query: 122 LKTALEEISYWFAR 135
           +++A +EI+ WF  
Sbjct: 140 VESARKEIALWFPD 153


>gi|269926488|ref|YP_003323111.1| Nucleoside-diphosphate kinase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790148|gb|ACZ42289.1| Nucleoside-diphosphate kinase [Thermobaculum terrenum ATCC BAA-798]
          Length = 151

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  ++KPDAV+R LIG ++  +E  GL +VA K   ++R+ A   Y  H ++PFF  
Sbjct: 1   MERTLVIVKPDAVQRGLIGEVIARIERTGLKLVALKLSKIDRETAHTHYQEHVNKPFFQG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV L V +G  A+S  R+ MG T+P  ++ G+IR    IS+G N IHGSDS 
Sbjct: 61  LVNFITSGPVVLAVFEGPNAVSIVRKTMGATNPVDSVPGSIRGDLAISLGRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EIS +F+ +EI+
Sbjct: 121 ESAEREISIFFSPDEIL 137


>gi|57168470|ref|ZP_00367604.1| nucleoside diphosphate kinase Cj0332c [Campylobacter coli RM2228]
 gi|305432889|ref|ZP_07402047.1| nucleoside diphosphate kinase [Campylobacter coli JV20]
 gi|57020278|gb|EAL56952.1| nucleoside diphosphate kinase Cj0332c [Campylobacter coli RM2228]
 gi|304444043|gb|EFM36698.1| nucleoside diphosphate kinase [Campylobacter coli JV20]
          Length = 137

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 99/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAEAFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGEGAVLKNRDLMGATNPKEAQPGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F  NEI 
Sbjct: 121 ENAKIEIEFFFKSNEIC 137


>gi|312136674|ref|YP_004004011.1| nucleoside diphosphate kinase [Methanothermus fervidus DSM 2088]
 gi|311224393|gb|ADP77249.1| nucleoside diphosphate kinase [Methanothermus fervidus DSM 2088]
          Length = 150

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 93/137 (67%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           ++EKTF MIKPDAVKR LIG I++  E  GL +VA K   ++++ A+  Y  HKD+PFF 
Sbjct: 1   MMEKTFVMIKPDAVKRRLIGEIIQRFEKRGLQIVAMKMVDVDKELAKKHYAEHKDKPFFK 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           +L++ + S PV + VLKG+  IS  R+++G TDPK+A  GTIR  + + IG N IH SDS
Sbjct: 61  DLIKYITSSPVVVLVLKGKNCISVVRKMVGATDPKEAESGTIRGDFALEIGRNIIHASDS 120

Query: 122 LKTALEEISYWFARNEI 138
            ++A  EI  +F  +EI
Sbjct: 121 PESAEREIKLFFKNSEI 137


>gi|269140149|ref|YP_003296850.1| nucleoside diphosphate kinase [Edwardsiella tarda EIB202]
 gi|267985810|gb|ACY85639.1| nucleoside diphosphate kinase [Edwardsiella tarda EIB202]
 gi|304559983|gb|ADM42647.1| Nucleoside diphosphate kinase [Edwardsiella tarda FL6-60]
          Length = 143

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KP+AV +N IG+I    E  GL +VAAK   + R+QAE FY  H++RPFF
Sbjct: 1   MTLERTFSIVKPNAVAKNAIGAIYARFESAGLKIVAAKMVHLTREQAEGFYAEHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+G +A+ +NRE+MG T+P+ AL GT+R  Y  S+ EN++HGSD
Sbjct: 61  DGLVTFMTSGPIMVQVLEGNDAVRRNREIMGATNPENALAGTLRADYADSLTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+ ++I 
Sbjct: 121 SPASAEREIAYFFSADDIC 139


>gi|237808757|ref|YP_002893197.1| Nucleoside-diphosphate kinase [Tolumonas auensis DSM 9187]
 gi|259511721|sp|C4L7J5|NDK_TOLAT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|237501018|gb|ACQ93611.1| Nucleoside-diphosphate kinase [Tolumonas auensis DSM 9187]
          Length = 143

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N+IG I    E  GL ++AAK   ++++QA  FY  HK +PF+
Sbjct: 1   MTIERTFSIIKPDAVAKNIIGEIYHRFECAGLHIIAAKMLHLSQEQAAGFYAEHKGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L++ M SGP+ +QVL+G++AI ++RE++G TDP+KA  GTIR  + IS+ +N++HGSD
Sbjct: 61  DNLLKFMTSGPIVVQVLEGQDAIRRHRELLGSTDPEKAQAGTIRADHAISVTQNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI ++F  +EI 
Sbjct: 121 SSESAAREIEFFFTEDEIC 139


>gi|301769587|ref|XP_002920240.1| PREDICTED: nucleoside diphosphate kinase, mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 199

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K      +   + Y   + +PF+P L
Sbjct: 50  ERTLVAVKPDGVQRRLVGDVIQRFERRGFKLVGMKMLQAPERVLAEHYHDLQRKPFYPAL 109

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G TD  +A  GTIR  + I I  N IH SDS++
Sbjct: 110 ISYMTSGPVVAMVWEGPNVVCSSRAMIGHTDSAEAAPGTIRGDFSIHISRNIIHASDSVE 169

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 170 GAQREIQLWFQSSELV 185


>gi|260576755|ref|ZP_05844740.1| Nucleoside-diphosphate kinase [Rhodobacter sp. SW2]
 gi|259021007|gb|EEW24318.1| Nucleoside-diphosphate kinase [Rhodobacter sp. SW2]
          Length = 140

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 99/140 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA KRNL G IV + ED GL VVA+K   ++  QA  FY  H  R F+
Sbjct: 1   MAIERTLSIIKPDATKRNLTGKIVAKFEDAGLRVVASKRIHLSLAQAGAFYAEHAARGFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNR+VMG T+P  A  GTIR ++ +S+GENS+HGSD
Sbjct: 61  GELCEFMASEPVVVQVLQGEGAIAKNRDVMGATNPANAADGTIRKEFALSVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S  +A  EI+++F+  E++G
Sbjct: 121 SEASAAREIAFFFSGLELVG 140


>gi|224418701|ref|ZP_03656707.1| nucleoside diphosphate kinase (NDK; NDP kinase; nucleoside-2-P
           kinase) [Helicobacter canadensis MIT 98-5491]
 gi|253826765|ref|ZP_04869650.1| nucleoside diphosphate kinase [Helicobacter canadensis MIT 98-5491]
 gi|313142224|ref|ZP_07804417.1| guanosine pentaphosphate phosphohydrolase [Helicobacter canadensis
           MIT 98-5491]
 gi|253510171|gb|EES88830.1| nucleoside diphosphate kinase [Helicobacter canadensis MIT 98-5491]
 gi|313131255|gb|EFR48872.1| guanosine pentaphosphate phosphohydrolase [Helicobacter canadensis
           MIT 98-5491]
          Length = 137

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 98/137 (71%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+N+IG I+   E  GL + A K   +++  A++FY IHK RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKNVIGKIIDRFESNGLRIAAMKKVQLSQSDAQEFYAIHKSRPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV + VL+G  A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVTFMVSGPVVVMVLEGLNAVAKNRELMGATNPKEAAAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A +EI ++FA  EI 
Sbjct: 121 ENAEKEIKFFFAEREIC 137


>gi|313902017|ref|ZP_07835432.1| nucleoside diphosphate kinase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467741|gb|EFR63240.1| nucleoside diphosphate kinase [Thermaerobacter subterraneus DSM
           13965]
          Length = 151

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I+  LE  GL +V  K   ++ + A   Y  H+ +PFFP 
Sbjct: 1   MERTFVMVKPDGVQRGLVGEIIARLERKGLKLVGLKMVQVSEELARRHYAAHEGKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + S PV   V +G EA++  R +MG TD  KA  GTIR      IG N +HGSDSL
Sbjct: 61  LIRFITSAPVVAMVWEGREAVNVVRNLMGPTDGAKAAPGTIRGDLANDIGFNLVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A +EI  WF ++E+I
Sbjct: 121 ESARQEIELWFRQDELI 137


>gi|55980157|ref|YP_143454.1| nucleoside diphosphate kinase [Thermus thermophilus HB8]
 gi|67460632|sp|Q5SLV5|NDK_THET8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|75765323|pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Thermus Thermophilus Hb8
 gi|75765324|pdb|1WKJ|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Thermus Thermophilus Hb8
 gi|75765325|pdb|1WKK|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Thermus Thermophilus Hb8 In Complex With Gdp
 gi|75765326|pdb|1WKK|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Thermus Thermophilus Hb8 In Complex With Gdp
 gi|75765327|pdb|1WKL|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Thermus Thermophilus Hb8 In Complex With Atp And Adp
 gi|75765328|pdb|1WKL|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Thermus Thermophilus Hb8 In Complex With Atp And Adp
 gi|29603635|dbj|BAC67699.1| nucleoside diphosphate kinase [Thermus thermophilus]
 gi|55771570|dbj|BAD70011.1| nucleoside diphosphate kinase [Thermus thermophilus HB8]
          Length = 137

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  + A K   ++++ AE  Y  H+++PFFP 
Sbjct: 1   MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   VL+G   +++ R++MG T PK AL GTIR  +  +I EN IHGS +L
Sbjct: 61  LVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+ +F   E++
Sbjct: 121 EDAQREIALFFRPEELL 137


>gi|58760467|gb|AAW82141.1| NDP kinase NBR-A [Bos taurus]
          Length = 152

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTI   + I +G N IHGSDS++
Sbjct: 65  VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIHGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   E++
Sbjct: 125 SAEKEIALWFHPEELV 140


>gi|33239502|ref|NP_874444.1| nucleoside diphosphate kinase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33237027|gb|AAP99096.1| Nucleoside diphosphate kinase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 170

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 83/138 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R L+G I+   E  G  +V  K    +++ AE  Y +HK+RPFF
Sbjct: 20  MSVERTFLAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLIPSKELAEKHYGVHKERPFF 79

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I   R+++G T P +A  GTIR   GI+IG N IHGSD
Sbjct: 80  TGLVGFITSGPVVAMVWEGDGVILSARKLIGATKPLEAEPGTIRGDLGINIGRNVIHGSD 139

Query: 121 SLKTALEEISYWFARNEI 138
             +TA  EI  WF  +E+
Sbjct: 140 GPETASFEIDLWFNSSEL 157


>gi|297813557|ref|XP_002874662.1| hypothetical protein ARALYDRAFT_489940 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297320499|gb|EFH50921.1| hypothetical protein ARALYDRAFT_489940 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 238

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVIVPSKDFAQKHYHDLKERPFFNG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +G+  I   R+++G TDP+K+  GTIR    +++G N IHGSD  
Sbjct: 148 LCDFLSSGPVIAMVWEGDGVIRYGRKLIGATDPQKSEPGTIRGDLAVTVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EIS WF   E++
Sbjct: 208 ETAKDEISLWFKPQELV 224


>gi|6644111|gb|AAF20910.1|AF202052_1 nucleoside diphosphate kinase-Z1 [Danio rerio]
          Length = 153

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAMKFLQASEDLLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+ 
Sbjct: 66  VKYMSSGPVLAIVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIEVGRNIIHGSDSVD 125

Query: 124 TALEEISYWFARNEII 139
           +A  EIS WF   E++
Sbjct: 126 SANTEISLWFKPEELV 141


>gi|123441414|ref|YP_001005401.1| nucleoside diphosphate kinase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166233033|sp|A1JKR7|NDK_YERE8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|122088375|emb|CAL11166.1| nucleoside diphosphate kinase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 141

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV +N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MAVERTFSIIKPNAVAKNNIGAIYARFESAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A+ ++R++MG T+P  AL GT+R  +  S  EN++HGSD
Sbjct: 61  DGLVEFMTSGPVMIQVLEGENAVQRHRDIMGATNPDNALAGTLRADFADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F+ NEI 
Sbjct: 121 AVESAQREIAYFFSENEIC 139


>gi|61356843|gb|AAX41294.1| non-metastatic cells 4 protein [synthetic construct]
          Length = 187

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 73/136 (53%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SG V   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 98  IRYMSSGHVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|29841231|gb|AAP06245.1| similar to GenBank Accession Number U61287 nucleoside diphosphate
           kinase in Columba livia [Schistosoma japonicum]
 gi|226476034|emb|CAX72107.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476036|emb|CAX72108.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476038|emb|CAX72109.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476040|emb|CAX72110.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476042|emb|CAX72111.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476044|emb|CAX72112.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476046|emb|CAX72113.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476048|emb|CAX72114.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226476050|emb|CAX72115.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480468|emb|CAX78898.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480470|emb|CAX78899.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480474|emb|CAX78901.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480476|emb|CAX78902.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480478|emb|CAX78903.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480480|emb|CAX78904.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480482|emb|CAX78905.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480484|emb|CAX78906.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480486|emb|CAX78907.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480488|emb|CAX78908.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480490|emb|CAX78909.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480492|emb|CAX78910.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480494|emb|CAX78911.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480496|emb|CAX78912.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480498|emb|CAX78913.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480902|emb|CAX78916.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480904|emb|CAX78917.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480906|emb|CAX78918.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
 gi|226480908|emb|CAX78919.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
          Length = 149

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I++  E  G  ++A K    + +  +  Y   K  PFF  
Sbjct: 1   MERTFIMVKPDGVQRGLVGEIIQRFERRGYKLIAVKMIHASEQLLQTHYEALKSLPFFTN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV   V +G +A+   R ++G T P+ +  G+IR  +   +G N +HGSDS+
Sbjct: 61  LVAYMSSGPVVPMVFEGRKAVENGRTMLGATRPEASCPGSIRGDFCQDVGRNVVHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ WF+  E+ 
Sbjct: 121 ESANREINLWFSPQELC 137


>gi|325114194|emb|CBZ49752.1| nucleoside diphosphate kinase,related [Neospora caninum Liverpool]
          Length = 155

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T+ M+KPD V+R L+  ++K  E  G  +VA K    +    E+ Y   K +PFFP L
Sbjct: 7   ERTYIMVKPDGVQRGLVSEVLKRFEQRGYKLVALKMKSPDASLLEEHYADLKGKPFFPGL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G + + + R ++G+T P ++  GT+R  + I +G N +HGSDS++
Sbjct: 67  ISYMSSGPVVCMVWEGTDVVKQGRRMLGETRPLESNPGTLRGDFCIDVGRNIVHGSDSVE 126

Query: 124 TALEEISYWFARNEII 139
           +A +EI+ WF   EI 
Sbjct: 127 SANKEINLWFTPEEIC 142


>gi|145534205|ref|XP_001452847.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420546|emb|CAK85450.1| unnamed protein product [Paramecium tetraurelia]
          Length = 152

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 86/136 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF M+KPD V+R L+G I++  ED G  +VA KF   ++      Y   K+RPFFP L
Sbjct: 5   ERTFIMVKPDGVQRRLVGKIIQRFEDRGFKLVALKFVAPDQGLLTQHYADLKERPFFPSL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ + SGPV   V +G++A+   R ++G+T+P  +  GTIR  + I +G N IHGSDS+ 
Sbjct: 65  LKYVSSGPVAAMVWEGKDAVKTGRVMLGETNPLASKPGTIRGDFAIDVGRNVIHGSDSVD 124

Query: 124 TALEEISYWFARNEII 139
           +A  EIS WF   E++
Sbjct: 125 SANREISLWFQPQELV 140


>gi|269838350|ref|YP_003320578.1| Nucleoside-diphosphate kinase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787613|gb|ACZ39756.1| Nucleoside-diphosphate kinase [Sphaerobacter thermophilus DSM
           20745]
          Length = 150

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  ++KPD V+R LIG ++  LE  GL VV  K   ++R+ AE  Y +H++RPFF  
Sbjct: 1   MERTLIIVKPDGVQRGLIGEVIARLERRGLKVVGLKMMQISRELAEQHYGVHRERPFFAS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + S PV + VL+G +AI   R  +G T+P  A  GTIR  +G++IG N IH SD  
Sbjct: 61  LVEYITSAPVVVGVLEGPKAIEVTRATVGATNPVDAAPGTIRGDFGLTIGRNLIHASDGA 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F   E+I
Sbjct: 121 ESAEHEINLFFRPEELI 137


>gi|18203422|sp|Q9RRJ1|NDK_DEIRA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 138

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 83/137 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF+MIKPD V+R L   I+  + + G  VV  K   M R+ AE  Y  H++RPFF E
Sbjct: 1   MERTFAMIKPDGVRRGLTPEILARIHNKGYRVVGLKQMMMPRETAEQHYGEHRERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +  GPV    L+GE AI+  R +MG T+P  A  GTIR  +  S GEN  HGSDS 
Sbjct: 61  LVDFITGGPVVAIALEGENAIAGWRAMMGATNPANAAPGTIRADFATSTGENVTHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  E++ +F   E++
Sbjct: 121 ESAERELALFFGDGELL 137


>gi|14590577|ref|NP_142645.1| nucleoside diphosphate kinase [Pyrococcus horikoshii OT3]
 gi|85544432|pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From
           Pyrococcus Horikoshii
 gi|85544433|pdb|2CWK|B Chain B, Crystal Structure Of Nucleotide Diphosphate Kinase From
           Pyrococcus Horikoshii
 gi|134104161|pdb|2DXD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Atp Analog
 gi|134104162|pdb|2DXD|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Atp Analog
 gi|134104163|pdb|2DXE|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Gdp
 gi|134104164|pdb|2DXE|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Gdp
 gi|134104165|pdb|2DXF|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Gtp Analog
 gi|134104166|pdb|2DXF|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Gtp Analog
 gi|145579200|pdb|2DY9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Adp
 gi|145579201|pdb|2DY9|B Chain B, Crystal Structure Of Nucleoside Diphosphate Kinase In
           Complex With Adp
 gi|145579202|pdb|2DYA|A Chain A, Crystal Structure Of Complex Between Adenine Nucleotide
           And Nucleoside Diphosphate Kinase
 gi|145579203|pdb|2DYA|B Chain B, Crystal Structure Of Complex Between Adenine Nucleotide
           And Nucleoside Diphosphate Kinase
 gi|3257106|dbj|BAA29789.1| 160aa long hypothetical nucleoside-diphosphate kinase [Pyrococcus
           horikoshii OT3]
          Length = 160

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 3/138 (2%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T  +IKPDAV R LIG I+   E  GL +V  K  W++R+ AE  Y  H+++PFF  L
Sbjct: 8   ERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKAL 67

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGSD 120
           +  +   PV + VL+G  A+   R++ G TDPK A  GTIR  +G+ + +   N IH SD
Sbjct: 68  IDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASD 127

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EIS +F   E+
Sbjct: 128 SKESAEREISLFFKPEEL 145


>gi|240103930|ref|YP_002960239.1| nucleoside diphosphate kinase [Thermococcus gammatolerans EJ3]
 gi|239911484|gb|ACS34375.1| Nucleoside diphosphate kinase (ndk) [Thermococcus gammatolerans
           EJ3]
          Length = 177

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  ++KPDAV R L+G I+   E  GL +V  K  W++R+ AE  Y  H+ +PFF  
Sbjct: 9   VERTLVILKPDAVVRGLMGEIISRFEKRGLKIVGMKMIWIDRELAEKHYEEHRGKPFFEA 68

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   P  + V++G  AIS  R++ G TDPK A  G+IR  YG+ +G+   N IH S
Sbjct: 69  LIDYITKAPSVVMVVEGRYAISVVRKMAGATDPKDAEPGSIRGDYGLDVGDAIYNVIHAS 128

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EI+ +F   E+
Sbjct: 129 DSPESAEREINLYFKPEEL 147


>gi|315230885|ref|YP_004071321.1| nucleoside diphosphate kinase [Thermococcus barophilus MP]
 gi|315183913|gb|ADT84098.1| nucleoside diphosphate kinase [Thermococcus barophilus MP]
          Length = 168

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  +IKPDAV R LIG I+   E  GL +V  K   ++R+ AE  Y  HK +PFF  
Sbjct: 6   VERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIHIDRELAERHYEEHKGKPFFNA 65

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   P  + V++G  AIS  R++ G TDPK A  GTIR   G+ +G+   N +H S
Sbjct: 66  LIDYITKAPSVVMVVEGRYAISVVRKMAGATDPKDAEPGTIRGDLGLDVGDAIYNVVHAS 125

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EI+ +F   EI
Sbjct: 126 DSPESAEREINLYFKPEEI 144


>gi|30142116|gb|AAP13059.1| nucleoside diphosphate kinase [Oreochromis mossambicus]
          Length = 152

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R +IG ++K  E  G  +V  K    +     + Y+  KDRPFFP L
Sbjct: 6   ERTFIAIKPDGVQRGIIGEVIKRFEMKGFKLVGMKMLHASEDLLMEHYVDLKDRPFFPTL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V + +  +   R ++G+T+P  +  GTIR  + I + +N IHGSDS++
Sbjct: 66  INYMRSGPVVAMVWEDKGVVKTGRVMLGETNPADSKPGTIRGDFCIDVSKNIIHGSDSVE 125

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF  +E++
Sbjct: 126 SANKEISLWFKDDELV 141


>gi|400404|sp|Q02254|NDK1_SPIOL RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I
 gi|218275|dbj|BAA01510.1| nucleoside diphosphate kinase I [Spinacia oleracea]
          Length = 148

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 82/133 (61%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  + A KF  ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFSLKALKFVNVDRPFAEKHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ ++SGPV   V +G+  ++  R+++G T+P  +  GTIR  + I IG N IHGSD++
Sbjct: 61  LVEYIVSGPVVAMVWEGKGVVATGRKLIGATNPLASEPGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
            +A +EI+ WF  
Sbjct: 121 DSATKEIALWFPD 133


>gi|117920715|ref|YP_869907.1| nucleoside diphosphate kinase [Shewanella sp. ANA-3]
 gi|166233022|sp|A0KXI2|NDK_SHESA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|117613047|gb|ABK48501.1| nucleoside diphosphate kinase [Shewanella sp. ANA-3]
          Length = 143

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL +VAAK   + ++QAE FY  H +R FF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIVAAKMLHLTKEQAEGFYAEHSERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+GE A+  +RE++G T+P +A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQVLEGENAVLAHREILGATNPAQAAPGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +L++A  EI+Y+F+  E+ 
Sbjct: 121 ALESAAREIAYFFSAEELC 139


>gi|261380195|ref|ZP_05984768.1| nucleoside diphosphate kinase [Neisseria subflava NJ9703]
 gi|284797044|gb|EFC52391.1| nucleoside diphosphate kinase [Neisseria subflava NJ9703]
          Length = 141

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV++N+IG I    E+ GL ++AAK   ++ ++A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVEKNVIGKIYSRFEENGLRIIAAKMKHLSEREAKEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M   PV +QVL+GE A++KNRE+MG T+P  A  GTIR  +  S+  N++HGSD
Sbjct: 61  EDLVKFMTRNPVMIQVLEGENAVAKNRELMGATNPADAAPGTIRADFAESVSVNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F+++EI 
Sbjct: 121 SVENAAIEIAYFFSQSEIC 139


>gi|126728778|ref|ZP_01744593.1| nucleoside diphosphate kinase [Sagittula stellata E-37]
 gi|126710708|gb|EBA09759.1| nucleoside diphosphate kinase [Sagittula stellata E-37]
          Length = 140

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   + + QA +FY +H  RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHLTKAQAGEFYKVHAARPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+GE+AISKNREVMG T+P  A +GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASAPIVAQVLEGEDAISKNREVMGATNPADAAEGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           +  TA EEI+Y+F+  E++G
Sbjct: 121 APDTAAEEIAYFFSGLELVG 140


>gi|241758829|ref|ZP_04756942.1| nucleoside diphosphate kinase [Neisseria flavescens SK114]
 gi|241321037|gb|EER57250.1| nucleoside diphosphate kinase [Neisseria flavescens SK114]
          Length = 141

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV++N+IG I    E+ GL ++AAK   ++ ++A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVEKNVIGKIYSRFEENGLRIIAAKMKHLSEREAKEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M   PV +QVL+GE A++KNRE+MG T+P  A  GTIR  +  S+  N++HGSD
Sbjct: 61  EDLVKFMTRNPVMIQVLEGENAVAKNRELMGATNPADAAPGTIRADFAESVSVNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F+++EI 
Sbjct: 121 SVENAAIEIAYFFSQSEIC 139


>gi|18859107|ref|NP_571001.1| nucleoside diphosphate kinase A [Danio rerio]
 gi|7339840|gb|AAF60971.1|AF201764_1 nuclease diphosphate kinase B [Danio rerio]
          Length = 153

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF   KPD V+R L+G I+K  E  G  +VA KF   +    +  Y+  KDRPF+P L
Sbjct: 6   ERTFIAAKPDGVQRGLMGEIIKRFEQKGFRLVAMKFLQASEDLLKQHYIDLKDRPFYPGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS+ 
Sbjct: 66  VKYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIEVGRNIIHGSDSVD 125

Query: 124 TALEEISYWFARNEII 139
           +A  EIS WF   E++
Sbjct: 126 SANTEISLWFKPEELV 141


>gi|157375997|ref|YP_001474597.1| nucleoside-diphosphate kinase [Shewanella sediminis HAW-EB3]
 gi|189029057|sp|A8FX96|NDK_SHESH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|157318371|gb|ABV37469.1| Nucleoside-diphosphate kinase [Shewanella sediminis HAW-EB3]
          Length = 143

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIIASKMLHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+  NRE+MG T+P +A +GTIR+ +  SI EN++HGSD
Sbjct: 61  GALVEFMTSGPICVQVLEGENAVLANREIMGATNPAEAARGTIRSDFADSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++ +A  EI+Y+F+  E+ 
Sbjct: 121 AVASAEREIAYFFSTEELC 139


>gi|19113769|ref|NP_592857.1| nucleoside diphosphate kinase Ndk1 [Schizosaccharomyces pombe
           972h-]
 gi|1709244|sp|P49740|NDK_SCHPO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|1089812|dbj|BAA09829.1| Nucleoside Diphosphate Kinase [Schizosaccharomyces pombe]
 gi|5834808|emb|CAB55286.1| nucleoside diphosphate kinase Ndk1 [Schizosaccharomyces pombe]
          Length = 151

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 85/138 (61%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPDAV+R LIG I+ + E  G  + A KF   +R   E+ Y  HK +PF+
Sbjct: 1   MSTEQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV   + +G++A+   R ++G ++P  +  GTIR  YGI +G N  HGSD
Sbjct: 61  EKLVGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGTIRGDYGIDLGRNVCHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI  WF  +EI
Sbjct: 121 SIESANREIKLWFQPSEI 138


>gi|87123491|ref|ZP_01079342.1| Nucleoside-diphosphate kinase [Synechococcus sp. RS9917]
 gi|86169211|gb|EAQ70467.1| Nucleoside-diphosphate kinase [Synechococcus sp. RS9917]
          Length = 151

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 62/138 (44%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R+ AE  Y +HK+RPFF
Sbjct: 1   MA-ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFF 59

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    I+IG N IHGSD
Sbjct: 60  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAINIGRNVIHGSD 119

Query: 121 SLKTALEEISYWFARNEI 138
           + +TAL EI  WF  +E+
Sbjct: 120 APETALFEIGLWFQPSEL 137


>gi|225713346|gb|ACO12519.1| Nucleoside diphosphate kinase A 1 [Lepeophtheirus salmonis]
 gi|290561941|gb|ADD38368.1| Nucleoside diphosphate kinase A 1 [Lepeophtheirus salmonis]
          Length = 152

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 57/140 (40%), Positives = 82/140 (58%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF MIKPD V R ++G IVK  E  G  +VA KF   +       Y     +PF
Sbjct: 1   MSNTERTFIMIKPDGVHRGIVGDIVKRFEQKGFKLVAMKFMQASMDHLRKHYADLSSKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           F  LV+ M SGPV   V +G  A+   R ++G+T+PK +  GTIR  + + IG N  HGS
Sbjct: 61  FEGLVKYMASGPVLAMVWEGLNAVKTGRVMLGETNPKDSAPGTIRGDFCVQIGRNICHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           D++++A +EI+ WF  +E++
Sbjct: 121 DAVESAEKEIALWFTPDELV 140


>gi|312597562|pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From
           Campylobacter Jejuni
 gi|312597563|pdb|3PJ9|B Chain B, Crystal Structure Of A Nucleoside Diphosphate Kinase From
           Campylobacter Jejuni
 gi|312597564|pdb|3PJ9|C Chain C, Crystal Structure Of A Nucleoside Diphosphate Kinase From
           Campylobacter Jejuni
 gi|312597565|pdb|3PJ9|D Chain D, Crystal Structure Of A Nucleoside Diphosphate Kinase From
           Campylobacter Jejuni
          Length = 140

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 100/138 (72%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE+FY +HK+RPFF 
Sbjct: 3   AMEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFK 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           +LV+ MISGPV + +L+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDS
Sbjct: 63  DLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           L+ A  EI ++F  NEI 
Sbjct: 123 LENAKIEIEFFFKPNEIC 140


>gi|223038720|ref|ZP_03609013.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Campylobacter rectus RM3267]
 gi|222880122|gb|EEF15210.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Campylobacter rectus RM3267]
          Length = 137

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 97/137 (70%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T S+IKPDAVK+ +IG IV   E  GL + A K   + +  A+ FY +HKDRPFF +
Sbjct: 1   MQQTLSIIKPDAVKKGVIGKIVDRFESNGLRIAAMKKVKLTKCDAKAFYAVHKDRPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV + VL+G++A++KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDFMTSGPVVVMVLEGDDAVAKNRDLMGATNPKEAKPGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++FA  EI 
Sbjct: 121 ENAKNEIAFFFATREIC 137


>gi|224072202|ref|XP_002303650.1| predicted protein [Populus trichocarpa]
 gi|118486199|gb|ABK94942.1| unknown [Populus trichocarpa]
 gi|222841082|gb|EEE78629.1| predicted protein [Populus trichocarpa]
          Length = 236

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 82/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    +++ A+  Y   K+RPFF  
Sbjct: 86  MEQTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKVVVPSKEHAQKHYHDLKERPFFNG 145

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    ++IG N IHGSD  
Sbjct: 146 LCDFLSSGPVVAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVAIGGNVIHGSDGP 205

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 206 ETAKDEINLWFKPEELV 222


>gi|28916483|gb|AAO59410.1| nucleoside diphosphate kinase [Schistosoma japonicum]
          Length = 157

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I++  E  G  ++A K    + +  +  Y   K  PFF  
Sbjct: 9   MERTFIMVKPDGVQRGLVGEIIQRFERRGYKLIAVKMIHASEQLLQTHYEALKSLPFFTN 68

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV   V +G +A+   R ++G T P+ +  G+IR  +   +G N +HGSDS+
Sbjct: 69  LVAYMSSGPVVPMVFEGRKAVENGRTMLGATRPEASCPGSIRGDFCQDVGRNVVHGSDSV 128

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ WF+  E+ 
Sbjct: 129 ESANREINLWFSPQELC 145


>gi|168004121|ref|XP_001754760.1| NDPK3a nucleotide diphosphate kinase 3 protein [Physcomitrella
           patens subsp. patens]
 gi|162693864|gb|EDQ80214.1| NDPK3a nucleotide diphosphate kinase 3 protein [Physcomitrella
           patens subsp. patens]
          Length = 151

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 74/139 (53%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R LI  I+   E  G  +VA K     ++ A   Y     RPFF
Sbjct: 1   MDLERTFIAIKPDGVQRGLISEIIGRFERKGYKLVAIKLIVPTKEFAAQHYDDLSSRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L   + SGPV   V +G+  I   R+++G T P+ +  GTIR    + +  N IHGSD
Sbjct: 61  NGLCDFLSSGPVVAMVWEGQGVIKYGRKLIGATSPQASEPGTIRGDLCVQVSRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
             +TA+ EI  WF   E++
Sbjct: 121 GPETAVNEIGLWFKPEELV 139


>gi|225075198|ref|ZP_03718397.1| hypothetical protein NEIFLAOT_00198 [Neisseria flavescens
           NRL30031/H210]
 gi|224953373|gb|EEG34582.1| hypothetical protein NEIFLAOT_00198 [Neisseria flavescens
           NRL30031/H210]
          Length = 141

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV++N+IG I    E+ GL ++AAK   ++ ++A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVEKNVIGKIYSRFEENGLRIIAAKMKHLSEREAKEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M   PV +QVL+GE A++KNRE+MG T+P  A  GTIR  +  S+  N++HGSD
Sbjct: 61  EDLVKFMTRNPVMIQVLEGENAVAKNRELMGATNPSDAAPGTIRADFAESVSVNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F+++EI 
Sbjct: 121 SVENAAIEIAYFFSQSEIC 139


>gi|146277174|ref|YP_001167333.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides ATCC 17025]
 gi|166233010|sp|A4WRL4|NDK_RHOS5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|145555415|gb|ABP70028.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides ATCC 17025]
          Length = 140

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 105/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA +RNL G I  + ED GL +VA K   ++  QA+ FY +HKDRPFF
Sbjct: 1   MAIERTLSIIKPDATRRNLTGKINAKFEDAGLRIVAQKRIHLSLAQAQKFYGVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A +GTIR ++ +S+GENS+HGSD
Sbjct: 61  GELTEFMASEPVVVQVLEGEGAIAKNREVMGATNPANADEGTIRKEFALSVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|262280922|ref|ZP_06058705.1| nucleoside diphosphate kinase [Acinetobacter calcoaceticus RUH2202]
 gi|299771621|ref|YP_003733647.1| nucleoside diphosphate kinase [Acinetobacter sp. DR1]
 gi|262257822|gb|EEY76557.1| nucleoside diphosphate kinase [Acinetobacter calcoaceticus RUH2202]
 gi|298701709|gb|ADI92274.1| nucleoside diphosphate kinase [Acinetobacter sp. DR1]
          Length = 143

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N IG I    E  GL +VA K   +++  AE FY  HK+R FF
Sbjct: 1   MAIERTLSIVKPDAVSKNHIGDIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +RE++G T+PK+A  GTIR  + +SI EN+ HGSD
Sbjct: 61  GDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+FA NEI 
Sbjct: 121 SVASAEREIAYFFADNEIC 139


>gi|313683281|ref|YP_004061019.1| nucleoside diphosphate kinase [Sulfuricurvum kujiense DSM 16994]
 gi|313156141|gb|ADR34819.1| nucleoside diphosphate kinase [Sulfuricurvum kujiense DSM 16994]
          Length = 137

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 66/136 (48%), Positives = 94/136 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV + +IG I+   E  GL + A K   ++R+ AE FY +H  RPFF +
Sbjct: 1   MEQTLSIIKPDAVAKGVIGKILDRFESNGLKIAAMKKVQLSRQDAEAFYAVHAARPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV + VL+GE AI KNR++MG T+PK+A  GTIR  +  +I  N++HGSDS 
Sbjct: 61  LVDFMVSGPVVITVLEGENAILKNRDLMGATNPKEAAPGTIRADFAENIDANAVHGSDSA 120

Query: 123 KTALEEISYWFARNEI 138
           + A  EI+++F+  EI
Sbjct: 121 ENAAIEIAFFFSGREI 136


>gi|332659423|gb|AEE84823.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis
           thaliana]
          Length = 467

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 317 MERTFIAIKPDGVQRGLISEIITRFERKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNG 376

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 377 LCNFLSSGPVVAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 436

Query: 123 KTALEEISYWFARNEII 139
           +TA +EIS WF   E++
Sbjct: 437 ETAKDEISLWFKPEELV 453


>gi|226224533|ref|YP_002758640.1| nucleoside diphosphate kinase [Listeria monocytogenes Clip81459]
 gi|254825576|ref|ZP_05230577.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL J1-194]
 gi|254852832|ref|ZP_05242180.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL R2-503]
 gi|254931900|ref|ZP_05265259.1| nucleoside diphosphate kinase [Listeria monocytogenes HPB2262]
 gi|300763761|ref|ZP_07073758.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL N1-017]
 gi|259511707|sp|C1KWM9|NDK_LISMC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|225876995|emb|CAS05704.1| Putative nucleoside diphosphate kinase [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258606161|gb|EEW18769.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL R2-503]
 gi|293583452|gb|EFF95484.1| nucleoside diphosphate kinase [Listeria monocytogenes HPB2262]
 gi|293594819|gb|EFG02580.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL J1-194]
 gi|300515497|gb|EFK42547.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL N1-017]
 gi|328466278|gb|EGF37435.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Listeria
           monocytogenes 1816]
 gi|332312369|gb|EGJ25464.1| Nucleoside diphosphate kinase [Listeria monocytogenes str. Scott A]
          Length = 147

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y +    N IHGSDS 
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAVHTNRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA  EI+
Sbjct: 121 ESAKREIQLFFAPQEIL 137


>gi|6225750|sp|O81372|NDK1_MESCR RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I
 gi|3309053|gb|AAC25999.1| nucleoside diphosphate kinase I [Mesembryanthemum crystallinum]
          Length = 148

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 82/133 (61%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  + A KF  ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFSLKALKFINVDRPFAEKHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ ++SGPV   V +G+  +   R+++G T+P  +  GTIR  + I IG N IHGSD++
Sbjct: 61  LVEYIVSGPVVAMVWEGKGVVLTGRKIIGATNPLASEPGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESATKEIALWFPE 133


>gi|45477151|sp|Q8RXA8|NDK4_SPIOL RecName: Full=Nucleoside diphosphate kinase 4, chloroplastic;
           AltName: Full=Nucleoside diphosphate kinase III;
           AltName: Full=Nucleoside diphosphate kinase IV;
           Short=NDK IV; Short=NDP kinase IV; Short=NDPK IV; Flags:
           Precursor
 gi|19699051|gb|AAL91136.1| nucleoside diphosphate kinase III [Spinacia oleracea]
          Length = 235

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 77/136 (56%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LI  IV   E  G  +VA K    ++  A+  Y    +RPFF  L
Sbjct: 86  ERTFIAIKPDGVQRGLISEIVARFERKGFKLVAIKVVIPSKDFAQKHYHDLSERPFFNGL 145

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
              + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  +
Sbjct: 146 CDFLSSGPVVAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPE 205

Query: 124 TALEEISYWFARNEII 139
           TA +EI  WF   E++
Sbjct: 206 TAKDEIKLWFKPEELV 221


>gi|332844917|ref|XP_003314942.1| PREDICTED: nucleoside diphosphate kinase, mitochondrial-like [Pan
           troglodytes]
          Length = 209

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 60  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 119

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 120 IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 179

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 180 GAQREIQLWFQSSELV 195


>gi|66350947|emb|CAI95599.1| non-metastatic cells 4, protein expressed in [Homo sapiens]
          Length = 195

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 46  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 105

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 106 IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 165

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 166 GAQREIQLWFQSSELV 181


>gi|33303849|gb|AAQ02438.1| non-metastatic cells nucleoside-diphosphate kinase 6 [synthetic
           construct]
 gi|54695740|gb|AAV38242.1| non-metastatic cells 4, protein expressed in [synthetic construct]
 gi|54695742|gb|AAV38243.1| non-metastatic cells 4, protein expressed in [synthetic construct]
 gi|54695744|gb|AAV38244.1| non-metastatic cells 4, protein expressed in [synthetic construct]
 gi|54695818|gb|AAV38281.1| non-metastatic cells 4, protein expressed in [synthetic construct]
 gi|61366600|gb|AAX42881.1| non-metastatic cells 4 protein expressed in [synthetic construct]
 gi|61366609|gb|AAX42882.1| non-metastatic cells 4 protein expressed in [synthetic construct]
 gi|61366616|gb|AAX42883.1| non-metastatic cells 4 protein expressed in [synthetic construct]
 gi|61366624|gb|AAX42884.1| non-metastatic cells 4 protein expressed in [synthetic construct]
          Length = 188

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 98  IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|4826862|ref|NP_005000.1| nucleoside diphosphate kinase, mitochondrial precursor [Homo
           sapiens]
 gi|2498075|sp|O00746|NDKM_HUMAN RecName: Full=Nucleoside diphosphate kinase, mitochondrial;
           Short=NDK; Short=NDP kinase, mitochondrial; AltName:
           Full=Nucleoside diphosphate kinase D; Short=NDPKD;
           AltName: Full=nm23-H4; Flags: Precursor
 gi|14336697|gb|AAK61230.1|AE006463_10 nucleoside diphosphate kinase : NDKM [Homo sapiens]
 gi|1945762|emb|CAA68877.1| nucleoside-diphosphate kinase [Homo sapiens]
 gi|13436122|gb|AAH04880.1| Non-metastatic cells 4, protein expressed in [Homo sapiens]
 gi|13751642|emb|CAC37288.1| non-metastatic cells 4, protein expressed in [Homo sapiens]
 gi|16877644|gb|AAH17067.1| Non-metastatic cells 4, protein expressed in [Homo sapiens]
 gi|54695746|gb|AAV38245.1| non-metastatic cells 4, protein expressed in [Homo sapiens]
 gi|61356837|gb|AAX41293.1| non-metastatic cells 4 protein [synthetic construct]
 gi|119606226|gb|EAW85820.1| non-metastatic cells 4, protein expressed in, isoform CRA_c [Homo
           sapiens]
 gi|261860640|dbj|BAI46842.1| non-metastatic cells 4, protein expressed in [synthetic construct]
 gi|325464147|gb|ADZ15844.1| non-metastatic cells 4, protein expressed in [synthetic construct]
          Length = 187

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 98  IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|226954475|ref|ZP_03824939.1| nucleoside diphosphate kinase (NDP kinase) (nucleoside-2-P kinase)
           [Acinetobacter sp. ATCC 27244]
 gi|294651491|ref|ZP_06728804.1| nucleoside diphosphate kinase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226834824|gb|EEH67207.1| nucleoside diphosphate kinase (NDP kinase) (nucleoside-2-P kinase)
           [Acinetobacter sp. ATCC 27244]
 gi|292822641|gb|EFF81531.1| nucleoside diphosphate kinase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 143

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N IG I    E  GL +VA K   +++  AE FY  HK+R FF
Sbjct: 1   MAIERTLSIVKPDAVSKNHIGDIFARFEKAGLKIVATKMKHLSQSDAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +RE++G T+PK+A  GTIR  + +SI EN+ HGSD
Sbjct: 61  GDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+FA NEI 
Sbjct: 121 SVASAEREIAYFFADNEIC 139


>gi|224067515|ref|XP_002302498.1| predicted protein [Populus trichocarpa]
 gi|222844224|gb|EEE81771.1| predicted protein [Populus trichocarpa]
          Length = 164

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   + +  AE  Y     +PFF  
Sbjct: 17  MEQTFIMIKPDGVQRGLVGEIISRFEKKGFTLKGLKLQTVEQSFAEKHYEDLAKKPFFAG 76

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LVQ +ISGPV   + +G+  ++  R+++G T+P  +  GTIR  + I +G N IHGSDS+
Sbjct: 77  LVQYIISGPVVGMIWEGKGVVATGRKIIGATNPAASEPGTIRGDFAIDVGRNVIHGSDSV 136

Query: 123 KTALEEISYWFAR 135
           ++A +EI  WF  
Sbjct: 137 ESATKEIGLWFPE 149


>gi|73987695|ref|XP_533973.2| PREDICTED: similar to expressed in non-metastatic cells 1, protein
           (NM23A) (nucleoside diphosphate kinase) [Canis
           familiaris]
          Length = 152

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+RNL+G I+K  E  G  ++A K    +    ++ Y+  KDRPFF  L
Sbjct: 5   ERTFIAIKPDGVQRNLLGEIIKCFEQKGFRLIAMKLIQASEDLLKEHYIDLKDRPFFASL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
            + M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  EKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +  +EI  WF   E++
Sbjct: 125 SVEKEIGVWFQPEELV 140


>gi|294948822|ref|XP_002785912.1| Nucleoside diphosphate kinase B, putative [Perkinsus marinus ATCC
           50983]
 gi|239900020|gb|EER17708.1| Nucleoside diphosphate kinase B, putative [Perkinsus marinus ATCC
           50983]
          Length = 153

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 81/131 (61%)

Query: 5   KTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELV 64
           +TF M+KPD V+R L+G I++  ED G  +VA K C  + +  ++ Y    D+PFF  LV
Sbjct: 7   RTFIMVKPDGVQRGLVGRIIQRFEDKGFKLVAMKMCTPSEEHFKEHYADLSDKPFFAGLV 66

Query: 65  QAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKT 124
           + M + PV   V +G +A ++ R ++G T P ++  GTIR  +G+ +G N IHGSDS  +
Sbjct: 67  KYMQTSPVVAMVWEGLDAAAEGRRLLGATKPSESAPGTIRGDFGLEVGRNLIHGSDSPDS 126

Query: 125 ALEEISYWFAR 135
           A +EI+ WF  
Sbjct: 127 AAKEIALWFPE 137


>gi|54297460|ref|YP_123829.1| nucleoside diphosphate kinase [Legionella pneumophila str. Paris]
 gi|67460639|sp|Q5X515|NDK_LEGPA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|53751245|emb|CAH12656.1| hypothetical protein lpp1505 [Legionella pneumophila str. Paris]
          Length = 141

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E T S+IKPDAV +++IG I    E  GL +VAAK   ++R+QAE FY IH+ RPFF
Sbjct: 1   MAKELTLSIIKPDAVAKSVIGEIYTRFEKAGLDIVAAKMIQLSREQAESFYDIHRARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVLKG+ A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVMIQVLKGDNAVAKNREIMGATNPKEAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+++F  +E+ 
Sbjct: 121 SLENAAREIAFFFEPHELC 139


>gi|256052967|ref|XP_002569994.1| nucleoside diphosphate kinase [Schistosoma mansoni]
 gi|227287322|emb|CAY17572.1| nucleoside diphosphate kinase [Schistosoma mansoni]
          Length = 149

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G +++  E  G  +VA K    + +  +  Y   K   FFP+
Sbjct: 1   MERTFIMVKPDGVQRGLVGEVIQRFERRGYKLVAIKMMHASEQLLQTHYEALKSLSFFPK 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV   V +G + +   R ++G T P+ +  G+IR  Y   +G N +HGSDS 
Sbjct: 61  LVAYMSSGPVVPMVFEGRKVVENGRTMLGATKPEASCPGSIRGDYCQDVGRNVVHGSDST 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ WF+  E+ 
Sbjct: 121 ESANREINLWFSPQELC 137


>gi|126465728|ref|YP_001040837.1| nucleoside diphosphate kinase [Staphylothermus marinus F1]
 gi|166233027|sp|A3DMR9|NDK_STAMF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|126014551|gb|ABN69929.1| nucleoside diphosphate kinase [Staphylothermus marinus F1]
          Length = 141

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 89/139 (64%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T  +IKPD V+R LIG I+   E  GL + A K   + R++AE+FY +H+ +PFF
Sbjct: 1   MNTERTLVLIKPDGVRRGLIGEIISRFERKGLKIKALKMLRLTREKAEEFYSVHRGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L++ M SGP+   +L+G+ AIS  R ++G TD ++A  GTIR  Y +S  +N +H SD
Sbjct: 61  VSLIEFMTSGPIIAMILEGDMAISVVRRMIGPTDGREAPPGTIRGDYSLSKSQNVVHASD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A+ EI   F  +EII
Sbjct: 121 SPESAMREIRVIFKDDEII 139


>gi|16272816|ref|NP_439037.1| nucleoside diphosphate kinase [Haemophilus influenzae Rd KW20]
 gi|260579967|ref|ZP_05847797.1| nucleoside-diphosphate kinase [Haemophilus influenzae RdAW]
 gi|1171679|sp|P43802|NDK_HAEIN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|1573893|gb|AAC22532.1| nucleoside diphosphate kinase (ndk) [Haemophilus influenzae Rd
           KW20]
 gi|260093251|gb|EEW77184.1| nucleoside-diphosphate kinase [Haemophilus influenzae RdAW]
          Length = 141

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M+ E+TFS+IKPD VKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF
Sbjct: 1   MMTERTFSIIKPDVVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSD
Sbjct: 61  VPLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAAEGTIRKDFALSQRENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI+Y+F  +EI
Sbjct: 121 SIESANREIAYFFTNSEI 138


>gi|2498078|sp|Q39839|NDK1_SOYBN RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I
 gi|1236951|gb|AAA93030.1| nucleoside diphosphate kinase [Glycine max]
          Length = 149

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 54/134 (40%), Positives = 81/134 (60%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF MIKPD V+R LIG I+   E  G  +   K   ++R  AE  Y     +PFF 
Sbjct: 1   MDEQTFIMIKPDGVQRGLIGEIISRFEKKGFYLKGLKLVTVDRPFAEKHYADLSAKPFFS 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  +ISGPV   + +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD+
Sbjct: 61  GLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDA 120

Query: 122 LKTALEEISYWFAR 135
           +++A +EI+ WF  
Sbjct: 121 VESANKEIALWFPE 134


>gi|257454972|ref|ZP_05620220.1| nucleoside diphosphate kinase [Enhydrobacter aerosaccus SK60]
 gi|257447682|gb|EEV22677.1| nucleoside diphosphate kinase [Enhydrobacter aerosaccus SK60]
          Length = 143

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV  N IG I    E  GL +VAAK   ++ ++A  FY  HK+RPF+
Sbjct: 1   MAIERTLSIIKPDAVAGNHIGEIYSRFEKAGLKIVAAKMLHLDNEKAGGFYAEHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A++ +RE+MG T+PK A +GTIR  +  SI EN++HGSD
Sbjct: 61  NDLVSFMTSGPVVVSVLEGENAVAHHREIMGATNPKDAAEGTIRRDFANSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EISY+F  NE+ 
Sbjct: 121 STTSAAREISYFFNDNEVC 139


>gi|115433100|ref|XP_001216687.1| nucleoside diphosphate kinase [Aspergillus terreus NIH2624]
 gi|114189539|gb|EAU31239.1| nucleoside diphosphate kinase [Aspergillus terreus NIH2624]
          Length = 153

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 80/139 (57%), Gaps = 1/139 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  +KPD V+R LIG I+   ++ G  + A K     +   E  Y     +PF
Sbjct: 1   MSNTEQTFIAVKPDGVQRGLIGPIITRFQNRGYKLAAMKLVSPEKSLLEQHYADLSSKPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP L+  M+SGPV   V +G++ +   R ++G T+P  +  GTIR  Y I +G N  HGS
Sbjct: 61  FPGLISYMLSGPVCAMVWEGKDVVKTGRAILGATNPLASAPGTIRGDYAIDVGRNVCHGS 120

Query: 120 DSLKTALEEISYWFARNEI 138
           DS+++A +EI+ WF + E+
Sbjct: 121 DSVESAQKEIALWFKKEEL 139


>gi|255632438|gb|ACU16569.1| unknown [Glycine max]
          Length = 235

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    +++ A+  Y   K+RPFF  
Sbjct: 85  LERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPSKEFAQKHYHDLKERPFFDG 144

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +G+  IS  R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 145 LCDFLSSGPVIAMVWEGQGVISYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 204

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI  WF   E++
Sbjct: 205 ETAKDEIKLWFKPEELV 221


>gi|300724164|ref|YP_003713481.1| nucleoside diphosphate kinase [Xenorhabdus nematophila ATCC 19061]
 gi|297630698|emb|CBJ91363.1| nucleoside diphosphate kinase [Xenorhabdus nematophila ATCC 19061]
          Length = 142

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 69/138 (50%), Positives = 99/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AVK+++IGSI    E  G  ++A K   + R+QAE FY  HK RPFF
Sbjct: 1   MTIERTFSIIKPNAVKKDVIGSIYARFESAGFKIIATKMLHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +Q L+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQALEGENAVQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI+Y+F+ +EI
Sbjct: 121 SVESANREIAYFFSDDEI 138


>gi|151941479|gb|EDN59842.1| nucleoside diphosphate kinase [Saccharomyces cerevisiae YJM789]
 gi|190409762|gb|EDV13027.1| nucleoside diphosphate kinase [Saccharomyces cerevisiae RM11-1a]
 gi|259147771|emb|CAY81021.1| Ynk1p [Saccharomyces cerevisiae EC1118]
 gi|323304084|gb|EGA57862.1| Ynk1p [Saccharomyces cerevisiae FostersB]
 gi|323308277|gb|EGA61525.1| Ynk1p [Saccharomyces cerevisiae FostersO]
 gi|323332774|gb|EGA74179.1| Ynk1p [Saccharomyces cerevisiae AWRI796]
          Length = 153

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+  I+   E  G  +VA K    + K  E  Y  H  +PFFP++
Sbjct: 6   ERTFIAVKPDGVQRGLVSQILSRFEKRGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKM 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGP+   V +G++ + + R ++G T+P  +  GTIR  +GI +G N  HGSDS+ 
Sbjct: 66  VSFMKSGPILATVWEGKDVVKQGRTILGATNPLASAPGTIRGDFGIDLGRNVCHGSDSVD 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF + E++
Sbjct: 126 SAEREINLWFKKEELV 141


>gi|328772832|gb|EGF82870.1| hypothetical protein BATDEDRAFT_9385 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 150

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 83/134 (61%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ M+KPD V+R L+G ++K  E  G  +VA +     +   E+ Y   K + FF
Sbjct: 1   MSTERTYIMVKPDGVERGLVGEVIKRFESRGYQLVALELMHPTKALLEEHYGDLKTKSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+LV  M+SGPV   V  G++ +   R+++G+T+P  +  GTIR  + I +G+N  HGSD
Sbjct: 61  PKLVTYMLSGPVVGMVWAGKDVVKTGRKMLGETNPLASAPGTIRGDFCIDVGKNICHGSD 120

Query: 121 SLKTALEEISYWFA 134
           S+++A +EI+ WF 
Sbjct: 121 SVESAEKEIAMWFP 134


>gi|326929385|ref|XP_003210846.1| PREDICTED: nucleoside diphosphate kinase 3-like [Meleagris
           gallopavo]
          Length = 160

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 87/136 (63%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R+L+G IV+  E  G  +V  K    + +  ++ Y+  +DRPF+  L
Sbjct: 13  ERTFIAIKPDGVQRHLVGEIVRRFERKGFKLVGLKLLQASEELLKEHYIDLRDRPFYGRL 72

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +   R ++G+T+P ++  GTIR  + I +G+N IHGSDS++
Sbjct: 73  VKYMSSGPVVAMVWQGLDVVRMARTMIGETNPAESKPGTIRGDFCIEVGKNVIHGSDSVE 132

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   E++
Sbjct: 133 SAQKEISLWFHPEELM 148


>gi|226480500|emb|CAX78914.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
          Length = 149

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I++  E  G  ++A K    + +  +  Y   K  PFF  
Sbjct: 1   MERTFIMVKPDGVQRGLVGEIIQRFERRGYKLIAVKMIHASEQLLQTHYEALKSLPFFTN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV   V +G +A+   R ++G T P+ +  G+IR  +   +G N +HGSDS+
Sbjct: 61  LVAYMSSGPVVPMVFEGRKAVENGRTMLGATRPEASCPGSIRGDFCQDVGRNVVHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ WF+  E+ 
Sbjct: 121 ESANREINLWFSPLELC 137


>gi|225453348|ref|XP_002271321.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
 gi|225453350|ref|XP_002271352.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
 gi|147811500|emb|CAN74274.1| hypothetical protein VITISV_036798 [Vitis vinifera]
          Length = 148

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 54/133 (40%), Positives = 80/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+RNL+G I+   E  G  +   K   + R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRNLVGEIIGRFEKKGFSLKGLKLLSVERGFAEKHYEDLSSKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   + +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSDS+
Sbjct: 61  LVEYIISGPVVAMIWEGKNVVTTGRKIIGATNPSDSAPGTIRGDFAVDIGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
            +A +EI+ WF  
Sbjct: 121 GSARKEIALWFPE 133


>gi|320335658|ref|YP_004172369.1| Nucleoside diphosphate kinase [Deinococcus maricopensis DSM 21211]
 gi|319756947|gb|ADV68704.1| Nucleoside diphosphate kinase [Deinococcus maricopensis DSM 21211]
          Length = 142

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 83/137 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF+MIKPD V+R L   I+  ++  G  VV  K   + R+ AE  Y  HK+RPFF E
Sbjct: 6   MERTFAMIKPDGVRRGLTAEILARIQRKGYRVVGLKQMVIPRETAEAHYGEHKERPFFGE 65

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +  GPV    L+GE AI+  R +MG T+P  A  G+IR  Y  ++GEN  HGSDS 
Sbjct: 66  LVDFITGGPVVAIALEGENAIAGWRAMMGATNPANAAPGSIRADYATTVGENVTHGSDSP 125

Query: 123 KTALEEISYWFARNEII 139
           ++A  E+  +F   E++
Sbjct: 126 ESAERELGLFFKPEELL 142


>gi|251792059|ref|YP_003006779.1| nucleoside diphosphate kinase [Aggregatibacter aphrophilus NJ8700]
 gi|247533446|gb|ACS96692.1| nucleoside diphosphate kinase [Aggregatibacter aphrophilus NJ8700]
          Length = 139

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 95/138 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV+RNLIG+I+  LE  G  +VAAK   ++++QAE FY  H+ + FF
Sbjct: 1   MSLQRTLSIIKPDAVRRNLIGAILARLEQQGFSIVAAKMVRLSKEQAEGFYAEHQGKSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M S PV + VL+ E A+   R +MG T+P+ A +GTIR  + +S  ENS+HGSD
Sbjct: 61  EPLVAYMTSAPVLVSVLEKENAVQDYRTLMGTTNPEAAAEGTIRRDFALSQRENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           SL++A  EI+Y+F   E+
Sbjct: 121 SLESAAREIAYFFVSEEV 138


>gi|52424723|ref|YP_087860.1| nucleoside diphosphate kinase [Mannheimia succiniciproducens
           MBEL55E]
 gi|67460652|sp|Q65UT5|NDK_MANSM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|52306775|gb|AAU37275.1| Ndk protein [Mannheimia succiniciproducens MBEL55E]
          Length = 141

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+RNLIG I+   E  G  +VAAK   + + QAE FY  H+ +PFF
Sbjct: 1   MSLERTFSIIKPDAVERNLIGKILARFEQSGFEIVAAKMVRLTKAQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M+S P+ + VL+ E A+   R ++G TDP KA +GT+R ++  S+  NS+HGSD
Sbjct: 61  EDLVEYMVSAPILVSVLQKENAVKDYRTLIGATDPAKAKEGTVRKEFAESLRRNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL++A  EI+Y+F  +EI 
Sbjct: 121 SLESAAREIAYFFIDSEIC 139


>gi|152995381|ref|YP_001340216.1| nucleoside-diphosphate kinase [Marinomonas sp. MWYL1]
 gi|189029044|sp|A6VV02|NDK_MARMS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|150836305|gb|ABR70281.1| Nucleoside-diphosphate kinase [Marinomonas sp. MWYL1]
          Length = 135

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 93/135 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  G  +V AK   ++ + A  FY  HK+RPF+
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYTRFERAGFKIVEAKMIQLDDELAGGFYAEHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+ ++RE+MG T+PK+A  GT+R  Y  SI  N++HGSD
Sbjct: 61  KDLVAFMTSGPVVVSVLEGEGAVLRHRELMGATNPKEAAAGTLRADYATSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S+++A  EI+Y+F +
Sbjct: 121 SVESATREIAYFFGK 135


>gi|118370574|ref|XP_001018488.1| Nucleoside diphosphate kinase family protein [Tetrahymena
           thermophila]
 gi|89300255|gb|EAR98243.1| Nucleoside diphosphate kinase family protein [Tetrahymena
           thermophila SB210]
          Length = 151

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 56/138 (40%), Positives = 88/138 (63%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF MIKPD V+R L+G+I+   E  G  ++A KF    ++  E  Y  H  +PFF
Sbjct: 1   MADERTFIMIKPDGVQRGLVGNIISRFESRGYQLIAMKFQLATKQILEKHYEEHISKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M+SGPV   V +G++ + + R ++G T+P  +  GTIR  +GI + +N +HGSD
Sbjct: 61  PSLLKFMLSGPVVPMVWQGKDVVKQGRAMLGQTNPLTSAPGTIRGDFGIVMQKNLVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI+ WF  +E+
Sbjct: 121 SVESAKREIAIWFQDSEL 138


>gi|300120456|emb|CBK20010.2| unnamed protein product [Blastocystis hominis]
          Length = 150

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 55/135 (40%), Positives = 71/135 (52%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R  +G I+   E  G  +V  K      +  E  Y  HK +PF+
Sbjct: 1   MPRERTFLAIKPDGVQRGHVGEIISRFERKGFKLVGMKMMVPPMELLEQHYAEHKGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L   M S  V   V +G   +S  R++MG T P  A  GTIR   G  +G N IHGSD
Sbjct: 61  PSLTGFMSSSAVVAMVWEGNNVVSIARKMMGATKPLDAAPGTIRGDLGCDMGHNVIHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S+++A  EIS WF  
Sbjct: 121 SVESAQREISLWFPE 135


>gi|313244289|emb|CBY15108.1| unnamed protein product [Oikopleura dioica]
          Length = 151

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 82/139 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+K  E  G  +VA K C   ++  E  Y     +PFF
Sbjct: 1   MSTERTFIAIKPDGVQRGLVGKILKRFEQRGFKLVAMKLCMPGKEHLEKHYADLFSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+   V +G   +   R ++G+T+P+ +L G+IR  Y I +G N  HGSD
Sbjct: 61  AGLVEYMNSGPICAMVWEGLNVVKMGRMMLGETNPQASLPGSIRGDYSIQVGRNICHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+ WF   E++
Sbjct: 121 AVESANHEIALWFKPEELM 139


>gi|325120969|ref|NP_001191390.1| nucleoside diphosphate kinase, mitochondrial [Macaca mulatta]
          Length = 187

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGP+   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 98  IRYMSSGPMVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|86138700|ref|ZP_01057273.1| nucleoside diphosphate kinase [Roseobacter sp. MED193]
 gi|85824760|gb|EAQ44962.1| nucleoside diphosphate kinase [Roseobacter sp. MED193]
          Length = 140

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 70/140 (50%), Positives = 101/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDA +RNL G+I  + E+ GL +VA K   + + QA  FY +H +RPF+
Sbjct: 1   MALQRTFSIIKPDATRRNLTGAINAKFEEAGLRIVAQKRIHLTKAQAGKFYEVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+GE AI+KNRE+MG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMSSEPIVCQVLEGENAIAKNREIMGATNPADAAAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|296314506|ref|ZP_06864447.1| nucleoside diphosphate kinase [Neisseria polysaccharea ATCC 43768]
 gi|296838814|gb|EFH22752.1| nucleoside diphosphate kinase [Neisseria polysaccharea ATCC 43768]
          Length = 141

 Score =  174 bits (441), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV++N+IG I    E+  L +VAAK   +  K+A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVEKNVIGKIYSRFEENSLKIVAAKMKQLTLKEAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTSGPVMIQVLEGENAVLKNRELMGATNPAEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F++ EI 
Sbjct: 121 SVENAALEIAYFFSQTEIC 139


>gi|6322783|ref|NP_012856.1| Ynk1p [Saccharomyces cerevisiae S288c]
 gi|548341|sp|P36010|NDK_YEAST RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase
 gi|433632|emb|CAA53407.1| A153 [Saccharomyces cerevisiae]
 gi|474320|dbj|BAA02758.1| nucleoside diphosphate kinase [Saccharomyces cerevisiae]
 gi|486093|emb|CAA81904.1| YNK1 [Saccharomyces cerevisiae]
 gi|45270416|gb|AAS56589.1| YKL067W [Saccharomyces cerevisiae]
 gi|256272472|gb|EEU07453.1| Ynk1p [Saccharomyces cerevisiae JAY291]
 gi|285813193|tpg|DAA09090.1| TPA: Ynk1p [Saccharomyces cerevisiae S288c]
 gi|1587576|prf||2206496H nucleoside diphosphate kinase
          Length = 153

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+  I+   E  G  +VA K    + K  E  Y  H  +PFFP++
Sbjct: 6   ERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKM 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGP+   V +G++ + + R ++G T+P  +  GTIR  +GI +G N  HGSDS+ 
Sbjct: 66  VSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVD 125

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF + E++
Sbjct: 126 SAEREINLWFKKEELV 141


>gi|321450447|gb|EFX62457.1| hypothetical protein DAPPUDRAFT_93870 [Daphnia pulex]
          Length = 144

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 77/131 (58%)

Query: 9   MIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMI 68
           MIKPD V+R L+G I+K  E  G   VA KF     +  +  Y     RPFF  LV+ M 
Sbjct: 1   MIKPDGVQRGLVGEIIKRFEQKGFKSVALKFVQPTEEMLQKHYADLSGRPFFAGLVKYMA 60

Query: 69  SGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEE 128
           SGPV   V +G   +   R+++G+T+P  +  GTIR  + I +G N +HGSDS+++A +E
Sbjct: 61  SGPVVAMVWEGLNIVKTGRQMLGETNPADSKPGTIRGDFCIQVGRNIMHGSDSVESANKE 120

Query: 129 ISYWFARNEII 139
           I+ WF   E++
Sbjct: 121 IALWFKDEELV 131


>gi|52080782|ref|YP_079573.1| nucleoside diphosphate kinase [Bacillus licheniformis ATCC 14580]
 gi|52786152|ref|YP_091981.1| nucleoside diphosphate kinase [Bacillus licheniformis ATCC 14580]
 gi|319645261|ref|ZP_07999494.1| nucleoside diphosphate kinase [Bacillus sp. BT1B_CT2]
 gi|67460650|sp|Q65I26|NDK_BACLD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|52003993|gb|AAU23935.1| nucleoside diphosphate kinase [Bacillus licheniformis ATCC 14580]
 gi|52348654|gb|AAU41288.1| Ndk [Bacillus licheniformis ATCC 14580]
 gi|317393070|gb|EFV73864.1| nucleoside diphosphate kinase [Bacillus sp. BT1B_CT2]
          Length = 148

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 94/137 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LIG I+   E  GL ++ AK   ++ + A + Y  H  +PFF E
Sbjct: 1   MEKTFVMVKPDGVQRQLIGEILLRFERKGLQLIGAKLMKVSEETAGEHYKEHNGKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE+AI+  R+++G T+PK+AL GTIR  +G+ +G+N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGEDAIAVARQLIGKTNPKEALPGTIRGDFGMFVGKNIIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F  +E++
Sbjct: 121 ESAAREINLFFKEDELV 137


>gi|255308888|ref|NP_062704.2| nucleoside diphosphate kinase 3 [Mus musculus]
 gi|55584186|sp|Q9WV85|NDK3_MOUSE RecName: Full=Nucleoside diphosphate kinase 3; Short=NDK 3;
           Short=NDP kinase 3; AltName: Full=DR-nm23; AltName:
           Full=Nucleoside diphosphate kinase C; Short=NDPKC;
           AltName: Full=nm23-M3
 gi|12840926|dbj|BAB25013.1| unnamed protein product [Mus musculus]
 gi|20306984|gb|AAH28503.1| Non-metastatic cells 3, protein expressed in [Mus musculus]
          Length = 169

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y+  +++PF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G TDP  A+ GTIR  + + +G+N IHGSDS++
Sbjct: 82  VKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCMEVGKNVIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 142 SAHREIALWFREAELL 157


>gi|226312055|ref|YP_002771949.1| nucleoside diphosphate kinase [Brevibacillus brevis NBRC 100599]
 gi|254767218|sp|C0ZCD6|NDK_BREBN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226095003|dbj|BAH43445.1| nucleoside diphosphate kinase [Brevibacillus brevis NBRC 100599]
          Length = 147

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+RNLIG IV   E  G  +V AK   ++R+ AE+ Y  HK+RPFF E
Sbjct: 1   MEKTFLMVKPDGVQRNLIGEIVSRFEKKGYQLVGAKLMTVSRELAEEHYAEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +G   I+  R +MG T+P  A  GTIR  +  S+G N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWQGNNVITTARAMMGKTNPVDAASGTIRGDFATSVGMNIIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  WF+  E++
Sbjct: 121 ESAEREIGLWFSAEEVL 137


>gi|83942400|ref|ZP_00954861.1| nucleoside diphosphate kinase [Sulfitobacter sp. EE-36]
 gi|83953620|ref|ZP_00962341.1| nucleoside diphosphate kinase [Sulfitobacter sp. NAS-14.1]
 gi|83841565|gb|EAP80734.1| nucleoside diphosphate kinase [Sulfitobacter sp. NAS-14.1]
 gi|83846493|gb|EAP84369.1| nucleoside diphosphate kinase [Sulfitobacter sp. EE-36]
          Length = 140

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + E+ GL +VA K   M + QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHMTKAQAGVFYAVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A +GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPADAAEGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|332158990|ref|YP_004424269.1| nucleoside diphosphate kinase [Pyrococcus sp. NA2]
 gi|331034453|gb|AEC52265.1| nucleoside diphosphate kinase [Pyrococcus sp. NA2]
          Length = 159

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  +IKPDAV R LIG I+   E  GL +V  K  W++R+ AE  Y  H+++PFF  
Sbjct: 6   VERTLVIIKPDAVVRGLIGEIISRFERKGLKIVGMKMMWISRELAEKHYEEHRNKPFFEA 65

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           LV  +   PV + V++G  AI   R++ G TDPK A  GTIR    + I +   N IH S
Sbjct: 66  LVNYITKTPVVVMVVEGRCAIEVVRKMAGATDPKDAEPGTIRGDLALDISDAICNVIHAS 125

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EIS +F   EI
Sbjct: 126 DSKESAEREISLFFKPEEI 144


>gi|148359082|ref|YP_001250289.1| nucleoside diphosphate kinase [Legionella pneumophila str. Corby]
 gi|296107130|ref|YP_003618830.1| nucleoside-diphosphate kinase [Legionella pneumophila 2300/99
           Alcoy]
 gi|166232979|sp|A5IC43|NDK_LEGPC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|148280855|gb|ABQ54943.1| nucleoside diphosphate kinase [Legionella pneumophila str. Corby]
 gi|295649031|gb|ADG24878.1| nucleoside-diphosphate kinase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 141

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E T S+IKPDAV +++IG I    E  GL +VAAK   ++R+QAE+FY IH+ RPFF
Sbjct: 1   MAKELTLSIIKPDAVAKSVIGEIYTRFEKAGLDIVAAKMTQLSREQAENFYDIHRARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVLKGE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVMIQVLKGENAVAKNREIMGATNPKEAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+++F  +E+ 
Sbjct: 121 SLENAAREIAFFFEPHELC 139


>gi|332970239|gb|EGK09232.1| nucleoside diphosphate kinase [Psychrobacter sp. 1501(2011)]
          Length = 156

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV  N IG+I    E+ GL +V AK   ++ ++A  FY  HK+RPF+
Sbjct: 14  MAIERTLSIIKPDAVGGNHIGAIYSRFEEAGLKIVGAKMLHLDNEKAGGFYAEHKERPFY 73

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE AI+K+RE+MG T+P +A +GTIR  +  SI EN++HGSD
Sbjct: 74  NDLVSFMTSGPVVVSVLEGENAIAKHREIMGATNPAEAAEGTIRKDFASSIDENAVHGSD 133

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F+ NE++
Sbjct: 134 SAESAKREIAYFFSENEVL 152


>gi|294084197|ref|YP_003550955.1| nucleoside diphosphate kinase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663770|gb|ADE38871.1| nucleoside diphosphate kinase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 140

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 99/140 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G +   LE  GL +VA K   ++ ++A++FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGQVNARLEAAGLRIVAQKRVLLSDREAKEFYAVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV LQVL+G+ AI+KNRE MG T+P  A  GTIR  +  SI  NS+HGSD
Sbjct: 61  NDLVSFMTSGPVVLQVLEGDGAIAKNRETMGATNPADAADGTIRKDFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+Y+FA +EI G
Sbjct: 121 SPENAAIEIAYFFAGSEITG 140


>gi|238921043|ref|YP_002934558.1| nucleoside diphosphate kinase [Edwardsiella ictaluri 93-146]
 gi|259511701|sp|C5BET5|NDK_EDWI9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|238870612|gb|ACR70323.1| nucleoside diphosphate kinase [Edwardsiella ictaluri 93-146]
          Length = 143

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KP+AV +N IG+I    E  GL +VAAK   + R+QAE FY  H++RPFF
Sbjct: 1   MTLERTFSIVKPNAVAKNAIGAIYARFESAGLKIVAAKMVHLTREQAEGFYAEHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+G +A+ +NRE+MG T+P+ AL GT+R  Y  S+ EN++HGSD
Sbjct: 61  DGLVTFMTSGPIMVQVLEGNDAVRRNREIMGATNPESALAGTLRADYADSLTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+ ++I 
Sbjct: 121 SPASAEREIAYFFSADDIC 139


>gi|73808794|gb|AAZ85394.1| cytosolic nucleoside diphosphate kinase [Solanum chacoense]
          Length = 148

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 53/133 (39%), Positives = 82/133 (61%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIIGRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ ++SGPV   V +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD++
Sbjct: 61  LVEYIVSGPVVAMVWEGKGVVATGRKIIGATNPLESAAGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPE 133


>gi|329297585|ref|ZP_08254921.1| Nucleoside-diphosphate kinase [Plautia stali symbiont]
          Length = 143

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V AK   + ++QAE FY  HK RPFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGAIYNCFESAGFKIVGAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV + VL+GE AI ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPVVVSVLEGENAIQRHRDLMGATNPDNALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA NE+ 
Sbjct: 121 SAESAAREIAYFFAENEVC 139


>gi|258422500|ref|ZP_05685408.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9635]
 gi|257847257|gb|EEV71263.1| nucleoside-diphosphate kinase [Staphylococcus aureus A9635]
          Length = 149

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG ++  +E  GL +V  K   +  + AE  Y  H+ +PF+ +
Sbjct: 1   MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           K+A  EI+ WF  NEI
Sbjct: 121 KSAEREINLWFNENEI 136


>gi|254173031|ref|ZP_04879705.1| nucleoside diphosphate kinase [Thermococcus sp. AM4]
 gi|214033187|gb|EEB74015.1| nucleoside diphosphate kinase [Thermococcus sp. AM4]
          Length = 174

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           IE+T  ++KPDAV R L+G I+   E  GL +V  K  W++R+ AE  Y  H+ +PFF  
Sbjct: 6   IERTLVILKPDAVVRGLMGEIISRFEKRGLKIVGMKMIWIDRELAEKHYEEHRGKPFFEA 65

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   P  + V++G  AIS  R++ G TDPK A  G+IR  YG+ +G+   N IH S
Sbjct: 66  LIDYITKAPSVVMVVEGRYAISVVRKMAGATDPKDAEPGSIRGDYGLDVGDAIYNVIHAS 125

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EIS +F   E+
Sbjct: 126 DSPESAEREISLYFKPEEL 144


>gi|78185738|ref|YP_378172.1| nucleoside diphosphate kinase [Synechococcus sp. CC9902]
 gi|116071955|ref|ZP_01469223.1| Nucleoside-diphosphate kinase [Synechococcus sp. BL107]
 gi|109892795|sp|Q3AVV5|NDK_SYNS9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|78170032|gb|ABB27129.1| nucleoside diphosphate kinase [Synechococcus sp. CC9902]
 gi|116065578|gb|EAU71336.1| Nucleoside-diphosphate kinase [Synechococcus sp. BL107]
          Length = 151

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R  AE+ Y +HK+RPFF
Sbjct: 1   MA-ERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEEHYGVHKERPFF 59

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P ++  GTIR    ++IG N IHGSD
Sbjct: 60  AGLVGFITSGPVVAMVWEGDGVIASARKLIGATKPLESEPGTIRGDLAVNIGRNVIHGSD 119

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 120 APETAEFEIGLWFQPSEL 137


>gi|329897040|ref|ZP_08271812.1| Nucleoside diphosphate kinase [gamma proteobacterium IMCC3088]
 gi|328921480|gb|EGG28866.1| Nucleoside diphosphate kinase [gamma proteobacterium IMCC3088]
          Length = 142

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S++KPDAV +N+IG I    E  GL VVAAK   +    A  FY  HK+RPFF
Sbjct: 1   MAVERTLSIVKPDAVGKNVIGEIYSRFESNGLKVVAAKMVRLTDATAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P+L++ M SGPV +QVL+GE A+ KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  PDLIEFMTSGPVMVQVLEGENAVMKNRELMGATNPKEAAAGTIRADFAQSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL +A  EI+Y+FA+ E+ 
Sbjct: 121 SLASAEREINYFFAQTELC 139


>gi|226493048|ref|NP_001150023.1| LOC100283650 [Zea mays]
 gi|195636180|gb|ACG37558.1| nucleoside diphosphate kinase 4 [Zea mays]
          Length = 238

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 81/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    +++ AE  Y   K+RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIMSRFERKGYKLVAIKLIVPSKEFAEKHYHDLKERPFFSG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    I +G N IHGSD  
Sbjct: 148 LCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAIVVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 208 ETAKDEIALWFEPKELV 224


>gi|183396449|gb|ACC62124.1| nucleoside-diphosphate kinase 4 (predicted) [Rhinolophus
           ferrumequinum]
          Length = 187

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 73/136 (53%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K   +      + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIQRFERRGFKLVGMKMLQVPESVLAEHYHDLQRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G TD   A  GTIR  + + I  N IH SDS++
Sbjct: 98  ISYMSSGPVVAMVWEGPNVVCTSRAMIGHTDSAAAAPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|300717955|ref|YP_003742758.1| Nucleoside diphosphate kinase [Erwinia billingiae Eb661]
 gi|299063791|emb|CAX60911.1| Nucleoside diphosphate kinase [Erwinia billingiae Eb661]
          Length = 143

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N+IG+I    E  G  +V +K   ++++QAE FY  H+ +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNVIGAIFNRFESAGFKIVGSKMLHLSKEQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV + VL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  DGLVEFMTSGPVVVSVLEGENAVQRHRDLMGATNPANALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F   E+ 
Sbjct: 121 SAESAAREIAYFFGEGEVC 139


>gi|229544000|ref|ZP_04433059.1| Nucleoside-diphosphate kinase [Bacillus coagulans 36D1]
 gi|229325139|gb|EEN90815.1| Nucleoside-diphosphate kinase [Bacillus coagulans 36D1]
          Length = 148

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V R LIG IV   E  G  +  AK   ++ + A+  Y  HK+RPFF +
Sbjct: 1   MERTFLMVKPDGVSRQLIGEIVSRFEKKGFRLAGAKLMQISDELAKKHYAEHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+P +A  GTIR  YG+ + +N IHGSDS 
Sbjct: 61  LVAFITSGPVFAMVWEGENIIATARQMMGKTNPAEAAPGTIRGDYGVIVSKNIIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EIS +F  +E+I
Sbjct: 121 ESAKREISLFFREDELI 137


>gi|281346107|gb|EFB21691.1| hypothetical protein PANDA_015625 [Ailuropoda melanoleuca]
          Length = 288

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 60/149 (40%), Positives = 84/149 (56%), Gaps = 13/149 (8%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPFFP L
Sbjct: 128 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPFFPGL 187

Query: 64  VQAMISGPVFLQV-------------LKGEEAISKNREVMGDTDPKKALKGTIRNKYGIS 110
           V+ M SGPV                  +G   +   R ++G+T+P  +  GTIR  + I 
Sbjct: 188 VKYMNSGPVVAMANLMVVPLPDCFQVWEGLNVVKTGRMMLGETNPADSKPGTIRGDFCIQ 247

Query: 111 IGENSIHGSDSLKTALEEISYWFARNEII 139
           +G N IHGSDS+K+A +EIS WF   E++
Sbjct: 248 VGRNIIHGSDSVKSAEKEISLWFKPEELV 276



 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 64/109 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R+L+G I+K  E  G  ++A K    +    ++ Y+  KDRPFF  L
Sbjct: 6   ERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLIAMKLIQASEDLLKEHYIDLKDRPFFAGL 65

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIG 112
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G
Sbjct: 66  VKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVG 114


>gi|296219200|ref|XP_002755776.1| PREDICTED: nucleoside diphosphate kinase, mitochondrial-like
           [Callithrix jacchus]
          Length = 187

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIRRFERRGFTLVGMKMLQAPESILAEHYRDLQRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGP+   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 98  IRYMSSGPMVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|57237383|ref|YP_178396.1| nucleoside diphosphate kinase [Campylobacter jejuni RM1221]
 gi|86151303|ref|ZP_01069518.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|86153817|ref|ZP_01072020.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|157414629|ref|YP_001481885.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           81116]
 gi|205356018|ref|ZP_03222786.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|283955757|ref|ZP_06373248.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           1336]
 gi|315123898|ref|YP_004065902.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|67460610|sp|Q5HWD9|NDK_CAMJR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|172047046|sp|A8FKC1|NDK_CAMJ8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|57166187|gb|AAW34966.1| nucleoside diphosphate kinase [Campylobacter jejuni RM1221]
 gi|85841650|gb|EAQ58897.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|85842778|gb|EAQ59990.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|157385593|gb|ABV51908.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           81116]
 gi|205346142|gb|EDZ32777.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|283792712|gb|EFC31490.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           1336]
 gi|307747269|gb|ADN90539.1| Nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           M1]
 gi|315017620|gb|ADT65713.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315057753|gb|ADT72082.1| Nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           S3]
 gi|315931590|gb|EFV10556.1| Nucleoside-diphosphate kinase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 137

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 100/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE+FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F  NEI 
Sbjct: 121 ENAKIEIDFFFKPNEIC 137


>gi|93005477|ref|YP_579914.1| nucleoside-diphosphate kinase [Psychrobacter cryohalolentis K5]
 gi|109892782|sp|Q1QD23|NDK_PSYCK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|92393155|gb|ABE74430.1| nucleoside diphosphate kinase [Psychrobacter cryohalolentis K5]
          Length = 143

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 94/139 (67%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV  N IG+I    E  GL +VAAK   ++ K+A  FY  H +RPF+
Sbjct: 1   MANERTLSIIKPDAVAGNNIGAIYDRFEKSGLKIVAAKMMQLDDKKAGGFYAEHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE AI+ +R++MG T+PK A +GTIR  +  SI EN++HGSD
Sbjct: 61  NDLVSFMTSGPVLVSVLEGENAIATHRDIMGATNPKDAAEGTIRADFASSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EISY+F   E+ 
Sbjct: 121 SAESAAREISYFFNEEEVC 139


>gi|46200100|ref|YP_005767.1| nucleoside diphosphate kinase [Thermus thermophilus HB27]
 gi|67460690|sp|Q72GQ0|NDK_THET2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|46197728|gb|AAS82140.1| nucleoside diphosphate kinase [Thermus thermophilus HB27]
          Length = 137

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  + A K   ++++ AE  Y  H+++PFFP 
Sbjct: 1   MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMRISQELAERHYAEHREKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   VL+G   +++ R++MG T PK AL GTIR  +  +I EN IHGS +L
Sbjct: 61  LVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+ +F   E++
Sbjct: 121 EDAQREIALFFRPEELL 137


>gi|730129|sp|P39207|NDK1_ARATH RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I
 gi|56966225|pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside
           Diphosphate Kinase 1
 gi|56966226|pdb|1U8W|B Chain B, Crystal Structure Of Arabidopsis Thaliana Nucleoside
           Diphosphate Kinase 1
 gi|56966227|pdb|1U8W|C Chain C, Crystal Structure Of Arabidopsis Thaliana Nucleoside
           Diphosphate Kinase 1
 gi|56966228|pdb|1U8W|D Chain D, Crystal Structure Of Arabidopsis Thaliana Nucleoside
           Diphosphate Kinase 1
 gi|56966229|pdb|1U8W|E Chain E, Crystal Structure Of Arabidopsis Thaliana Nucleoside
           Diphosphate Kinase 1
 gi|56966230|pdb|1U8W|F Chain F, Crystal Structure Of Arabidopsis Thaliana Nucleoside
           Diphosphate Kinase 1
 gi|3169310|gb|AAC17844.1| nucleoside diphosphate kinase type 1 [Arabidopsis thaliana]
 gi|5881777|emb|CAB55695.1| nucleoside-diphosphate kinase [Arabidopsis thaliana]
 gi|7267574|emb|CAB78055.1| nucleoside-diphosphate kinase [Arabidopsis thaliana]
          Length = 149

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 77/133 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG ++   E  G  +   K   + R  AE  Y     + FF  
Sbjct: 1   MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  ++SGPV   + +G+  +   R+++G T+P  +  GTIR  + I IG N IHGSDS+
Sbjct: 61  LVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPD 133


>gi|261820569|ref|YP_003258675.1| nucleoside diphosphate kinase [Pectobacterium wasabiae WPP163]
 gi|261604582|gb|ACX87068.1| Nucleoside-diphosphate kinase [Pectobacterium wasabiae WPP163]
          Length = 142

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N IG+I    E  G  +VAAK   ++R+QAE FY  HK +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNAIGAIYARFESAGFTIVAAKMLRLSREQAEGFYAEHKGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M+SGP+ +Q L+GE A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVEFMMSGPIMVQALEGENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F+ +EI 
Sbjct: 121 SIESAQREIAYFFSDDEIC 139


>gi|209736482|gb|ACI69110.1| Nucleoside diphosphate kinase A [Salmo salar]
          Length = 151

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I++  E  G  +V  KF        ++ Y   KDRPFFP L
Sbjct: 5   ERTFIAIKPDGVQRRLVGDIIRRFELKGFKMVGMKFIEAPESLLKEHYADLKDRPFFPGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGSDS++
Sbjct: 65  VSYMTSGPVVAMVWEGFNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E+ 
Sbjct: 125 SANTEINLWFKPEELC 140


>gi|255537805|ref|XP_002509969.1| nucleoside diphosphate kinase, putative [Ricinus communis]
 gi|223549868|gb|EEF51356.1| nucleoside diphosphate kinase, putative [Ricinus communis]
          Length = 236

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 80/137 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +V  K    +++ A+  Y   K+RPFF  
Sbjct: 86  MERTFIAIKPDGVQRGLIAEIVARFERKGFKLVGIKVVVPSKEFAQKHYHDLKERPFFSG 145

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 146 LCDFLSSGPVIAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 205

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 206 ETAKDEINLWFKPEELV 222


>gi|302392218|ref|YP_003828038.1| nucleoside diphosphate kinase [Acetohalobium arabaticum DSM 5501]
 gi|302204295|gb|ADL12973.1| nucleoside diphosphate kinase [Acetohalobium arabaticum DSM 5501]
          Length = 137

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD  +RNL+G I+  +E  GL + A K   ++ + A+  Y  H D+PFF +
Sbjct: 1   MEQTFFMIKPDGTRRNLVGEIISRIEKKGLEIKAMKMMQISNRLAKKHYAEHIDKPFFSD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L + + SGPV   V++G  AI   R +MG TDP ++  G+IR  Y +SI  N +HGSDS 
Sbjct: 61  LKEFITSGPVVAMVVEGPGAIKIVRRMMGQTDPAESTPGSIRGDYALSIDRNVVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F+ +EII
Sbjct: 121 ESAEREIDLFFSEDEII 137


>gi|289666008|ref|ZP_06487589.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 141

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H+ RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRKRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +Q L+GE A++ +R+++G T+PK A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVMIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA  E++
Sbjct: 121 SVENAANEVAYFFAATEVV 139


>gi|239815174|ref|YP_002944084.1| nucleoside-diphosphate kinase [Variovorax paradoxus S110]
 gi|259511722|sp|C5CXG2|NDK_VARPS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|239801751|gb|ACS18818.1| Nucleoside-diphosphate kinase [Variovorax paradoxus S110]
          Length = 141

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 102/134 (76%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG IV   E  GL +VAAK   ++R +AE FY +HK+RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGKIVSRFEAAGLKIVAAKLVHLSRNEAEQFYSVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPVF+QVL+GE AI+KNR++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVFVQVLEGENAIAKNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           + +TA  E++++FA
Sbjct: 121 APETAANEVAFFFA 134


>gi|72383215|ref|YP_292570.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL2A]
 gi|92090390|sp|Q46I11|NDK_PROMT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|72003065|gb|AAZ58867.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL2A]
          Length = 151

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 84/139 (60%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TF  IKPD V+R LI  I+   E  G  +V  K    +++ AE  Y +HKDRPFF
Sbjct: 1   MTLERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKELAEKHYGVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +GE  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 61  SGLVDFITSGPVIAMVWEGEGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
              TA+ EI+ WF  NE++
Sbjct: 121 GSDTAVFEINLWFQENELV 139


>gi|209156411|pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase
 gi|209156412|pdb|3B54|B Chain B, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase
          Length = 161

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 81/136 (59%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+  I+   E  G  +VA K    + K  E  Y  H  +PFFP++
Sbjct: 14  ERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKM 73

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  M SGP+   V +G++ + + R ++G T+P  +  GTIR  +GI +G N  HGSDS+ 
Sbjct: 74  VSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVD 133

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF + E++
Sbjct: 134 SAEREINLWFKKEELV 149


>gi|167623511|ref|YP_001673805.1| nucleoside diphosphate kinase [Shewanella halifaxensis HAW-EB4]
 gi|189029055|sp|B0TNY9|NDK_SHEHH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|167353533|gb|ABZ76146.1| Nucleoside-diphosphate kinase [Shewanella halifaxensis HAW-EB4]
          Length = 143

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIIASKMVHLSQEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +Q L+GE A+  +RE++G T+P +A +GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQTLEGENAVLAHREILGATNPAEAAEGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+F+  E+ 
Sbjct: 121 SVASAEREIAYFFSTEELC 139


>gi|83588979|ref|YP_428988.1| nucleoside diphosphate kinase [Moorella thermoacetica ATCC 39073]
 gi|109892776|sp|Q2RM94|NDK_MOOTA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|83571893|gb|ABC18445.1| nucleoside diphosphate kinase [Moorella thermoacetica ATCC 39073]
          Length = 139

 Score =  173 bits (440), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 56/138 (40%), Positives = 86/138 (62%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFSMIKP+ V+R L+G+I+  LE  G  +VA K   +  + A   Y  H+D+PF+
Sbjct: 1   MAVERTFSMIKPEGVRRGLVGAILARLEQKGYRIVALKMLRLTPEMAAAHYAEHRDKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +L+  + SGPV   VL+G   I+  R +MG T+P++A  GTIR  + +   +N IHG+D
Sbjct: 61  QDLINHITSGPVVAMVLEGPGVIAGLRRLMGATNPQEAAPGTIRGDFALETSDNVIHGAD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S  +A  EI+ +F   E+
Sbjct: 121 SPASAEREIALYFTPAEL 138


>gi|297809115|ref|XP_002872441.1| nucleoside diphosphate kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gi|297318278|gb|EFH48700.1| nucleoside diphosphate kinase 1 [Arabidopsis lyrata subsp. lyrata]
          Length = 148

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 78/133 (58%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG ++   E  G  +   K   + R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLIGEVISRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKPFFSG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  ++SGPV   + +G+  +   R+++G T+P  +  GTIR  + I IG N IHGSD++
Sbjct: 61  LVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPANSEPGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPD 133


>gi|46908162|ref|YP_014551.1| nucleoside diphosphate kinase [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|254993472|ref|ZP_05275662.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL J2-064]
 gi|255521041|ref|ZP_05388278.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL J1-175]
 gi|67460684|sp|Q71Y86|NDK_LISMF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|46881432|gb|AAT04728.1| nucleoside diphosphate kinase [Listeria monocytogenes serotype 4b
           str. F2365]
          Length = 147

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 88/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y I    N IHGSDS 
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA  EI+
Sbjct: 121 ESAKREIQLFFAPQEIL 137


>gi|157831795|pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase
          Length = 150

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 4   ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 63

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+   +  G+IR  +G+ +G N IHGSDS++
Sbjct: 64  VSFITSGPVVAMVFEGKGVVASARLMIGVTNSLASAPGSIRGDFGVDVGRNIIHGSDSVE 123

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 124 SANREIALWFKPEELL 139


>gi|317490865|ref|ZP_07949301.1| nucleoside diphosphate kinase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920412|gb|EFV41735.1| nucleoside diphosphate kinase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 143

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KP+AV +N+IG+I    E  GL +VAAK   + R+QAE FY  HK RPFF
Sbjct: 1   MTVERTFSIVKPNAVAKNVIGAIYSRFEAAGLKIVAAKMVHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+G++A+ +NRE+MG T+P+ AL GT+R  Y  S+ EN+ HGSD
Sbjct: 61  DGLVDFMTSGPIMVQVLEGKDAVRRNREIMGATNPENALAGTLRADYADSLTENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL++A  EI+Y+FA NE+ 
Sbjct: 121 SLESAEREIAYFFASNEVC 139


>gi|242242748|ref|ZP_04797193.1| nucleoside diphosphate kinase [Staphylococcus epidermidis W23144]
 gi|242233884|gb|EES36196.1| nucleoside diphosphate kinase [Staphylococcus epidermidis W23144]
          Length = 159

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  GL +V  KF  +  + AE  Y  HK +PF+ +
Sbjct: 11  VERTFLMIKPDAVQRNLIGEIISRIEKKGLKLVGGKFMQVPMELAEKHYSEHKGKPFYDK 70

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++ +R+++G T+P +A  GTIR  YG+++G N IHGSDS 
Sbjct: 71  LISFITSAPVFAMVVEGENAVAVSRKIIGSTNPSEAAPGTIRGDYGLNLGRNIIHGSDST 130

Query: 123 KTALEEISYWFARNEI 138
           ++A  E+  WF  +EI
Sbjct: 131 ESAQREVKLWFTSSEI 146


>gi|54294409|ref|YP_126824.1| hypothetical protein lpl1478 [Legionella pneumophila str. Lens]
 gi|67460637|sp|Q5WWH5|NDK_LEGPL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|53754241|emb|CAH15718.1| hypothetical protein lpl1478 [Legionella pneumophila str. Lens]
 gi|307610247|emb|CBW99809.1| hypothetical protein LPW_15711 [Legionella pneumophila 130b]
          Length = 141

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E T S+IKPDAV +++IG I    E  GL +VAAK   ++R+QAE FY IH+ RPFF
Sbjct: 1   MAKELTLSIIKPDAVAKSVIGEIYTRFEKAGLDIVAAKMTQLSREQAESFYDIHRARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVLKGE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVMIQVLKGENAVAKNREIMGATNPKEAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+++F  +E+ 
Sbjct: 121 SLENAAREIAFFFEPHELC 139


>gi|16079330|ref|NP_390154.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|238054373|sp|P31103|NDK_BACSU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|143804|gb|AAA20857.1| Ndk [Bacillus subtilis]
 gi|2634691|emb|CAB14189.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|124494284|gb|ABN13179.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|124494304|gb|ABN13198.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494324|gb|ABN13217.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494344|gb|ABN13236.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|124494364|gb|ABN13255.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494384|gb|ABN13274.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494444|gb|ABN13331.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|124494464|gb|ABN13350.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494484|gb|ABN13369.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494504|gb|ABN13388.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494524|gb|ABN13407.1| nucleoside diphosphate kinase [Bacillus subtilis]
          Length = 149

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 92/138 (66%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           ++EKTF M+KPD V+R LIG I+   E  GL +  AK   +  + AE  Y  H+ +PFF 
Sbjct: 1   MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV+ + SGPVF  V +GE  I   R+++G T+PK+AL GTIR  YG+ +G+N IHGSDS
Sbjct: 61  ELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
           L++A  EI+ +F   E++
Sbjct: 121 LESAEREINIFFKNEELV 138


>gi|251810893|ref|ZP_04825366.1| nucleoside diphosphate kinase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|251805573|gb|EES58230.1| nucleoside diphosphate kinase [Staphylococcus epidermidis
           BCM-HMP0060]
          Length = 159

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 92/136 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  G  +V  KF  +  + AE  Y  H+ +PF+ +
Sbjct: 11  VERTFLMIKPDAVQRNLIGEIISRIEKKGFKLVGGKFMQVPMELAEKHYSEHEGKPFYDK 70

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++ +R+++G T+P +A  GTIR  YG+++G N IHGSDS 
Sbjct: 71  LISFITSAPVFAMVVEGENAVAVSRKIIGSTNPSEAAPGTIRGDYGLNLGRNIIHGSDST 130

Query: 123 KTALEEISYWFARNEI 138
           ++A  E+  WF  +EI
Sbjct: 131 ESAQREVKLWFTSSEI 146


>gi|126335458|ref|XP_001362809.1| PREDICTED: similar to Non-metastatic cells 3, protein expressed in
           [Monodelphis domestica]
          Length = 169

 Score =  173 bits (439), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 52/135 (38%), Positives = 79/135 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD  +R L+G I++  E  G  +V  K    +     + Y   +DRPF+  L
Sbjct: 22  ERTFLAIKPDGFQRRLVGEIIRRFEKKGFKLVGLKLVQASEDLLREHYSALRDRPFYSRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  +  GTIR  + I +G+N IHGSDS+ 
Sbjct: 82  VKYMSSGPVVAMVWQGLDVVRSSRALIGATNPADSAPGTIRGDFCIEVGKNVIHGSDSVD 141

Query: 124 TALEEISYWFARNEI 138
           +A  EI+ WF  +E+
Sbjct: 142 SARREIALWFHADEL 156


>gi|294900664|ref|XP_002777055.1| nucleoside diphosphate kinase, putative [Perkinsus marinus ATCC
           50983]
 gi|239884509|gb|EER08871.1| nucleoside diphosphate kinase, putative [Perkinsus marinus ATCC
           50983]
          Length = 153

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 80/131 (61%)

Query: 5   KTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELV 64
           +TF M+KPD V+R L+G I++  E+ G  +VA K C  + +  +  Y    D+PFF  LV
Sbjct: 7   RTFIMVKPDGVQRGLVGRIIQRFENKGFKLVAMKMCSPSEEHFKKHYADLSDKPFFAGLV 66

Query: 65  QAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKT 124
           + M + PV   V +G +A ++ R ++G T P ++  GTIR  +G+ +G N IHGSDS  +
Sbjct: 67  KYMQTAPVVAMVWEGLDAAAEGRRLLGATKPSESAPGTIRGDFGLEVGRNLIHGSDSPDS 126

Query: 125 ALEEISYWFAR 135
           A +EI+ WF  
Sbjct: 127 AAKEIALWFPE 137


>gi|50122146|ref|YP_051313.1| nucleoside diphosphate kinase [Pectobacterium atrosepticum
           SCRI1043]
 gi|67460665|sp|Q6D272|NDK_ERWCT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|49612672|emb|CAG76122.1| nucleoside diphosphate kinase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 142

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N IG+I    E  G  +VA+K   ++R+QAE FY  HK +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNAIGAIYARFESAGFTIVASKMLRLSREQAEGFYAEHKGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M+SGP+ +Q L+GE A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVEFMMSGPIMVQALEGENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F+ +EI 
Sbjct: 121 SIESAQREIAYFFSDDEIC 139


>gi|332284657|ref|YP_004416568.1| nucleoside diphosphate kinase [Pusillimonas sp. T7-7]
 gi|330428610|gb|AEC19944.1| nucleoside diphosphate kinase [Pusillimonas sp. T7-7]
          Length = 141

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 74/138 (53%), Positives = 100/138 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG IV   E   L VVAA+   ++R  AE FY +HK+RPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIVARFEKANLKVVAARLQQLSRDDAERFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPVF+QVL+GE AI  NR++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVFVQVLEGENAIQTNRDLMGATDPKKADAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           +++TA  EI+++F  + I
Sbjct: 121 AVETAAVEIAFFFPESNI 138


>gi|296270433|ref|YP_003653065.1| nucleoside-diphosphate kinase [Thermobispora bispora DSM 43833]
 gi|296093220|gb|ADG89172.1| Nucleoside-diphosphate kinase [Thermobispora bispora DSM 43833]
          Length = 136

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 58/134 (43%), Positives = 83/134 (61%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+T  +IKPD V+R LIG ++  +E  GL +VA     ++ + A+  Y  H +RPFF 
Sbjct: 1   MSERTLVLIKPDGVRRGLIGEVISRIERKGLKIVAMDLRTLDAETAKAHYAEHAERPFFN 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV+ + SGP+   V++G  AI   R + G TDP KA  GTIR  + +SIGEN +HGSDS
Sbjct: 61  ELVEFITSGPLVALVVEGPRAIEAFRALAGATDPVKAAPGTIRGDFALSIGENVVHGSDS 120

Query: 122 LKTALEEISYWFAR 135
            ++A  EI  +F  
Sbjct: 121 PESAAREIKIFFPD 134


>gi|319789790|ref|YP_004151423.1| Nucleoside-diphosphate kinase [Thermovibrio ammonificans HB-1]
 gi|317114292|gb|ADU96782.1| Nucleoside-diphosphate kinase [Thermovibrio ammonificans HB-1]
          Length = 142

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 98/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T  ++KPDAVK+N +G IV+ L++  L ++A K   + ++QA+ FY++HK+RPF+
Sbjct: 1   MAVERTLVIVKPDAVKKNAVGDIVRILQENDLKLLAIKMVHLTKEQAKKFYIVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL   M SGP    VL+GE AI++ RE++G TDP KA +GTIR KYG  +G N++H SD
Sbjct: 61  DELTDFMSSGPCVPMVLEGENAIARVREIIGATDPAKAAEGTIRKKYGTDVGRNAVHASD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI ++F + EI
Sbjct: 121 SPESAAYEIPFFFNQLEI 138


>gi|317128582|ref|YP_004094864.1| nucleoside-diphosphate kinase [Bacillus cellulosilyticus DSM 2522]
 gi|315473530|gb|ADU30133.1| Nucleoside-diphosphate kinase [Bacillus cellulosilyticus DSM 2522]
          Length = 147

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 95/137 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+RNL+GSI+   E  G  +V +K   ++ + AE  Y  HK+RPFF +
Sbjct: 1   MERTFIMVKPDGVQRNLVGSIISRFELKGFSLVGSKLLTVSNELAEAHYAEHKNRPFFGD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  VL+G+  I++ R++MG T+P++A+ GTIR  +GI +  N IHGSDS 
Sbjct: 61  LVNFITSGPVFAMVLEGDGVIAEARKMMGKTNPQEAMPGTIRGDFGIHMSRNVIHGSDSQ 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EIS +F  +E++
Sbjct: 121 ESAQREISLFFRSDELV 137


>gi|121613085|ref|YP_001000042.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148926427|ref|ZP_01810110.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|167004999|ref|ZP_02270757.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|166232963|sp|A1VY51|NDK_CAMJJ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|87250077|gb|EAQ73035.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|145844590|gb|EDK21696.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           CG8486]
          Length = 137

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 100/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE+FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F  NEI 
Sbjct: 121 ENAKIEIEFFFKPNEIC 137


>gi|71065244|ref|YP_263971.1| nucleoside diphosphate kinase [Psychrobacter arcticus 273-4]
 gi|92090395|sp|Q4FTX1|NDK_PSYA2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|71038229|gb|AAZ18537.1| nucleoside diphosphate kinase [Psychrobacter arcticus 273-4]
          Length = 143

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV  N IG+I    E  GL +VAAK   ++ ++A  FY  H +RPF+
Sbjct: 1   MANERTLSIIKPDAVAGNNIGAIYDRFEKSGLKIVAAKMMQLDDEKAGGFYAEHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +L   M+SGPV + VL+GE AI+K+RE+MG T+PK A +GTIR  +  SI EN++HGSD
Sbjct: 61  NDLKSFMMSGPVLVSVLEGENAIAKHREIMGATNPKDAAEGTIRADFASSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EISY+F   E+ 
Sbjct: 121 SAESAAREISYFFNEEEVC 139


>gi|242310116|ref|ZP_04809271.1| nucleoside diphosphate kinase [Helicobacter pullorum MIT 98-5489]
 gi|239523413|gb|EEQ63279.1| nucleoside diphosphate kinase [Helicobacter pullorum MIT 98-5489]
          Length = 137

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 97/137 (70%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAVK+N+IG IV   E  GL + A K   ++   A++FY IHK RPFF +
Sbjct: 1   MEQTLSIIKPDAVKKNVIGKIVDRFESNGLRIAAMKKVQLSECDAQEFYAIHKSRPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV + VL+G  A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVAFMVSGPVVVMVLEGLNAVAKNRELMGATNPKEAAAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A +EI ++FA  EI 
Sbjct: 121 ENAEKEIRFFFAEREIC 137


>gi|254294283|ref|YP_003060306.1| nucleoside-diphosphate kinase [Hirschia baltica ATCC 49814]
 gi|254042814|gb|ACT59609.1| Nucleoside-diphosphate kinase [Hirschia baltica ATCC 49814]
          Length = 140

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 80/140 (57%), Positives = 99/140 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA  RNL G I    ED GL VVA K   M   QAE FY  H +RPFF
Sbjct: 1   MAIQRTFSIIKPDATNRNLTGKINAVFEDAGLRVVAQKRVRMTAAQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M S PV LQVL+GE+A+ K+REVMG T+P +A +GT+R  +  SIGENS+HGSD
Sbjct: 61  GELVEFMTSAPVVLQVLQGEDAVLKHREVMGATNPAEAAEGTVRKLFAQSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S ++A  EISY+F   EI+G
Sbjct: 121 SAESAAREISYFFRPEEIVG 140


>gi|118474185|ref|YP_891437.1| nucleoside diphosphate kinase [Campylobacter fetus subsp. fetus
           82-40]
 gi|166232960|sp|A0RMK4|NDK_CAMFF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|118413411|gb|ABK81831.1| nucleoside diphosphate kinase [Campylobacter fetus subsp. fetus
           82-40]
          Length = 137

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 97/137 (70%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAVK+ ++G I+   E  GL + AAK   ++ + A+ FY +H  RPF+ E
Sbjct: 1   MEQTLSIIKPDAVKKGVVGKIIDRFESNGLRIAAAKKLQLSVEDAKKFYEVHAARPFYGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV + VL+G+ A+ KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMTSGPVVVMVLEGDNAVVKNRELMGATNPKEAAAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++FA+ EI 
Sbjct: 121 ENAKTEIAFFFAKREIC 137


>gi|219522010|ref|NP_001137192.1| nucleoside diphosphate kinase, mitochondrial [Sus scrofa]
 gi|217314907|gb|ACK36988.1| non-metastatic cells 4 [Sus scrofa]
          Length = 187

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 73/136 (53%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L G +++  E  G  +V  K   +      + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLGGDVIQRFERRGFKLVGMKMLQVPESLLAEHYHELRRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G T+  +A  GTIR  + I I  N IH SDS++
Sbjct: 98  ISYMSSGPVVAMVWEGPNVVCASRAMIGHTNSAEAAPGTIRGDFSIHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|254831470|ref|ZP_05236125.1| hypothetical protein Lmon1_08953 [Listeria monocytogenes 10403S]
          Length = 147

 Score =  173 bits (439), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD+V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDSVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y I    N IHGSDS 
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA +EI+
Sbjct: 121 ESAQREIQLFFAPDEIL 137


>gi|261392412|emb|CAX49954.1| nucleoside diphosphate kinase (NDK; NDP kinase; nucleoside-2-P
           kinase) [Neisseria meningitidis 8013]
          Length = 141

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  K+A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M  GPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPAEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F++ EI 
Sbjct: 121 SVENAALEIAYFFSQTEIC 139


>gi|254583330|ref|XP_002497233.1| ZYRO0F00814p [Zygosaccharomyces rouxii]
 gi|238940126|emb|CAR28300.1| ZYRO0F00814p [Zygosaccharomyces rouxii]
          Length = 152

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LI +I+   E+ G  +V  K         +  Y  H ++PFFP++
Sbjct: 5   ERTFIAIKPDGVQRGLISNILSRFENKGYKLVGIKLVTPTENLLKQHYAEHVEKPFFPKM 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M+SGP+   V +G++ + + R ++G T+P  +  GTIR  Y + +G N  HGSDS+ 
Sbjct: 65  LSHMMSGPILATVWEGKDVVKQGRAILGATNPLNSAPGTIRGDYAVDMGRNVAHGSDSVA 124

Query: 124 TALEEISYWFARNEII 139
           +A  EI  WF + E++
Sbjct: 125 SAEREIDLWFKKEELV 140


>gi|89054313|ref|YP_509764.1| nucleoside diphosphate kinase [Jannaschia sp. CCS1]
 gi|109892773|sp|Q28RC3|NDK_JANSC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|88863862|gb|ABD54739.1| nucleoside diphosphate kinase [Jannaschia sp. CCS1]
          Length = 140

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 105/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA KRNL G I  + E+ GL +VA+K   +   QA+ FY +H +RPFF
Sbjct: 1   MAIQRTFSIIKPDATKRNLTGQIAAKFEEAGLRIVASKRIQLTLAQAQAFYGVHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + MIS P+ +QVL+GE+AI KNREVMG T+P  A  GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELCEFMISEPIVVQVLEGEDAIVKNREVMGATNPADAAPGTIRKEFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|221115190|ref|XP_002166190.1| PREDICTED: similar to nucleoside diphosphate kinase [Hydra
           magnipapillata]
 gi|14029141|gb|AAK51137.1| nucleoside diphosphate kinase [Hydra vulgaris]
          Length = 151

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 85/139 (61%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF M+KPD V R L   ++K  E+ G  +VA KF   + +     Y   K++ FF
Sbjct: 1   MSTERTFIMVKPDGVVRGLTAKVIKRFEEKGYKLVAMKFMKASEELLNQHYADLKEKKFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ + SGPV   V +G++A    R ++G+T+P  +  GT+R  Y I +G N +HGSD
Sbjct: 61  PTLIKHIASGPVVPMVWEGKDACRTGRILLGETNPLDSKPGTLRGDYSIDLGRNIVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A +EI+ WF  +E++
Sbjct: 121 SVESANKEIALWFTESELV 139


>gi|223974989|gb|ACN31682.1| unknown [Zea mays]
          Length = 238

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 81/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +VA K    +++ AE  Y   K+RPFF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIMSRFERKGYKLVAIKLIVPSKEFAEKHYHDLKERPFFSG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    I +G N IHGSD  
Sbjct: 148 LCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAIVVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 208 ETAKDEIALWFEPKELV 224


>gi|262371646|ref|ZP_06064925.1| nucleoside diphosphate kinase [Acinetobacter junii SH205]
 gi|262311671|gb|EEY92756.1| nucleoside diphosphate kinase [Acinetobacter junii SH205]
          Length = 143

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N IG I    E  GL ++A K   +++  AE FY  HK+R FF
Sbjct: 1   MAIERTLSIVKPDAVSKNHIGDIFARFEKAGLKIIATKMKHLSQADAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +RE++G T+PK+A  GTIR  + +SI EN+ HGSD
Sbjct: 61  GDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  EI+Y+FA NEI 
Sbjct: 121 SVASAEREIAYFFADNEIC 139


>gi|294941694|ref|XP_002783193.1| nucleoside diphosphate kinase, putative [Perkinsus marinus ATCC
           50983]
 gi|239895608|gb|EER14989.1| nucleoside diphosphate kinase, putative [Perkinsus marinus ATCC
           50983]
          Length = 153

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 80/131 (61%)

Query: 5   KTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELV 64
           +TF M+KPD V+R L+G I++  E+ G  +VA K C  + +  +  Y    D+PFF  LV
Sbjct: 7   RTFIMVKPDGVQRGLVGRIIQRFENKGFKLVAMKMCSPSEEHFKKHYADLSDKPFFAGLV 66

Query: 65  QAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKT 124
           + M + PV   V +G +A ++ R ++G T P ++  GTIR  +G+ +G N IHGSDS  +
Sbjct: 67  KYMQTAPVVAMVWEGLDAAAEGRRLLGATKPSESAPGTIRGDFGLEVGRNLIHGSDSPDS 126

Query: 125 ALEEISYWFAR 135
           A +EI+ WF  
Sbjct: 127 AAKEIALWFPE 137


>gi|67902458|ref|XP_681485.1| NDK_EMENI Nucleoside diphosphate kinase (NDK) (NDP kinase) (AnNDK)
           [Aspergillus nidulans FGSC A4]
 gi|40739682|gb|EAA58872.1| NDK_EMENI Nucleoside diphosphate kinase (NDK) (NDP kinase) (AnNDK)
           [Aspergillus nidulans FGSC A4]
          Length = 161

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 53/134 (39%), Positives = 79/134 (58%)

Query: 5   KTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELV 64
           ++F  IKPD V+R L+G I+   E+ G  + A K    +R   E  Y   K++PFFP LV
Sbjct: 13  RSFIAIKPDGVQRGLVGPIISRFENRGFKLAAMKLTSPSRSLLEQHYSDLKEKPFFPGLV 72

Query: 65  QAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKT 124
             M+SGP+   V +G++ +   R ++G T+P  +  GTIR  + I +G N  HGSDS+++
Sbjct: 73  TYMLSGPIVAMVWEGKDVVKTGRTILGATNPLASAPGTIRGDFAIDVGRNVCHGSDSVES 132

Query: 125 ALEEISYWFARNEI 138
           A +EI  WF   EI
Sbjct: 133 AKKEIGLWFTPEEI 146


>gi|260773388|ref|ZP_05882304.1| nucleoside diphosphate kinase [Vibrio metschnikovii CIP 69.14]
 gi|260612527|gb|EEX37730.1| nucleoside diphosphate kinase [Vibrio metschnikovii CIP 69.14]
          Length = 143

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 69/138 (50%), Positives = 95/138 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAVKRNLIG I   +E  GL ++AAK   +   QA  FY  H+ + FF
Sbjct: 1   MALERTFSIIKPDAVKRNLIGEIYHRIEKAGLRIIAAKMVHLTEDQASGFYAEHEGKAFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +L   M SGP+ +QVL+GE AI++ RE+MG T+P++A  GTIR+ Y +S+  NS+HGSD
Sbjct: 61  NDLKAFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTIRSDYALSMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S  +A  EI ++F   EI
Sbjct: 121 SPISAAREIEFFFPDAEI 138


>gi|255089507|ref|XP_002506675.1| predicted protein [Micromonas sp. RCC299]
 gi|226521948|gb|ACO67933.1| predicted protein [Micromonas sp. RCC299]
          Length = 150

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 78/135 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R L+G I++  E  G  +   K   + +  AE  Y     +PFF
Sbjct: 1   MATEQTYIMIKPDGVQRGLVGQIIQRFEQKGFFLRGMKMMQVEKSHAEKHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV   V +G+E +   R+++G T+P  +  GTIR  + I +G N IHGSD
Sbjct: 61  GDLVDYMCSGPVVCMVWEGKEVVKTGRKIIGATNPLASEPGTIRGDFCIELGRNVIHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           ++++A  EI  WF  
Sbjct: 121 AVESAQHEIGLWFPE 135


>gi|253742402|gb|EES99236.1| Nucleoside diphosphate kinase [Giardia intestinalis ATCC 50581]
          Length = 151

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 81/138 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF M+KPD V+R L+G I+   E  G  +VA KF   ++   E+ Y  H  RPFF
Sbjct: 1   MARERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + + SGPV   V +G   +S +R +MG T P ++  GTIR  +GI +G N IHGS 
Sbjct: 61  AGLCKFLSSGPVCAMVWEGANVVSISRTMMGVTKPAESAPGTIRGDFGIDVGRNIIHGSA 120

Query: 121 SLKTALEEISYWFARNEI 138
           +L+ A  EI+ WF   EI
Sbjct: 121 NLEDAAREIALWFKPEEI 138


>gi|330318624|gb|AEC10975.1| nucleoside diphosphate kinase 1 [Camellia sinensis]
          Length = 148

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   K   + R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFSLKGLKLVSVERAFAEKHYADLSAKPFFHG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V  G+  ++  R+++G T+P  +  GTIR  + I IG N IHGSDS+
Sbjct: 61  LVEYIISGPVVAMVWDGKNVVTTGRKIIGATNPSDSAPGTIRGDFAIDIGRNVIHGSDSI 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESARKEIALWFPE 133


>gi|325295271|ref|YP_004281785.1| Nucleoside diphosphate kinase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065719|gb|ADY73726.1| Nucleoside diphosphate kinase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 140

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 98/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T  ++KPDAVK+N +G IV+ L++  L ++A K   ++++QA+ FY++HKDRPF+
Sbjct: 1   MAVERTLVIVKPDAVKKNAVGDIVRILQENDLKLLAIKMVHLSKEQAKKFYIVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL   M SGP    V +GE AI++ RE++G TDP KA +GTIR KYG  +G N++H SD
Sbjct: 61  DELTDFMSSGPCVPMVFEGENAIARVREIIGATDPAKAAEGTIRKKYGTDVGRNAVHASD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI ++F+  EI
Sbjct: 121 SPESAAYEIPFFFSALEI 138


>gi|258513584|ref|YP_003189806.1| Nucleoside-diphosphate kinase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777289|gb|ACV61183.1| Nucleoside-diphosphate kinase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 149

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 86/136 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+  ++   E  G  +VA K   ++R+ AE  Y  HK +PFF  
Sbjct: 1   MERTFVMVKPDGVQRGLVAKVINSFEQKGCKLVALKMMKIDRELAEKHYGEHKGKPFFTP 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  +ISGPV   VL+G++ I+  R VMG T+P +A  GTIR  YG+ IG N +HGSDS 
Sbjct: 61  LVDYIISGPVVAMVLEGKDVITAARNVMGATNPLQAAIGTIRGDYGMDIGRNVVHGSDSP 120

Query: 123 KTALEEISYWFARNEI 138
            +A  EI+ +F   EI
Sbjct: 121 ASAQREINLFFLPEEI 136


>gi|18416233|ref|NP_567690.1| nucleoside diphosphate kinase 4 (NDK4) [Arabidopsis thaliana]
 gi|45477149|sp|Q8LAH8|NDK4_ARATH RecName: Full=Nucleoside diphosphate kinase IV,
           chloroplastic/mitochondrial; Short=NDK IV; Short=NDP
           kinase IV; Short=NDPK IV; AltName: Full=Nucleoside
           diphosphate kinase 4; Flags: Precursor
 gi|4972094|emb|CAB43890.1| hypothetical protein [Arabidopsis thaliana]
 gi|7269239|emb|CAB81308.1| hypothetical protein [Arabidopsis thaliana]
 gi|11990430|dbj|BAB19789.1| nucleoside diphosphate kinase 4 [Arabidopsis thaliana]
 gi|26450853|dbj|BAC42534.1| unknown protein [Arabidopsis thaliana]
 gi|105829662|gb|ABF74700.1| At4g23900 [Arabidopsis thaliana]
 gi|332659424|gb|AEE84824.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana]
          Length = 237

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 87  MERTFIAIKPDGVQRGLISEIITRFERKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNG 146

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 147 LCNFLSSGPVVAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 206

Query: 123 KTALEEISYWFARNEII 139
           +TA +EIS WF   E++
Sbjct: 207 ETAKDEISLWFKPEELV 223


>gi|15677173|ref|NP_274326.1| nucleoside diphosphate kinase [Neisseria meningitidis MC58]
 gi|121635019|ref|YP_975264.1| nucleoside diphosphate kinase [Neisseria meningitidis FAM18]
 gi|218768329|ref|YP_002342841.1| nucleoside diphosphate kinase [Neisseria meningitidis Z2491]
 gi|254805108|ref|YP_003083329.1| Nucleoside diphosphate kinase [Neisseria meningitidis alpha14]
 gi|304387386|ref|ZP_07369578.1| nucleoside diphosphate kinase [Neisseria meningitidis ATCC 13091]
 gi|54037886|sp|P65533|NDK_NEIMB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|54041578|sp|P65532|NDK_NEIMA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166232991|sp|A1KUD5|NDK_NEIMF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|7226548|gb|AAF41682.1| nucleoside diphosphate kinase [Neisseria meningitidis MC58]
 gi|120866725|emb|CAM10478.1| nucleoside diphosphate kinase [Neisseria meningitidis FAM18]
 gi|121052337|emb|CAM08668.1| nucleoside diphosphate kinase [Neisseria meningitidis Z2491]
 gi|254668650|emb|CBA06306.1| Nucleoside diphosphate kinase [Neisseria meningitidis alpha14]
 gi|254670498|emb|CBA06234.1| Nucleoside diphosphate kinase [Neisseria meningitidis alpha153]
 gi|304338637|gb|EFM04755.1| nucleoside diphosphate kinase [Neisseria meningitidis ATCC 13091]
 gi|316984105|gb|EFV63083.1| nucleoside diphosphate kinase [Neisseria meningitidis H44/76]
 gi|319410574|emb|CBY90943.1| nucleoside diphosphate kinase (NDK; NDP kinase; nucleoside-2-P
           kinase) [Neisseria meningitidis WUE 2594]
 gi|325128396|gb|EGC51279.1| nucleoside-diphosphate kinase [Neisseria meningitidis N1568]
 gi|325132492|gb|EGC55185.1| nucleoside-diphosphate kinase [Neisseria meningitidis M6190]
 gi|325134451|gb|EGC57096.1| nucleoside-diphosphate kinase [Neisseria meningitidis M13399]
 gi|325138266|gb|EGC60835.1| nucleoside-diphosphate kinase [Neisseria meningitidis ES14902]
 gi|325140468|gb|EGC62989.1| nucleoside-diphosphate kinase [Neisseria meningitidis CU385]
 gi|325142520|gb|EGC64921.1| nucleoside-diphosphate kinase [Neisseria meningitidis 961-5945]
 gi|325198459|gb|ADY93915.1| nucleoside-diphosphate kinase [Neisseria meningitidis G2136]
 gi|325200067|gb|ADY95522.1| nucleoside-diphosphate kinase [Neisseria meningitidis H44/76]
 gi|325204308|gb|ADY99761.1| nucleoside-diphosphate kinase [Neisseria meningitidis M01-240355]
 gi|325205919|gb|ADZ01372.1| nucleoside-diphosphate kinase [Neisseria meningitidis M04-240196]
          Length = 141

 Score =  173 bits (438), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  K+A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M  GPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPSEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F++ EI 
Sbjct: 121 SVENAALEIAYFFSQTEIC 139


>gi|77463451|ref|YP_352955.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|126462306|ref|YP_001043420.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides ATCC 17029]
 gi|221639309|ref|YP_002525571.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides KD131]
 gi|332558328|ref|ZP_08412650.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Rhodobacter
           sphaeroides WS8N]
 gi|92090397|sp|Q3J2D0|NDK_RHOS4 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166233009|sp|A3PJY2|NDK_RHOS1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|254767248|sp|B9KSS4|NDK_RHOSK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|77387869|gb|ABA79054.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|126103970|gb|ABN76648.1| nucleoside diphosphate kinase [Rhodobacter sphaeroides ATCC 17029]
 gi|221160090|gb|ACM01070.1| Nucleoside diphosphate kinase [Rhodobacter sphaeroides KD131]
 gi|332276040|gb|EGJ21355.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Rhodobacter
           sphaeroides WS8N]
          Length = 140

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA +RNL G I  + E+ GL +VA K   ++  QA+ FY +HKDRPFF
Sbjct: 1   MAIERTLSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIHLSLAQAQKFYGVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++ +S+GENS+HGSD
Sbjct: 61  GELTEFMASEPVVVQVLEGEGAIAKNREVMGATNPANADAGTIRKEFALSVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|242398526|ref|YP_002993950.1| Nucleoside diphosphate kinase [Thermococcus sibiricus MM 739]
 gi|242264919|gb|ACS89601.1| Nucleoside diphosphate kinase [Thermococcus sibiricus MM 739]
          Length = 164

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 3/140 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T  +IKPDAV R LIG I+   E  GL ++  K   ++R+ AE  Y  HK +PFF  
Sbjct: 12  VERTLVIIKPDAVVRGLIGKIISRFEKKGLKIIGMKMIHIDRELAEKHYEEHKGKPFFEP 71

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   P  + VL+G  AI   R++ G TDPK A  GTIR  YG+ +G+   N IH S
Sbjct: 72  LIDYITKAPSVVMVLEGRCAIGVVRKMCGATDPKDAEPGTIRGDYGLDVGDAIYNVIHAS 131

Query: 120 DSLKTALEEISYWFARNEII 139
           DS +TA  EI+ +F   E++
Sbjct: 132 DSEETAKREIALYFKDEELL 151


>gi|27468074|ref|NP_764711.1| nucleoside diphosphate kinase [Staphylococcus epidermidis ATCC
           12228]
 gi|293366564|ref|ZP_06613241.1| nucleoside diphosphate kinase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315619|gb|AAO04753.1|AE016747_250 nucleoside diphosphate kinase [Staphylococcus epidermidis ATCC
           12228]
 gi|291319333|gb|EFE59702.1| nucleoside diphosphate kinase [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 159

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  GL +V  KF  +  + AE  Y  H+ +PF+ +
Sbjct: 11  VERTFLMIKPDAVQRNLIGEIISRIEKKGLKLVGGKFMQVPMELAEKHYSEHEGKPFYDK 70

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++ +R+++G T+P +A  GTIR  YG+++G N IHGSDS 
Sbjct: 71  LISFITSAPVFAMVVEGENAVAVSRKIIGSTNPSEAAPGTIRGDYGLNLGRNIIHGSDST 130

Query: 123 KTALEEISYWFARNEI 138
           ++A  E+  WF  +EI
Sbjct: 131 ESAQREVKLWFTSSEI 146


>gi|21231429|ref|NP_637346.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|21242759|ref|NP_642341.1| nucleoside diphosphate kinase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|58582158|ref|YP_201174.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|66768517|ref|YP_243279.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|78047622|ref|YP_363797.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84624050|ref|YP_451422.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576717|ref|YP_001913646.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576908|ref|YP_001913837.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188991674|ref|YP_001903684.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|289670468|ref|ZP_06491543.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|325915373|ref|ZP_08177690.1| nucleoside diphosphate kinase [Xanthomonas vesicatoria ATCC 35937]
 gi|325927619|ref|ZP_08188848.1| nucleoside diphosphate kinase [Xanthomonas perforans 91-118]
 gi|54037889|sp|P65539|NDK_XANCP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|54041581|sp|P65538|NDK_XANAC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67460607|sp|Q5GZT2|NDK_XANOR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|81305511|sp|Q4UUL4|NDK_XANC8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|90110377|sp|Q3BTW6|NDK_XANC5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|109892799|sp|Q2P2S9|NDK_XANOM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729873|sp|B0RT49|NDK_XANCB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|21108239|gb|AAM36877.1| nucleoside diphosphate kinase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21113099|gb|AAM41270.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|58426752|gb|AAW75789.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|66573849|gb|AAY49259.1| nucleoside diphosphate kinase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|78036052|emb|CAJ23743.1| nucleoside-diphosphate kinase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84367990|dbj|BAE69148.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|167733434|emb|CAP51635.1| Nucleoside-diphosphate kinase [Xanthomonas campestris pv.
           campestris]
 gi|188521169|gb|ACD59114.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521360|gb|ACD59305.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|325538420|gb|EGD10099.1| nucleoside diphosphate kinase [Xanthomonas vesicatoria ATCC 35937]
 gi|325541986|gb|EGD13499.1| nucleoside diphosphate kinase [Xanthomonas perforans 91-118]
          Length = 141

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +Q L+GE A++ +R+++G T+PK A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVMIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA  E++
Sbjct: 121 SVENAANEVAYFFAATEVV 139


>gi|298291106|ref|YP_003693045.1| nucleoside-diphosphate kinase [Starkeya novella DSM 506]
 gi|296927617|gb|ADH88426.1| Nucleoside-diphosphate kinase [Starkeya novella DSM 506]
          Length = 140

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 78/140 (55%), Positives = 103/140 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS++KPDA KRNL G+I   +E  GL +VA K   + R QAE FY +HK+RPFF
Sbjct: 1   MALERTFSILKPDATKRNLTGAINAYIEKAGLRIVAQKRMLLTRGQAETFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGP+ +QVL+GE A++K REVMG T+P  A +GTIR  + +S+GENS HGSD
Sbjct: 61  GELVDFMISGPIVVQVLEGENAVAKYREVMGATNPANAAEGTIRKDFALSVGENSAHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+ +F+ NEI+G
Sbjct: 121 SAENAQIEIAQFFSGNEIVG 140


>gi|253689387|ref|YP_003018577.1| Nucleoside-diphosphate kinase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259511708|sp|C6DBH8|NDK_PECCP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|251755965|gb|ACT14041.1| Nucleoside-diphosphate kinase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 142

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N IGSI    E  G  +VAAK   ++R+QAE FY  HK +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNAIGSIYARFESAGFTLVAAKMLRLSREQAEGFYAEHKGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M+SGP+ +QVL+GE A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVEFMMSGPIMVQVLEGENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F+ +EI 
Sbjct: 121 SIESAQREIAYFFSDDEIC 139


>gi|117620412|ref|YP_856291.1| nucleoside diphosphate kinase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166232943|sp|A0KJ40|NDK_AERHH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|117561819|gb|ABK38767.1| nucleoside diphosphate kinase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 142

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +NLIG+I    E  GL V+AAK   M+ +QA  FY  H+ +PF+
Sbjct: 1   MAIERTFSIIKPDAVSKNLIGAIYNRFESAGLKVIAAKMLHMSSEQAAGFYAEHQGKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GEEAI ++RE+MG T+PK+AL GT+R  +  SI  N++HGSD
Sbjct: 61  DGLVSFMTSGPVMIQVLEGEEAIRRHREIMGATNPKEALAGTLRACFAESIDRNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +  +A  EI+Y+F+  EI 
Sbjct: 121 APASAAREIAYFFSDAEIC 139


>gi|194098881|ref|YP_002001945.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae NCCP11945]
 gi|239999167|ref|ZP_04719091.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae 35/02]
 gi|240013925|ref|ZP_04720838.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae DGI18]
 gi|240016367|ref|ZP_04722907.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae FA6140]
 gi|240080486|ref|ZP_04725029.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae FA19]
 gi|240113146|ref|ZP_04727636.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae MS11]
 gi|240115902|ref|ZP_04729964.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID18]
 gi|240118200|ref|ZP_04732262.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID1]
 gi|240121494|ref|ZP_04734456.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID24-1]
 gi|240123748|ref|ZP_04736704.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID332]
 gi|240125939|ref|ZP_04738825.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae SK-92-679]
 gi|240128451|ref|ZP_04741112.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493939|ref|ZP_05107110.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae 1291]
 gi|260440283|ref|ZP_05794099.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae DGI2]
 gi|268594998|ref|ZP_06129165.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae 35/02]
 gi|268596622|ref|ZP_06130789.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae FA19]
 gi|268599226|ref|ZP_06133393.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae MS11]
 gi|268601573|ref|ZP_06135740.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID18]
 gi|268603912|ref|ZP_06138079.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID1]
 gi|268682375|ref|ZP_06149237.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID332]
 gi|268684533|ref|ZP_06151395.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae SK-92-679]
 gi|268686843|ref|ZP_06153705.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae SK-93-1035]
 gi|291043578|ref|ZP_06569294.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae DGI2]
 gi|293398891|ref|ZP_06643056.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae F62]
 gi|226729835|sp|B4RMG0|NDK_NEIG2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|193934171|gb|ACF29995.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae NCCP11945]
 gi|226512979|gb|EEH62324.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae 1291]
 gi|268548387|gb|EEZ43805.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae 35/02]
 gi|268550410|gb|EEZ45429.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae FA19]
 gi|268583357|gb|EEZ48033.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae MS11]
 gi|268585704|gb|EEZ50380.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID18]
 gi|268588043|gb|EEZ52719.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID1]
 gi|268622659|gb|EEZ55059.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae PID332]
 gi|268624817|gb|EEZ57217.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae SK-92-679]
 gi|268627127|gb|EEZ59527.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012041|gb|EFE04030.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae DGI2]
 gi|291610305|gb|EFF39415.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae F62]
 gi|317164454|gb|ADV07995.1| nucleoside diphosphate kinase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 141

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  K+A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M  GPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPTEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F++ EI 
Sbjct: 121 SVENAALEIAYFFSQTEIC 139


>gi|326511160|dbj|BAJ87594.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 246

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 81/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +VA K    +++ AE  Y   K+RPFF  
Sbjct: 96  MERTFIAIKPDGVQRGLISEIVSRFERKGYKLVAIKLVVPSKQFAEKHYHDLKERPFFSG 155

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 156 LCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 215

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 216 ETAKDEIALWFQPKELV 232


>gi|304311804|ref|YP_003811402.1| Nucleoside diphosphate kinase [gamma proteobacterium HdN1]
 gi|301797537|emb|CBL45757.1| Nucleoside diphosphate kinase [gamma proteobacterium HdN1]
          Length = 143

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N IG I    E  GL +VAA+   +++ QAE FY  H++R FF
Sbjct: 1   MAIERTLSIIKPDAVAKNAIGDIYSRFEKGGLKIVAARMMHLSQAQAEGFYAEHRERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE A+  +R++MG TDPKKA  GTIR  +  SI EN++HGSD
Sbjct: 61  KDLVAFMTSGPVIVQVLEGENAVLCHRDLMGATDPKKAAAGTIRADFASSIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+  E+ 
Sbjct: 121 STTSAAREIAYFFSETEVC 139


>gi|218888243|ref|YP_002437564.1| nucleoside diphosphate kinase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|226729798|sp|B8DNF4|NDK_DESVM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|218759197|gb|ACL10096.1| Nucleoside-diphosphate kinase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 139

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 100/139 (71%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAV+RNL G+I+K ++D GL VVA K   + R QAE FY +H++RPFF 
Sbjct: 1   MAERTFSIIKPDAVERNLSGAILKMIQDSGLKVVAMKMIHLTRSQAEGFYAVHRERPFFD 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M SGPV   VL+G+ AI + R++MG T+P  A +GTIR  Y +SI  NS+HGSD+
Sbjct: 61  SLVTYMCSGPVVCSVLEGDNAIQRYRDLMGATNPANAAEGTIRKTYAVSIEANSVHGSDA 120

Query: 122 LKTALEEISYWFARNEIIG 140
            +TA  EI+Y+F   E++G
Sbjct: 121 PETAAYEIAYFFNALEMVG 139


>gi|21593387|gb|AAM65336.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana]
          Length = 237

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 87  MERTFIAIKPDGVQRGLISEIITRFERKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNG 146

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 147 LCNFLSSGPVVAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 206

Query: 123 KTALEEISYWFARNEII 139
           +TA +EIS WF   E++
Sbjct: 207 ETAKDEISLWFKPEELV 223


>gi|304321683|ref|YP_003855326.1| nucleoside diphosphate kinase [Parvularcula bermudensis HTCC2503]
 gi|303300585|gb|ADM10184.1| nucleoside diphosphate kinase [Parvularcula bermudensis HTCC2503]
          Length = 140

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 103/140 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I+ +LED GL VVA K   ++  QA+ FY +HK+RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGQIIAKLEDGGLRVVAQKRIRLSEDQAKSFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AIS+NRE+MG T+P +A  GTIR ++  +I  NS+HGSD
Sbjct: 61  SDLVSFMTSGPVVVQVLEGENAISRNREIMGATNPSEAAPGTIRAEFAENIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
              TA EEI ++F  +EI+G
Sbjct: 121 GPDTAAEEIKFFFTDDEIVG 140


>gi|288958646|ref|YP_003448987.1| nucleoside-diphosphate kinase [Azospirillum sp. B510]
 gi|288910954|dbj|BAI72443.1| nucleoside-diphosphate kinase [Azospirillum sp. B510]
          Length = 140

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 105/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDA +RNL G I  + ED GL +VA K   +++ QAE FY +H++RPFF
Sbjct: 1   MAVERTLSIIKPDATRRNLTGKINAKFEDGGLRIVAQKRVQLSKAQAEQFYGVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV LQVL+GE AI++NRE+MG T+P  A +GTIR ++  SI  NS+HGSD
Sbjct: 61  GDLVSFMISGPVVLQVLEGENAIARNREIMGATNPANAAEGTIRKEFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI+++FA  E++G
Sbjct: 121 APETAAQEIAFFFAGIELVG 140


>gi|226328009|ref|ZP_03803527.1| hypothetical protein PROPEN_01900 [Proteus penneri ATCC 35198]
 gi|225203713|gb|EEG86067.1| hypothetical protein PROPEN_01900 [Proteus penneri ATCC 35198]
          Length = 141

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKP+AVK+N+IG+I    E  G  ++ AK   + R+QAE FY  HK RPFF
Sbjct: 1   MAIQRTFSIIKPNAVKKNVIGAIYNRFESAGFSIIGAKMLHLTREQAEGFYEEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE  I ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENVIQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F  NE+ 
Sbjct: 121 SEASAAREIAYFFTENEVC 139


>gi|281341551|gb|EFB17135.1| hypothetical protein PANDA_008921 [Ailuropoda melanoleuca]
          Length = 157

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K      +   + Y   + +PF+P L
Sbjct: 9   ERTLVAVKPDGVQRRLVGDVIQRFERRGFKLVGMKMLQAPERVLAEHYHDLQRKPFYPAL 68

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G TD  +A  GTIR  + I I  N IH SDS++
Sbjct: 69  ISYMTSGPVVAMVWEGPNVVCSSRAMIGHTDSAEAAPGTIRGDFSIHISRNIIHASDSVE 128

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 129 GAQREIQLWFQSSELV 144


>gi|237844373|ref|XP_002371484.1| nucleoside diphosphate kinase, putative [Toxoplasma gondii ME49]
 gi|211969148|gb|EEB04344.1| nucleoside diphosphate kinase, putative [Toxoplasma gondii ME49]
 gi|221481234|gb|EEE19635.1| nucleoside diphosphate kinase, putative [Toxoplasma gondii GT1]
 gi|221501782|gb|EEE27542.1| nucleoside diphosphate kinase, putative [Toxoplasma gondii VEG]
          Length = 155

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 82/136 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T+ M+KPD V+R L+  +++  E  G  +VA K    +    E+ Y   K +PFFP L
Sbjct: 7   ERTYIMVKPDGVQRGLVSEVIRRFEQRGYKLVALKMKSPDATLLEEHYADLKGKPFFPGL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G + + + R ++G+T P ++  GT+R  + I +G N +HGSDS++
Sbjct: 67  ISYMTSGPVVCMVWEGTDVVKQGRRMLGETRPLESNPGTLRGDFCIDVGRNIVHGSDSVE 126

Query: 124 TALEEISYWFARNEII 139
           +A +EIS WF   EI 
Sbjct: 127 SANKEISLWFTPEEIC 142


>gi|269958435|ref|YP_003328222.1| nucleoside diphosphate kinase [Anaplasma centrale str. Israel]
 gi|269848264|gb|ACZ48908.1| nucleoside diphosphate kinase [Anaplasma centrale str. Israel]
          Length = 146

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/140 (50%), Positives = 96/140 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M+ EKT S++KPD V+R +IG ++  +E  GL +VA K C ++ +QAE FY +HK RPFF
Sbjct: 1   MMFEKTLSILKPDVVERGIIGRVISYIEGAGLRIVAQKMCALSPEQAEAFYAVHKARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV  M SGPV +QVL GE A+   R+VMG T+P++A  GTIR     SI  N +HGSD
Sbjct: 61  PSLVSFMTSGPVVVQVLVGESAVKTYRDVMGATNPREAAPGTIRGDLAESIDANCVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           SL+ A  EI ++F  +EI+G
Sbjct: 121 SLENAEREIRFFFQEHEIVG 140


>gi|289613173|emb|CBI59767.1| unnamed protein product [Sordaria macrospora]
          Length = 152

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 51/135 (37%), Positives = 79/135 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G+IV   E+ G  +VA K     +   E  Y     +PFF  L
Sbjct: 5   EQTFIAVKPDGVQRGLVGNIVSRFENRGFKLVAMKLTSPGQAHLEKHYEDLNTKPFFAGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGP+   V +G++A+   R ++G T+P  +  GTIR  + + +G N  HGSDS++
Sbjct: 65  IKYMNSGPICAMVWEGKDAVKTGRTILGATNPLASAPGTIRGDFALDMGRNVCHGSDSVE 124

Query: 124 TALEEISYWFARNEI 138
            A +EI+ WF   E+
Sbjct: 125 NAKKEIALWFKPEEL 139


>gi|169830306|ref|YP_001716288.1| nucleoside-diphosphate kinase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226729797|sp|B1I1P4|NDK_DESAP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|169637150|gb|ACA58656.1| Nucleoside-diphosphate kinase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 150

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++TF M+KPD V+R L+G ++   E  G  +VA K  W++R  AE  Y  H+ +PFF E
Sbjct: 1   MDRTFVMVKPDGVQRGLVGEVITRFERRGFKLVALKLLWIDRGLAERHYEEHRGKPFFDE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   VL+G E ++  RE+MG T P KAL GTIR  YGI +G N +HGSDS 
Sbjct: 61  LVRYITSGPVAAMVLEGREVVTTVREMMGATQPAKALPGTIRGTYGIDVGRNIVHGSDSA 120

Query: 123 KTALEEISYWFARNEII 139
            +A  EI  +FA  E+I
Sbjct: 121 ASAAREIGLFFADGELI 137


>gi|73989154|ref|XP_534114.2| PREDICTED: similar to Nucleoside diphosphate kinase, mitochondrial
           precursor (NDP kinase, mitochondrial) (NDK) (nm23-H4)
           (Nucleoside diphosphate kinase D) (NDPKD) [Canis
           familiaris]
          Length = 773

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K      +   + +   + +PF+P L
Sbjct: 624 ERTLVAVKPDGVQRRLVGDVIQRFERRGFKLVGMKMLQAPERVLAEHHHDLQRKPFYPPL 683

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G TD  +A  GTIR  + I I  N IH SDS++
Sbjct: 684 ISYMTSGPVVAMVWEGPSVVCSSRTMIGHTDSAEATPGTIRGDFSIHISRNIIHASDSVE 743

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 744 GARREIQLWFQSSELV 759


>gi|323489689|ref|ZP_08094916.1| Nucleoside-diphosphate kinase [Planococcus donghaensis MPA1U2]
 gi|323396820|gb|EGA89639.1| Nucleoside-diphosphate kinase [Planococcus donghaensis MPA1U2]
          Length = 148

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+RN+IG IV   E  G  +  AK   +  + AE+ Y  HK+RPFF E
Sbjct: 1   MEKTFLMVKPDGVQRNVIGEIVARFEKKGYHLAGAKLMQIPTELAEEHYGEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  V +GE  I   R++MG T+PK A  GTIR  + +++G+N IHGSDS 
Sbjct: 61  LVEFITSGPVFAMVWEGENVILTARQMMGATNPKDAAPGTIRGDFAVTVGKNMIHGSDSA 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F   E++
Sbjct: 121 ESAEREIGLFFKEEELV 137


>gi|260951349|ref|XP_002619971.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238847543|gb|EEQ37007.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 152

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 84/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R LI SI+   E+ G  +V  K C    +   + Y   +++PFFP L
Sbjct: 5   ERTFIAIKPDGVQRGLIASILSRFENRGFKLVGIKLCQPTEELLRNHYEDLQEKPFFPSL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M+SGPV   V +G++ + + R ++G T+P ++  GTIR  + I +G N  HGSDS++
Sbjct: 65  LSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGTIRGDFAIDMGRNVAHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF + E++
Sbjct: 125 SANKEIGLWFKKEELV 140


>gi|224002899|ref|XP_002291121.1| nucleoside diphosphate kinase [Thalassiosira pseudonana CCMP1335]
 gi|220972897|gb|EED91228.1| nucleoside diphosphate kinase [Thalassiosira pseudonana CCMP1335]
          Length = 152

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 86/138 (62%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+T+ MIKPD V+R ++G+I+   E  G  +VA K     ++  +  Y    ++PFFP
Sbjct: 3   ASERTYIMIKPDGVQRGIVGNIISRFETKGYKLVALKTKQATKELLDTHYCDLVEKPFFP 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           +L   M+SGPV   + +G+EA++  R+++G T+P  +  GTIR  + I +G N  HGSDS
Sbjct: 63  KLRDYMMSGPVVSMIWEGKEAVATGRKMLGATNPLASEPGTIRGDFCIEVGRNICHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           ++ A +EI+ WF  +E++
Sbjct: 123 VENAEKEIALWFEESELL 140


>gi|163735787|ref|ZP_02143216.1| nucleoside diphosphate kinase [Roseobacter litoralis Och 149]
 gi|161390873|gb|EDQ15213.1| nucleoside diphosphate kinase [Roseobacter litoralis Och 149]
          Length = 140

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDA +RNL G I  + ED GL +VA K   M + QA  FY +H +RPF+
Sbjct: 1   MALERTFSIIKPDATRRNLTGKINAKFEDAGLRIVAQKRIHMTKAQAGVFYAVHSERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPADAALGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+Y+F+  E++G
Sbjct: 121 APETAAEEIAYFFSGMELVG 140


>gi|301108277|ref|XP_002903220.1| nucleoside diphosphate kinase B [Phytophthora infestans T30-4]
 gi|262097592|gb|EEY55644.1| nucleoside diphosphate kinase B [Phytophthora infestans T30-4]
          Length = 151

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/135 (40%), Positives = 80/135 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R+L+G I+K  E  G  +VA K    + +  E  Y     RPFF
Sbjct: 1   MARERTYIMIKPDGVQRHLVGEIIKRFETKGYKLVALKLARPSVEHLEAHYSDLSGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGPV   V +G   + + R+++G T P ++  GTIR  + + +G N  HGSD
Sbjct: 61  PALIKYMSSGPVTCMVWEGTNVVLEGRKMLGATKPSESALGTIRGDFCVDVGRNVCHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S+ +A +EIS WF  
Sbjct: 121 SVDSAEKEISLWFPE 135


>gi|126335377|ref|XP_001372617.1| PREDICTED: similar to gag polyprotein [Monodelphis domestica]
          Length = 831

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 76/136 (55%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K      K   + Y   K +PF+P L
Sbjct: 150 ERTLIAVKPDGVQRRLVGDVIRRFERRGFKLVGMKLLQAPEKVLAEHYHDLKKKPFYPNL 209

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G+TD   A  GTIR  + + I  N +H SDS++
Sbjct: 210 IKYMSSGPVVAMVWEGYNVVRTSRAMVGNTDSADAAPGTIRGDFSVHISRNVVHASDSVE 269

Query: 124 TALEEISYWFARNEII 139
            A  EIS WF  +E++
Sbjct: 270 VAQREISLWFHSSELV 285


>gi|46580738|ref|YP_011546.1| nucleoside diphosphate kinase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601973|ref|YP_966373.1| nucleoside diphosphate kinase [Desulfovibrio vulgaris DP4]
 gi|67460689|sp|Q729L7|NDK_DESVH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166232968|sp|A1VBY0|NDK_DESVV RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|46450158|gb|AAS96806.1| nucleoside diphosphate kinase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562202|gb|ABM27946.1| nucleoside diphosphate kinase [Desulfovibrio vulgaris DP4]
 gi|311234453|gb|ADP87307.1| Nucleoside-diphosphate kinase [Desulfovibrio vulgaris RCH1]
          Length = 139

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 99/139 (71%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           ++E+TFS+IKPDAV+RNL G ++  ++  GL VVA K   + + QAE FY +H++RPFF 
Sbjct: 1   MVERTFSIIKPDAVERNLQGEVLAMIQGAGLKVVAMKMIHLTKAQAEGFYAVHRERPFFD 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L   M SGPV   VL+GE AIS+ RE+MG T+P  A +GTIR KY +S+  NS+HGSD+
Sbjct: 61  SLTTYMCSGPVVCSVLEGENAISRYREIMGATNPANAAEGTIRKKYAVSLEANSVHGSDA 120

Query: 122 LKTALEEISYWFARNEIIG 140
            +TA  EISY+F   EI+G
Sbjct: 121 PETAAFEISYFFNALEIVG 139


>gi|302759597|ref|XP_002963221.1| hypothetical protein SELMODRAFT_270355 [Selaginella moellendorffii]
 gi|300168489|gb|EFJ35092.1| hypothetical protein SELMODRAFT_270355 [Selaginella moellendorffii]
          Length = 234

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           IE+TF  IKPD V+R LI  I+   E  G  +VA K     ++ A   Y   K+RPFF  
Sbjct: 85  IERTFIAIKPDGVQRGLISEIISRFERKGYKLVAIKILTPTKEFAMLHYDDLKERPFFNG 144

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +G+  +   R+++G T P  +  GTIR    IS+G N IHGSD  
Sbjct: 145 LCDFLSSGPVVAMVWEGQGVVKYGRKLIGATSPHNSEPGTIRGDLAISVGRNIIHGSDGP 204

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 205 ETAKNEINLWFKPEELV 221


>gi|86149234|ref|ZP_01067466.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88597277|ref|ZP_01100512.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|218561991|ref|YP_002343770.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|18203358|sp|Q9PIG7|NDK_CAMJE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|85840592|gb|EAQ57849.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88190338|gb|EAQ94312.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|112359697|emb|CAL34483.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|284925604|gb|ADC27956.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|315927864|gb|EFV07189.1| Nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 137

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/137 (51%), Positives = 100/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE+FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + +L+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F  NEI 
Sbjct: 121 ENAKIEIEFFFKPNEIC 137


>gi|289550752|ref|YP_003471656.1| Nucleoside diphosphate kinase [Staphylococcus lugdunensis HKU09-01]
 gi|289180284|gb|ADC87529.1| Nucleoside diphosphate kinase [Staphylococcus lugdunensis HKU09-01]
          Length = 149

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 91/136 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPDAV+RNLIG+I+  +E+ GL +V AK   +    AE  Y  HK +PF+  
Sbjct: 1   MERTFLMLKPDAVQRNLIGNIISRIENKGLKLVGAKLMTVPTSLAEAHYAEHKGKPFYDG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++ +R ++G T+P +A  G+IR   G+++G N IHGSDSL
Sbjct: 61  LISFITSAPVFAMVVEGENAVNVSRHIIGQTNPAEAAPGSIRGDLGLTVGRNVIHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
            +A  EI  WF  NEI
Sbjct: 121 ASAEREIHLWFDENEI 136


>gi|167626768|ref|YP_001677268.1| nucleoside diphosphate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189029040|sp|B0U0L6|NDK_FRAP2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|167596769|gb|ABZ86767.1| Nucleoside-diphosphate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 140

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 105/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  ++T S+IKPDAV++N+IG I +  E  GL VVAAK   +++ +AE FY +HKDRPFF
Sbjct: 1   MNKQRTLSIIKPDAVEKNIIGEIYRRFEKSGLKVVAAKMKHLSKAEAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +QVL+G+ AI+KNR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  SALVEFMISGPVMIQVLEGDNAIAKNRKLMGATNPKEAEAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI Y+F+  EI+G
Sbjct: 121 APETAAQEIKYFFSDIEIVG 140


>gi|1051256|gb|AAA85097.1| DR-nm23 [Homo sapiens]
          Length = 168

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 83/136 (61%), Gaps = 1/136 (0%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQSSEELLREHYAELRERPFYGRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G T+P  A  GTIR  + I +G N IHGSDS++
Sbjct: 82  VKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVG-NLIHGSDSVE 140

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 141 SARREIALWFRADELL 156


>gi|116791705|gb|ABK26078.1| unknown [Picea sitchensis]
          Length = 144

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 80/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   +   + R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFILKGLRMVGVERSFAEKHYEDLSSKPFFTG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSD++
Sbjct: 61  LVEYIISGPVVAMVWEGKGVVATGRKIIGATNPAASEPGTIRGDFAVEIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESAKKEIALWFPD 133


>gi|261401248|ref|ZP_05987373.1| nucleoside diphosphate kinase [Neisseria lactamica ATCC 23970]
 gi|313668446|ref|YP_004048730.1| nucleoside diphosphate kinase [Neisseria lactamica ST-640]
 gi|269208731|gb|EEZ75186.1| nucleoside diphosphate kinase [Neisseria lactamica ATCC 23970]
 gi|309379238|emb|CBX22195.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005908|emb|CBN87364.1| nucleoside diphosphate kinase [Neisseria lactamica 020-06]
          Length = 141

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  ++A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLREAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M  GPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPAEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+F++ EI 
Sbjct: 121 SVENAALEIAYFFSQTEIC 139


>gi|57641242|ref|YP_183720.1| nucleoside diphosphate kinase [Thermococcus kodakarensis KOD1]
 gi|67460613|sp|Q5JGR7|NDK_PYRKO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|57159566|dbj|BAD85496.1| nucleoside diphosphate kinase [Thermococcus kodakarensis KOD1]
          Length = 174

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           IE+T  ++KPDAV R L+G I+   E  GL +V  K  W++RK AE  Y  HK +PFF  
Sbjct: 6   IERTLIILKPDAVVRGLMGEIISRFEKRGLKIVGMKMIWIDRKLAEKHYAEHKGKPFFEP 65

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   P  + V++G  AIS  R++ G TDPK A  G+IR  YG+ +G+   N IH S
Sbjct: 66  LIDYITKAPSVVMVVEGRYAISVVRKMAGATDPKDAEPGSIRGDYGLDVGDAIYNVIHAS 125

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EI+ +F   E+
Sbjct: 126 DSPESAEREINLYFKPEEL 144


>gi|329666291|pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From
           Giardia Lamblia Featuring A Disordered Dinucleotide
           Binding Site
          Length = 155

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF M+KPD V+R L+G I+   E  G  +VA KF   ++   E+ Y  H  RPFF
Sbjct: 5   MARERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHAARPFF 64

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + + SGPV   V +G   +S +R +MG T P ++  GTIR  +GI +G N IHGS 
Sbjct: 65  AGLCKFLSSGPVCAMVWEGANVVSISRTMMGVTKPAESAPGTIRGDFGIDVGRNIIHGSA 124

Query: 121 SLKTALEEISYWFARNEI 138
           +L  A  EI+ WF   E+
Sbjct: 125 NLDDAAREIALWFKPEEV 142


>gi|226504662|ref|NP_001150225.1| nucleoside diphosphate kinase 4 [Zea mays]
 gi|195637658|gb|ACG38297.1| nucleoside diphosphate kinase 4 [Zea mays]
          Length = 237

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 81/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +VA K    ++  AE  Y   K+RPFF  
Sbjct: 87  MERTFIAIKPDGVQRGLISEIVNRFERKGYKLVAIKLIVPSKGFAEKHYHDLKERPFFNG 146

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR   G+ +G N IHGSD  
Sbjct: 147 LCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLGVVVGRNIIHGSDGP 206

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 207 ETAKDEIALWFEPKELV 223


>gi|166712104|ref|ZP_02243311.1| nucleoside diphosphate kinase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 141

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGQIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +Q L+GE A++ +R+++G T+PK A  GTIR  +  SI  N+ HGSD
Sbjct: 61  SALVEFMISGPVMIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA  E++
Sbjct: 121 SVENAANEVAYFFAATEVV 139


>gi|153951886|ref|YP_001398617.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. doylei
           269.97]
 gi|166232962|sp|A7H537|NDK_CAMJD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|152939332|gb|ABS44073.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 137

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 72/136 (52%), Positives = 100/136 (73%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE+FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           + A  EI ++F  NEI
Sbjct: 121 ENAKIEIEFFFKPNEI 136


>gi|326511321|dbj|BAJ87674.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 150

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 79/134 (58%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF MIKPD V+R LIG ++   E  G  +   K   + +  AE  Y     +PFF 
Sbjct: 1   MAEQTFIMIKPDGVQRGLIGEVISRFEKKGFYLKGMKLQNVEKSFAEQHYADLSSKPFFA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ ++SGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSDS
Sbjct: 61  GLVEYIVSGPVVAMVWEGKSVVATGRKIIGATNPLASEPGTIRGDFAVDIGRNVIHGSDS 120

Query: 122 LKTALEEISYWFAR 135
           ++ A +EI+ WF  
Sbjct: 121 VENARKEIALWFPE 134


>gi|308160763|gb|EFO63236.1| Nucleoside diphosphate kinase [Giardia lamblia P15]
          Length = 151

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 81/138 (58%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF M+KPD V+R L+G I+   E  G  +VA KF   ++   E+ Y  H  RPFF
Sbjct: 1   MARERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHATRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + + SGPV   V +G   +S +R +MG T P ++  GTIR  +GI +G N IHGS 
Sbjct: 61  AGLCKFLSSGPVCAMVWEGANVVSISRTMMGVTKPAESAPGTIRGDFGIDVGRNIIHGSA 120

Query: 121 SLKTALEEISYWFARNEI 138
           +L+ A  EI+ WF   E+
Sbjct: 121 NLEDAAREIALWFKPEEV 138


>gi|145629951|ref|ZP_01785733.1| nucleoside diphosphate kinase [Haemophilus influenzae R3021]
 gi|144984232|gb|EDJ91655.1| nucleoside diphosphate kinase [Haemophilus influenzae R3021]
          Length = 140

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 94/137 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFFA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+S P+   VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMMSSPIVASVLEKENAVKDYRTLIGTTNPETAAEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           ++ A  EI+Y+F  +EI
Sbjct: 121 IENANREIAYFFTDSEI 137


>gi|315282958|ref|ZP_07871251.1| nucleoside diphosphate kinase [Listeria marthii FSL S4-120]
 gi|313613405|gb|EFR87256.1| nucleoside diphosphate kinase [Listeria marthii FSL S4-120]
          Length = 147

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  +PFF +
Sbjct: 1   MEQTYVMVKPDGVERGLIGEIVTRIEQKGLKLVAGKLMQIDRELAEKHYAEHIGKPFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G+ AI+  R +MG T+P +A  GTIR  Y I    N IHGSDS 
Sbjct: 61  LIGFITSGPVFAMVLEGDGAITTARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F   EI+
Sbjct: 121 ESAKREIQLFFEPYEIL 137


>gi|290892089|ref|ZP_06555085.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL J2-071]
 gi|290558212|gb|EFD91730.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL J2-071]
          Length = 147

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y +    N IHGSDSL
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAVHTNRNVIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA  EI+
Sbjct: 121 ESAKREIQLFFAPQEIL 137


>gi|294670878|ref|ZP_06735734.1| hypothetical protein NEIELOOT_02582 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307365|gb|EFE48608.1| hypothetical protein NEIELOOT_02582 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 141

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 79/139 (56%), Positives = 106/139 (76%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++T S+IKPDAV +N+IG I    ED GL +VAAK   ++R++AE FY +HK+RPFF
Sbjct: 1   MTIQRTISIIKPDAVGKNVIGKIYSRFEDNGLKIVAAKMKHLSREEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGPV +QVL+GE+A++KNRE+MG T+PK+A  GTIR  +  S+GEN++HGSD
Sbjct: 61  HELVNFMISGPVMIQVLEGEDAVAKNRELMGATNPKEAATGTIRADFAESVGENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+Y+F   EI 
Sbjct: 121 SLENAALEIAYFFTEAEIC 139


>gi|258545516|ref|ZP_05705750.1| nucleoside diphosphate kinase [Cardiobacterium hominis ATCC 15826]
 gi|258519216|gb|EEV88075.1| nucleoside diphosphate kinase [Cardiobacterium hominis ATCC 15826]
          Length = 140

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  + T S+IKPDAV+ +  G+I+  LE  GL +VAAK   ++R  A  FY +H++RPFF
Sbjct: 1   MPAQMTLSIIKPDAVQNHHTGAILDRLEKNGLEIVAAKMLRLSRDDAARFYDVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SG V +QVL+GE+A+++ R +MG TDPK+A  GT+R  +    G N++HGSD
Sbjct: 61  AELVEFMTSGAVMVQVLRGEDAVARYRTLMGATDPKEAAPGTLRADFAEDKGRNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+++FA  E+ 
Sbjct: 121 SLENAAREIAFFFAERELC 139


>gi|325296925|ref|NP_001191454.1| nucleoside diphosphate kinase B [Monodelphis domestica]
          Length = 151

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 2/140 (1%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  IKPD V+R L+G I+K  E  G  +VA KF   + +  +  Y+  KDRPF
Sbjct: 1   MANTERTFIAIKPDGVQRGLVGDIIKRFEQKG-SLVAMKFLRASEEHLKQHYVDLKDRPF 59

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP LV+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 60  FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS 119

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 120 DSVKSAEKEISLWFKPEELV 139


>gi|319956057|ref|YP_004167320.1| nucleoside diphosphate kinase [Nitratifractor salsuginis DSM 16511]
 gi|319418461|gb|ADV45571.1| nucleoside diphosphate kinase [Nitratifractor salsuginis DSM 16511]
          Length = 137

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 103/137 (75%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+N+IG I+   E  GL V A K   ++R  AE FY +HK+RPFF E
Sbjct: 1   MEKTLSIIKPDAVKKNVIGKIIDRFESNGLRVAAIKKIQLSRADAEAFYAVHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A++KNRE+MG TDPK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGENAVAKNRELMGATDPKEAAPGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A +EI+++FA+ EI+
Sbjct: 121 ENAEKEIAFFFAQREIL 137


>gi|294677257|ref|YP_003577872.1| nucleoside diphosphate kinase [Rhodobacter capsulatus SB 1003]
 gi|294476077|gb|ADE85465.1| nucleoside diphosphate kinase [Rhodobacter capsulatus SB 1003]
          Length = 140

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDA +RNL G I  + E+ GL +VA K   ++ +QA  FY +HK+RPF+
Sbjct: 1   MAIERTLSIIKPDATRRNLTGKINAKFEEAGLRIVAQKRIKLSLEQAGKFYEVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S PV +QVL+GE AI+KNREVMG T+P  A+ GTIR ++ +S+GENS+HGSD
Sbjct: 61  GELCEFMASEPVVVQVLEGEGAIAKNREVMGATNPANAVDGTIRKEFALSVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+++F+  E++G
Sbjct: 121 APETAAVEIAFFFSGLELVG 140


>gi|254504507|ref|ZP_05116658.1| Nucleoside diphosphate kinase superfamily [Labrenzia alexandrii
           DFL-11]
 gi|222440578|gb|EEE47257.1| Nucleoside diphosphate kinase superfamily [Labrenzia alexandrii
           DFL-11]
          Length = 140

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 85/140 (60%), Positives = 111/140 (79%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+IVK+ ED GL VVA+K  WM+ ++AE FY +H +RPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAIVKKFEDAGLRVVASKRVWMSIREAEAFYAVHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELTEFMSSGPTVVQVLEGENAIAKNREVMGATNPADAAEGTIRKEFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI++WF+  E++G
Sbjct: 121 APETAAEEIAFWFSGTELVG 140


>gi|312884227|ref|ZP_07743936.1| nucleoside diphosphate kinase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368000|gb|EFP95543.1| nucleoside diphosphate kinase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 141

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 99/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKPDAV+R+LIG I + +E  GL ++AAK   +  +QA  FY  H+ + FF
Sbjct: 1   MALERTFSIIKPDAVERDLIGEIYRRIEKAGLKIIAAKMVTLTEEQASGFYAEHEGKDFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + M SGP+ +QVL+GE AIS+ RE+MG T+P++A  GT+R  Y +++  NS+HGSD
Sbjct: 61  PPLKEFMTSGPIMVQVLEGENAISRYRELMGKTNPEQAACGTLRADYALNMRLNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI ++F  +EI
Sbjct: 121 STESAAREIEFFFPASEI 138


>gi|91784210|ref|YP_559416.1| nucleoside diphosphate kinase [Burkholderia xenovorans LB400]
 gi|296158995|ref|ZP_06841823.1| Nucleoside-diphosphate kinase [Burkholderia sp. Ch1-1]
 gi|119372021|sp|Q13X25|NDK_BURXL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|91688164|gb|ABE31364.1| nucleoside diphosphate kinase [Burkholderia xenovorans LB400]
 gi|295890870|gb|EFG70660.1| Nucleoside-diphosphate kinase [Burkholderia sp. Ch1-1]
          Length = 141

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 96/134 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYTRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE AI K+R++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVVVQALEGENAILKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           + +TA  EI+++F 
Sbjct: 121 APETAAVEIAFFFP 134


>gi|57506046|ref|ZP_00371969.1| nucleoside diphosphate kinase Cj0332c [Campylobacter upsaliensis
           RM3195]
 gi|315638792|ref|ZP_07893964.1| nucleoside diphosphate kinase [Campylobacter upsaliensis JV21]
 gi|57015654|gb|EAL52445.1| nucleoside diphosphate kinase Cj0332c [Campylobacter upsaliensis
           RM3195]
 gi|315481010|gb|EFU71642.1| nucleoside diphosphate kinase [Campylobacter upsaliensis JV21]
          Length = 137

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 99/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAVK+ +IG I+   E  GL + A K   ++++QAE FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKLQLSKEQAEGFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A+ KNRE+MG T+PK+A  GTIR  +  +I  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGENAVLKNRELMGATNPKEAKAGTIRADFAENIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F  NEI 
Sbjct: 121 ENAKIEIDFFFKPNEIC 137


>gi|294625019|ref|ZP_06703669.1| nucleoside diphosphate kinase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666608|ref|ZP_06731847.1| nucleoside diphosphate kinase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600694|gb|EFF44781.1| nucleoside diphosphate kinase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292603628|gb|EFF47040.1| nucleoside diphosphate kinase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 141

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/139 (49%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGDIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +Q L+GE A++ +R+++G T+PK A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVMIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA  E++
Sbjct: 121 SVENAANEVAYFFAATEVV 139


>gi|254673135|emb|CBA07922.1| Nucleoside diphosphate kinase [Neisseria meningitidis alpha275]
 gi|308389427|gb|ADO31747.1| nucleoside diphosphate kinase [Neisseria meningitidis alpha710]
 gi|325144552|gb|EGC66851.1| nucleoside-diphosphate kinase [Neisseria meningitidis M01-240013]
          Length = 141

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  K+A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M  GPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPAEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + + A  EI+Y+F++ EI 
Sbjct: 121 TPENAALEIAYFFSQTEIC 139


>gi|226480504|emb|CAX78915.1| nucleoside-diphosphate kinase [Schistosoma japonicum]
          Length = 149

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G I++  E  G  ++A K    + +  +  Y   K  PFF  
Sbjct: 1   MERTFIMVKPDGVQRGLVGEIIQRFERRGYKLIAVKMIHASEQLLQTHYEALKSLPFFTN 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV   V +G +A+   R ++G T P+ +  G+IR  +   +G N +HGSDS+
Sbjct: 61  LVAYMSSGPVVPMVFEGRKAVENGRTMLGATRPEASCPGSIRGDFCQDVGRNVVHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  E + WF+  E+ 
Sbjct: 121 ESANRETNLWFSPQELC 137


>gi|145353779|ref|XP_001421179.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581416|gb|ABO99472.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 150

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 51/135 (37%), Positives = 78/135 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T+ MIKPD V+R L+  I+      G  + A K   ++++ AE  Y     +PFF
Sbjct: 1   MATERTYIMIKPDGVQRGLVAEIIARFARKGFTLRALKMQNVSKEHAEKHYADLSSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV   V +G++ +   R+++G T+P  +  GTIR  + I +G N IHGSD
Sbjct: 61  GGLVSYMCSGPVVAMVWEGKDVVKTGRKIIGATNPAASEPGTIRGDFCIEVGRNVIHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           ++++A  EI+ WF  
Sbjct: 121 AVESANHEIALWFPE 135


>gi|126739390|ref|ZP_01755083.1| nucleoside diphosphate kinase [Roseobacter sp. SK209-2-6]
 gi|126719490|gb|EBA16199.1| nucleoside diphosphate kinase [Roseobacter sp. SK209-2-6]
          Length = 140

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/140 (50%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDA +RNL G+I  + E+ GL VVA K   + + QA  FY +H +RPF+
Sbjct: 1   MALQRTFSIIKPDATRRNLTGAINAKFEEAGLRVVAQKRIHLTKAQAGKFYEVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M S P+  QVL+GE+AI+KNRE+MG T+P  A  GTIR ++  S+GENS+HGSD
Sbjct: 61  DELCEFMSSEPIVAQVLEGEDAIAKNREIMGATNPADAAAGTIRAEFAESVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+Y+F+  E++G
Sbjct: 121 APETAAVEIAYFFSGLELVG 140


>gi|6435320|gb|AAF08537.1|AF191098_1 nucleoside diphosphate kinase [Pisum sativum]
          Length = 233

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K     ++ A+  Y   K+RPFF  
Sbjct: 83  LERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNG 142

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I+  R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 143 LCDFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGP 202

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI  WF   E++
Sbjct: 203 ETAKDEIKLWFKPEELV 219


>gi|221310189|ref|ZP_03592036.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221314512|ref|ZP_03596317.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221319434|ref|ZP_03600728.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221323710|ref|ZP_03605004.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|296332989|ref|ZP_06875446.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674907|ref|YP_003866579.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|321311743|ref|YP_004204030.1| nucleoside diphosphate kinase [Bacillus subtilis BSn5]
 gi|124494404|gb|ABN13293.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|124494423|gb|ABN13311.1| nucleoside diphosphate kinase [Bacillus subtilis]
 gi|291484697|dbj|BAI85772.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. natto
           BEST195]
 gi|296149840|gb|EFG90732.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305413151|gb|ADM38270.1| nucleoside diphosphate kinase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|320018017|gb|ADV93003.1| nucleoside diphosphate kinase [Bacillus subtilis BSn5]
          Length = 148

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 91/137 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LIG I+   E  GL +  AK   +  + AE  Y  H+ +PFF E
Sbjct: 1   MEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  V +GE  I   R+++G T+PK+AL GTIR  YG+ +G+N IHGSDSL
Sbjct: 61  LVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F   E++
Sbjct: 121 ESAEREINIFFKNEELV 137


>gi|313681000|ref|YP_004058739.1| nucleoside diphosphate kinase [Oceanithermus profundus DSM 14977]
 gi|313153715|gb|ADR37566.1| nucleoside diphosphate kinase [Oceanithermus profundus DSM 14977]
          Length = 138

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 87/137 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF+MIKPD V+R L G I++ LED G  +VA K   ++   AE+ Y  HK++PFF  
Sbjct: 1   MERTFAMIKPDGVRRGLTGKIIQRLEDKGFKIVALKKMRISFDLAEEHYGEHKEKPFFKP 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPV   VL+G   I++ R++MG T+P  AL GTIR  +  +I EN IHGS + 
Sbjct: 61  LVEFITSGPVVAMVLEGPGVIAELRKMMGATNPADALPGTIRGDFATTIDENVIHGSANE 120

Query: 123 KTALEEISYWFARNEII 139
             A  EI+ +F   E +
Sbjct: 121 ADAEREIALFFRPEEFV 137


>gi|116782330|gb|ABK22467.1| unknown [Picea sitchensis]
 gi|116791968|gb|ABK26181.1| unknown [Picea sitchensis]
 gi|148906233|gb|ABR16272.1| unknown [Picea sitchensis]
 gi|224286555|gb|ACN40983.1| unknown [Picea sitchensis]
 gi|224286768|gb|ACN41087.1| unknown [Picea sitchensis]
          Length = 148

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 80/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R L+G I+   E  G  +   +   + R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQRGLVGEIISRFEKKGFILKGLRMVGVERSFAEKHYEDLSSKPFFTG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G+  ++  R+++G T+P  +  GTIR  + + IG N IHGSD++
Sbjct: 61  LVEYIISGPVVAMVWEGKGVVATGRKIIGATNPAASEPGTIRGDFAVEIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A +EI+ WF  
Sbjct: 121 ESAKKEIALWFPD 133


>gi|154148137|ref|YP_001407023.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(nucleoside-2-P
           kinase) [Campylobacter hominis ATCC BAA-381]
 gi|166232961|sp|A7I3D2|NDK_CAMHC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|153804146|gb|ABS51153.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Campylobacter hominis ATCC BAA-381]
          Length = 137

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 95/137 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T S+IKPDAV++ +IG I+   E  GL + AAK   +++  A  FY IHK+R FF +
Sbjct: 1   MQQTLSIIKPDAVEKGVIGKIIDRFESAGLRIAAAKKIKLSKCDASQFYAIHKERSFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M SGPV + VL+GE A++KNRE+MG TDPKKA  GTIR  +  SI  N++HGSDS 
Sbjct: 61  LVDYMTSGPVVVMVLEGENAVAKNRELMGATDPKKAAPGTIRADFAESIDANAVHGSDSE 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++FA  EI 
Sbjct: 121 ENAKNEIAFFFAGREIC 137


>gi|319943744|ref|ZP_08018025.1| nucleoside diphosphate kinase [Lautropia mirabilis ATCC 51599]
 gi|319742977|gb|EFV95383.1| nucleoside diphosphate kinase [Lautropia mirabilis ATCC 51599]
          Length = 164

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I+   E  GL +VAA+   +++ +AE FY +HK+RPFF
Sbjct: 24  MAVERTLSIIKPDAVAKNVIGQILARFESAGLKIVAARMMQLSKAEAEAFYAVHKERPFF 83

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPV +QVL+GE AI +NRE+MG TDPKKA KG+IR  +  SI  N++HGSD
Sbjct: 84  KDLVAFMVSGPVMVQVLEGENAILRNRELMGATDPKKAEKGSIRADFADSIDANAVHGSD 143

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA  EI+++F   +I 
Sbjct: 144 APETAANEIAFFFPSMQIC 162


>gi|226088577|dbj|BAH37033.1| nucleoside diphosphate kinase 3 [Pisum sativum]
          Length = 233

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K     ++ A+  Y   K+RPFF  
Sbjct: 83  LERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNG 142

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I+  R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 143 LCDFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGP 202

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI  WF   E++
Sbjct: 203 ETAKDEIKLWFKPEELV 219


>gi|190574018|ref|YP_001971863.1| nucleoside diphosphate kinase [Stenotrophomonas maltophilia K279a]
 gi|194365434|ref|YP_002028044.1| nucleoside diphosphate kinase [Stenotrophomonas maltophilia R551-3]
 gi|226729864|sp|B4SSW2|NDK_STRM5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729865|sp|B2FNQ5|NDK_STRMK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|190011940|emb|CAQ45561.1| putative nucleoside diphosphate kinase [Stenotrophomonas
           maltophilia K279a]
 gi|194348238|gb|ACF51361.1| Nucleoside-diphosphate kinase [Stenotrophomonas maltophilia R551-3]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYARFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +Q L+GE A+  +R+++G T+PK+A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVMIQALEGENAVLAHRDLLGATNPKEAAPGTIRADFAESIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  EI+Y+FA  E++
Sbjct: 121 SVENAAIEIAYFFAATEVV 139


>gi|309973627|gb|ADO96828.1| Nucleoside diphosphate kinase [Haemophilus influenzae R2846]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M+ E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF
Sbjct: 1   MMTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR ++ +S  ENS+HGSD
Sbjct: 61  APLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAAEGTIRKEFALSQRENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A  EI+Y+F   EI
Sbjct: 121 SIENANREIAYFFTDCEI 138


>gi|41053595|ref|NP_571002.1| nucleoside diphosphate kinase B [Danio rerio]
 gi|33416869|gb|AAH55548.1| Nucleoside diphosphate kinase-Z2 [Danio rerio]
          Length = 153

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 59/141 (41%), Positives = 83/141 (58%), Gaps = 2/141 (1%)

Query: 1   MV--IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRP 58
           M    E+TF  +KPD V+R L+G I+K  E  G  +VAAKF   +   A+  Y+  KD+P
Sbjct: 1   MAGKTERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQP 60

Query: 59  FFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHG 118
           F+  LV+   SGP+   V +G   I   R ++G+TDP  +  GTIR  + I +G N IHG
Sbjct: 61  FYAGLVKYTSSGPLLAMVWEGLNVIKTGRVMLGETDPFASKPGTIRGDFCIEVGRNLIHG 120

Query: 119 SDSLKTALEEISYWFARNEII 139
           SDS K+A  E+S WF   E++
Sbjct: 121 SDSEKSAATEVSLWFKPEELV 141


>gi|226939611|ref|YP_002794684.1| nucleoside diphosphate kinase [Laribacter hongkongensis HLHK9]
 gi|254767236|sp|C1DD40|NDK_LARHH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226714537|gb|ACO73675.1| Ndk [Laribacter hongkongensis HLHK9]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N+IG I    E  GL +VAAK   ++R++AE FY +HK+RPFF
Sbjct: 1   MAIERTLSIVKPDAVAKNVIGKIYDRFESNGLKIVAAKMKHLSRREAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE A+ KNRE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVEFMISGPVMVQVLEGENAVLKNRELMGATDPKKADAGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+Y+F+  E+ 
Sbjct: 121 SLENAAIEIAYFFSATEVC 139


>gi|325130329|gb|EGC53095.1| nucleoside-diphosphate kinase [Neisseria meningitidis OX99.30304]
 gi|325201982|gb|ADY97436.1| nucleoside-diphosphate kinase [Neisseria meningitidis M01-240149]
 gi|325208267|gb|ADZ03719.1| nucleoside diphosphate kinase [Neisseria meningitidis NZ-05/33]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  K+A++FY +HKDRPF+
Sbjct: 1   MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M  GPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPSEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + + A  EI+Y+F++ EI 
Sbjct: 121 TPENAALEIAYFFSQTEIC 139


>gi|226088579|dbj|BAH37034.1| nucleoside diphosphate kinase 3 [Pisum sativum]
          Length = 233

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K     ++ A+  Y   K+RPFF  
Sbjct: 83  LERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNG 142

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I+  R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 143 LCDFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGP 202

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI  WF   E++
Sbjct: 203 ETAKDEIKLWFKPEELV 219


>gi|170767434|ref|ZP_02901887.1| nucleoside diphosphate kinase [Escherichia albertii TW07627]
 gi|170123768|gb|EDS92699.1| nucleoside diphosphate kinase [Escherichia albertii TW07627]
          Length = 143

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGNIFSRFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 121 SVESAAREIAYFFGEGEVC 139


>gi|67460643|sp|Q5ZV92|NDK_LEGPH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E T S+IKPDAV +++IG I    E  GL +VAAK   ++R+QAE FY IH+ RPFF
Sbjct: 1   MAKELTLSIIKPDAVAKSVIGEIYTRFEKAGLDIVAAKMTQLSREQAESFYDIHRARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVLKGE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVMIQVLKGENAVAKNREIMGATNPKEAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+++F ++E+ 
Sbjct: 121 SLENAAREIAFFFEQHELC 139


>gi|268593187|ref|ZP_06127408.1| nucleoside diphosphate kinase [Providencia rettgeri DSM 1131]
 gi|291311233|gb|EFE51686.1| nucleoside diphosphate kinase [Providencia rettgeri DSM 1131]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKP+AVK+N+IG+I    E  G  ++AAK   + R+QAE FY  HK RPFF
Sbjct: 1   MTVQRTFSIIKPNAVKKNVIGAIYNRFESAGFTIIAAKMMHLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ LQVL+GE AI ++R++MG T+P  AL GT+R  Y  S  EN+ HGSD
Sbjct: 61  EGLVEFMTSGPIMLQVLEGENAIQRHRDLMGATNPDNALAGTLRADYADSFTENATHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SEESAAREIAYFFTADEIC 139


>gi|8569508|pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4
 gi|8569509|pdb|1EHW|B Chain B, Human Nucleoside Diphosphate Kinase 4
          Length = 162

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 25  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPAL 84

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS++
Sbjct: 85  IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVE 144

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 145 GAQREIQLWFQSSELV 160


>gi|317403335|gb|EFV83848.1| nucleoside diphosphate kinase [Achromobacter xylosoxidans C54]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 101/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV +N+IG IV   E  GL V+AA+   ++R  AE FY +HK+RPFF
Sbjct: 1   MSVQRTLSIIKPDAVAKNVIGQIVARFEQAGLKVIAARLAQLSRADAERFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPVF+QVL+GE+AI KNR++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVFVQVLEGEDAIQKNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  E++++F    I
Sbjct: 121 APETAAVEVAFFFPEINI 138


>gi|33866888|ref|NP_898447.1| nucleoside diphosphate kinase [Synechococcus sp. WH 8102]
 gi|38372264|sp|Q7U3S1|NDK_SYNPX RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|33639489|emb|CAE08873.1| Nucleoside diphosphate kinase [Synechococcus sp. WH 8102]
          Length = 151

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R  AE  Y +HK+RPFF
Sbjct: 1   MA-ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEQHYGVHKERPFF 59

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 60  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 119

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF   E+
Sbjct: 120 APETAEFEIGLWFDAAEL 137


>gi|302785506|ref|XP_002974524.1| hypothetical protein SELMODRAFT_228272 [Selaginella moellendorffii]
 gi|300157419|gb|EFJ24044.1| hypothetical protein SELMODRAFT_228272 [Selaginella moellendorffii]
          Length = 234

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 76/137 (55%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           IE+TF  IKPD V+R LI  I+   E  G  +VA K     ++ A   Y   K+RPFF  
Sbjct: 85  IERTFIAIKPDGVQRGLISEIISRFERKGYKLVAIKILTPTKEFAMLHYDDLKERPFFNG 144

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +G+  +   R+++G T P  +  GTIR    IS+G N IHGSD  
Sbjct: 145 LCDFLSSGPVVAMVWEGQGVVKYGRKLIGATSPHNSEPGTIRGDLAISVGRNIIHGSDGP 204

Query: 123 KTALEEISYWFARNEII 139
           +TA  EI+ WF   E++
Sbjct: 205 ETAKNEINLWFKPEELV 221


>gi|212634538|ref|YP_002311063.1| nucleoside diphosphate kinase [Shewanella piezotolerans WP3]
 gi|226729860|sp|B8CMX4|NDK_SHEPW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|212556022|gb|ACJ28476.1| Nucleoside diphosphate kinase [Shewanella piezotolerans WP3]
          Length = 143

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIIASKMVHLSQEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +Q L+GE A+  +RE++G T+P +A +GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQTLEGENAVLAHREILGATNPAEAAEGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  E++Y+F+  E+ 
Sbjct: 121 SVASAEREVAYFFSTEELC 139


>gi|209521130|ref|ZP_03269858.1| Nucleoside-diphosphate kinase [Burkholderia sp. H160]
 gi|209498440|gb|EDZ98567.1| Nucleoside-diphosphate kinase [Burkholderia sp. H160]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 96/134 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYTRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +Q L+GE AI K+R++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVEFMISGPVVVQALEGENAILKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
             +TA  EI+++F 
Sbjct: 121 GPETAAVEIAFFFP 134


>gi|12832570|dbj|BAB22162.1| unnamed protein product [Mus musculus]
          Length = 167

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 85/136 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y+  +++PF+  L
Sbjct: 20  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRL 79

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +  +R ++G TDP  A+ GTIR  + + +G+N IHGSDS++
Sbjct: 80  VKYMSSGPVVAMVWQGLDVVHASRALIGATDPGDAMPGTIRGDFCMEVGKNEIHGSDSVE 139

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 140 SAHREIALWFREAELL 155


>gi|224826445|ref|ZP_03699547.1| Nucleoside-diphosphate kinase [Lutiella nitroferrum 2002]
 gi|224601546|gb|EEG07727.1| Nucleoside-diphosphate kinase [Lutiella nitroferrum 2002]
          Length = 141

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL VVAAK   ++R +AE FY +HK+RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGKIYDRFESAGLKVVAAKMKQLSRAEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE A+ KNRE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVSFMISGPVMIQALEGENAVLKNRELMGATDPKKADAGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA +E+ 
Sbjct: 121 SVENAAIEVAYFFAASEVC 139


>gi|157961324|ref|YP_001501358.1| nucleoside diphosphate kinase [Shewanella pealeana ATCC 700345]
 gi|189029056|sp|A8H2N6|NDK_SHEPA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|157846324|gb|ABV86823.1| Nucleoside-diphosphate kinase [Shewanella pealeana ATCC 700345]
          Length = 143

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNHIGAIYNRFETAGLKIIASKMIHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +Q L+GE A+  +RE++G T+P +A +GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQTLEGENAVLAHREILGATNPAEAAEGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  E++Y+F+  E+ 
Sbjct: 121 SVASAEREVAYFFSAEELC 139


>gi|1389640|dbj|BAA12982.1| PNDKN1 [Pisum sativum]
          Length = 149

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 54/134 (40%), Positives = 81/134 (60%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF MIKPD V+R L+G I+   E  G  +   KF  + R  AE  Y     +PFF 
Sbjct: 1   MAEQTFIMIKPDGVQRGLVGEIISRFEKKGFYLKGLKFVNVERAFAEKHYADLSAKPFFS 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  +ISGPV   + +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD+
Sbjct: 61  GLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDA 120

Query: 122 LKTALEEISYWFAR 135
           +++A +EI+ WF  
Sbjct: 121 VESANKEIALWFPE 134


>gi|227828170|ref|YP_002829950.1| nucleoside diphosphate kinase [Sulfolobus islandicus M.14.25]
 gi|227830877|ref|YP_002832657.1| nucleoside diphosphate kinase [Sulfolobus islandicus L.S.2.15]
 gi|229579763|ref|YP_002838162.1| nucleoside diphosphate kinase [Sulfolobus islandicus Y.G.57.14]
 gi|229581568|ref|YP_002839967.1| nucleoside diphosphate kinase [Sulfolobus islandicus Y.N.15.51]
 gi|229585399|ref|YP_002843901.1| nucleoside diphosphate kinase [Sulfolobus islandicus M.16.27]
 gi|238620360|ref|YP_002915186.1| nucleoside diphosphate kinase [Sulfolobus islandicus M.16.4]
 gi|284998384|ref|YP_003420152.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus L.D.8.5]
 gi|259511714|sp|C3MZM4|NDK_SULIA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|259511715|sp|C4KIV4|NDK_SULIK RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|259511716|sp|C3MRJ9|NDK_SULIL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|259511717|sp|C3MY95|NDK_SULIM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|259511718|sp|C3NFS7|NDK_SULIN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|259511719|sp|C3N7P6|NDK_SULIY RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|227457325|gb|ACP36012.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus L.S.2.15]
 gi|227459966|gb|ACP38652.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus M.14.25]
 gi|228010478|gb|ACP46240.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus Y.G.57.14]
 gi|228012284|gb|ACP48045.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus Y.N.15.51]
 gi|228020449|gb|ACP55856.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus M.16.27]
 gi|238381430|gb|ACR42518.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus M.16.4]
 gi|284446280|gb|ADB87782.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus L.D.8.5]
 gi|323475223|gb|ADX85829.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus REY15A]
 gi|323477955|gb|ADX83193.1| Nucleoside-diphosphate kinase [Sulfolobus islandicus HVE10/4]
          Length = 138

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/138 (45%), Positives = 90/138 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           MV+++TF MIKPD VKR LIG I+   E  GL +V+ K   M+R  AE  Y  HK + FF
Sbjct: 1   MVMQRTFVMIKPDGVKRGLIGEIISRFEKRGLKIVSLKMVKMSRDIAEKLYDEHKGKSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  + SGPV   V++G++ +   R ++G+TDPK+A  GTIR  Y +S  EN IH SD
Sbjct: 61  EELVNYVTSGPVVCMVIEGDDVVQVIRRMIGNTDPKEAPPGTIRGDYALSKSENVIHASD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A  E+S +F ++++
Sbjct: 121 SIEKAQREMSLFFDKSDL 138


>gi|51892832|ref|YP_075523.1| nucleoside diphosphate kinase [Symbiobacterium thermophilum IAM
           14863]
 gi|67460658|sp|Q67NR4|NDK_SYMTH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|51856521|dbj|BAD40679.1| nucleoside diphosphate kinase [Symbiobacterium thermophilum IAM
           14863]
          Length = 150

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/135 (44%), Positives = 84/135 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E++F M+KPD V+R LIG ++  LE  GL +VAAK   ++R+ AE+ Y   KD+PFFP 
Sbjct: 1   MERSFVMVKPDGVQRGLIGEVISRLERRGLKLVAAKLMRVSRELAEEHYAQLKDKPFFPS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L++ + SGPV   V +G  AIS  R+ MG T+P  A  GTIR  +   +  N +HGSD  
Sbjct: 61  LIEFITSGPVMAMVWEGPNAISIIRKTMGATNPANAEPGTIRADFACDVSYNVVHGSDGP 120

Query: 123 KTALEEISYWFARNE 137
           ++A  EI  WF   E
Sbjct: 121 ESAEREIRLWFGEVE 135


>gi|222110299|ref|YP_002552563.1| nucleoside diphosphate kinase [Acidovorax ebreus TPSY]
 gi|254767230|sp|B9MFX2|NDK_DIAST RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|221729743|gb|ACM32563.1| Nucleoside-diphosphate kinase [Acidovorax ebreus TPSY]
          Length = 141

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 98/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL +VAA+   ++R +AE FY +HK+RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYARFEAAGLKIVAARMIHLSRAEAEQFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE A+ KNRE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVMVQALEGENAVLKNRELMGATDPKKAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  E++++F    I
Sbjct: 121 AAETAQVEVAFFFPGLNI 138


>gi|47219604|emb|CAG02649.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 168

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 55/135 (40%), Positives = 81/135 (60%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K     +      Y     RPFF EL
Sbjct: 22  ERTFIALKPDGVQRKLVGEIVRRFEKKGFKLVALKLVQAPQDLLRKHYSDLSRRPFFGEL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G++ +   R+++G+T+P  +L GTIR    + +G N IHGSDS++
Sbjct: 82  VRYMSSGPVVAMVWQGQDVVKTARKMLGETNPADSLPGTIRGDSCVDVGRNVIHGSDSVE 141

Query: 124 TALEEISYWFARNEI 138
           +A +EI  WF  +E+
Sbjct: 142 SAQKEIYLWFRPHEL 156


>gi|62870979|gb|AAY18431.1| putative nucleoside diphosphate kinase III [Noccaea caerulescens]
          Length = 238

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 78/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +V  K    ++  A+  Y   K+R FF  
Sbjct: 88  MERTFIAIKPDGVQRGLISEIVSRFERKGFKLVGIKVVVPSKDFAQKHYHDLKERTFFNG 147

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 148 LCDFLSSGPVIAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 207

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 208 ETAKDEINLWFKPQELV 224


>gi|297538106|ref|YP_003673875.1| Nucleoside-diphosphate kinase [Methylotenera sp. 301]
 gi|297257453|gb|ADI29298.1| Nucleoside-diphosphate kinase [Methylotenera sp. 301]
          Length = 135

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 95/135 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV +N+IG I+   E+ GL +V AK   + + +AE FY +H  RPFF
Sbjct: 1   MAVQRTLSIIKPDAVAKNVIGKILTRFENAGLKIVEAKMAQLTKAEAEGFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +Q L+GE A+  NR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  ADLVKFMISGPVMIQALEGENAVQVNRDLMGATNPKEAAAGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S + A  EI+Y+F +
Sbjct: 121 SAENAAIEIAYFFGK 135


>gi|281203564|gb|EFA77761.1| nucleoside diphosphate kinase [Polysphondylium pallidum PN500]
          Length = 222

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 53/134 (39%), Positives = 73/134 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD   R LIG I+   E  G  +VA K     ++QAE  Y     +PFF  L
Sbjct: 76  ERTFIAIKPDGTARGLIGEIIHRFERKGYKLVAIKILHPTKEQAEAHYADLSSKPFFNGL 135

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+   SG +   V +G+  I   R ++G TDP ++L G+IR    + +G N +HGSD  +
Sbjct: 136 VKFFSSGAIVAMVWEGKGVIKGGRSLVGATDPAQSLPGSIRGDLCVEVGRNIVHGSDGPE 195

Query: 124 TALEEISYWFARNE 137
           +A  EI  WF  NE
Sbjct: 196 SAQHEIKLWFKENE 209


>gi|88703675|ref|ZP_01101391.1| nucleoside diphosphate kinase [Congregibacter litoralis KT71]
 gi|88702389|gb|EAQ99492.1| nucleoside diphosphate kinase [Congregibacter litoralis KT71]
          Length = 142

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N IG I    E  GL VVA+K   ++   A  FY  HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNHIGEIYARFEAAGLRVVASKMMRLSDVVAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ M SGPV +QVL+GE A++ NRE+MG T+P++A  GTIR  +  SI  N++HGSD
Sbjct: 61  PALIEFMTSGPVVVQVLEGENAVATNRELMGATNPQEAEAGTIRADFASSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+FA ++I 
Sbjct: 121 STTSAAREIAYFFASSDIC 139


>gi|282891515|ref|ZP_06300007.1| nucleoside-diphosphate kinase [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498606|gb|EFB40933.1| nucleoside-diphosphate kinase [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 143

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV  N IG I+   E  G+ +VAAK   +++  AE FY +HK+RPFF
Sbjct: 1   MATERTLSIIKPDAVGNNHIGDIIARFEKAGIRIVAAKMKHLSQADAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M +GPV + VL+G+ AI KNRE+MG TDP KA  GTIR  +  +I EN++HGSD
Sbjct: 61  RDLVSFMTTGPVLIMVLEGDNAILKNREIMGATDPSKAAPGTIRADFAKTIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
             +TA +EI+Y+F   E+ 
Sbjct: 121 GSETAAQEIAYFFKPEEVC 139


>gi|241667348|ref|ZP_04754926.1| nucleoside-diphosphate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875899|ref|ZP_05248609.1| nucleoside diphosphate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841920|gb|EET20334.1| nucleoside diphosphate kinase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 140

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 105/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  ++T S+IKPDAV++N+IG I +  E  GL VVAAK   +++ +AE FY +HKDRPFF
Sbjct: 1   MNKQRTLSIIKPDAVEKNIIGEIYRRFEKSGLKVVAAKMKHLSKAEAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +QVL+G+ AI+KNRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  SALVEFMISGPVMIQVLEGDNAIAKNRELMGATNPKEAEAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI Y+F+  EI+G
Sbjct: 121 APETAAQEIKYFFSDIEIVG 140


>gi|258543031|ref|YP_003188464.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634109|dbj|BAI00085.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637169|dbj|BAI03138.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640221|dbj|BAI06183.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643278|dbj|BAI09233.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646333|dbj|BAI12281.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649386|dbj|BAI15327.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652372|dbj|BAI18306.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655430|dbj|BAI21357.1| nucleoside diphosphate kinase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 160

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA +RNL G I    ED GL +VA K   ++  QA  FY +HK+RPF+
Sbjct: 21  MAKERTLSIIKPDATRRNLTGKINAVFEDAGLRIVAQKRIQLSPAQAGAFYEVHKERPFY 80

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+G+ A++KNREVMG TDPKKA   TIR ++  SI  NS+HGSD
Sbjct: 81  NDLVSFMISGPVVVQVLEGDNAVAKNREVMGATDPKKAEPNTIRAQFAESIEANSVHGSD 140

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  EI ++FA  EI+
Sbjct: 141 SAENAANEIRFFFAETEIL 159


>gi|332754205|gb|EGJ84573.1| nucleoside diphosphate kinase [Shigella flexneri 4343-70]
 gi|333001895|gb|EGK21461.1| nucleoside diphosphate kinase [Shigella flexneri K-218]
          Length = 143

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 121 SVESAAREIAYFFGEGEVC 139


>gi|319408326|emb|CBI81979.1| Nucleoside diphosphate kinase [Bartonella schoenbuchensis R1]
          Length = 140

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 86/140 (61%), Positives = 111/140 (79%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFSMIKPDA +RNL G+I K LED GL V+A+K  WM++ +AE FY +HK+RPFF
Sbjct: 1   MAVERTFSMIKPDATRRNLTGAITKMLEDAGLRVIASKRVWMSQHEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELVQ M SGP  +QVL+GE+AI+KNRE+MG T+P  A +GTIR  Y +SIGENS+HGSD
Sbjct: 61  GELVQFMSSGPTVVQVLEGEDAIAKNREIMGATNPADAQEGTIRKAYALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S ++A  EI+YWF+  EI+G
Sbjct: 121 SAESAKTEIAYWFSDIEIVG 140


>gi|254469030|ref|ZP_05082436.1| nucleoside diphosphate kinase [beta proteobacterium KB13]
 gi|207087840|gb|EDZ65123.1| nucleoside diphosphate kinase [beta proteobacterium KB13]
          Length = 134

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/134 (50%), Positives = 95/134 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDAV +N+IG I    E+ GL +V AK   +++++AE FY +HK+RPFF
Sbjct: 1   MATEQTLSIIKPDAVAKNVIGKIYTRFEENGLKIVQAKMAHLSKEEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +Q L+G+ A+ KNRE+MG T+P++A  GTIR  +  SI  N++HGSD
Sbjct: 61  NDLVTFMTSGPVMIQALEGDNAVLKNRELMGATNPQEAAPGTIRADFAASIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           SL+ A  EI Y+F 
Sbjct: 121 SLENAKIEIEYFFG 134


>gi|254570088|ref|XP_002492154.1| Nucleoside diphosphate kinase [Pichia pastoris GS115]
 gi|238031951|emb|CAY69874.1| Nucleoside diphosphate kinase [Pichia pastoris GS115]
 gi|328351359|emb|CCA37758.1| nucleoside-diphosphate kinase [Pichia pastoris CBS 7435]
          Length = 152

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+  I+    + G  +VA K    N     + Y     +PFFP L
Sbjct: 5   ERTFIAVKPDGVQRGLVPEILSRFWNKGYKLVAIKLTLANEDLLREHYADLTSKPFFPSL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M+SGPV   V +G++ + + R ++G T+P  +  GTIR  + + +G N IHGSDS++
Sbjct: 65  LSYMLSGPVLATVWEGKDVVKQGRALLGATNPLASAPGTIRGDFAVDMGRNIIHGSDSVE 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF + E++
Sbjct: 125 SAEKEIGLWFKKEELV 140


>gi|126725334|ref|ZP_01741176.1| Nucleoside-diphosphate kinase [Rhodobacterales bacterium HTCC2150]
 gi|126704538|gb|EBA03629.1| Nucleoside-diphosphate kinase [Rhodobacterales bacterium HTCC2150]
          Length = 140

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 107/140 (76%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDA KRNL G+I  + E  GL +VA+K   +   QA+ FY +H +RPFF
Sbjct: 1   MALQRTFSIIKPDATKRNLTGAIAAKFEAAGLRIVASKRIQLTLAQAQQFYGVHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + MIS P+ +QVL+GE+AI+KNREVMG T+P  A +GTIR +Y +SIGENS+HGSD
Sbjct: 61  GELCEFMISEPIVVQVLEGEDAIAKNREVMGATNPADADEGTIRKEYALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|300113466|ref|YP_003760041.1| nucleoside-diphosphate kinase [Nitrosococcus watsonii C-113]
 gi|299539403|gb|ADJ27720.1| Nucleoside-diphosphate kinase [Nitrosococcus watsonii C-113]
          Length = 144

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL +VAA+   ++++QA+ FY +HK+RPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNIIGEIYTRFEKAGLRIVAARMFHLSKEQAQGFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE AI+KNRE+MG T+PK+A  GTIR  +  +I  N++HGSD
Sbjct: 61  NDLVGFMTSGPVMVQVLEGENAIAKNREIMGATNPKEADPGTIRADFAENIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
              TA +EI+++F   EI 
Sbjct: 121 GSGTAEQEINFFFKPEEIC 139


>gi|290476005|ref|YP_003468901.1| nucleoside diphosphate kinase [Xenorhabdus bovienii SS-2004]
 gi|289175334|emb|CBJ82137.1| nucleoside diphosphate kinase [Xenorhabdus bovienii SS-2004]
          Length = 142

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 101/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AVK++ IGSI    E  G  ++AAK  ++ R+QAE FY  HK RPFF
Sbjct: 1   MTIERTFSIIKPNAVKKDAIGSIYARFESAGFKIIAAKMLYLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  Y  S  EN++HGSD
Sbjct: 61  DGLVEFMTSGPIVVQVLEGENAVQRHRDLMGATNPDNALAGTLRADYADSFTENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI+Y+F+ +EI
Sbjct: 121 SIESANREIAYFFSDDEI 138


>gi|293332239|ref|NP_001167891.1| hypothetical protein LOC100381602 [Zea mays]
 gi|223944687|gb|ACN26427.1| unknown [Zea mays]
          Length = 149

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 57/133 (42%), Positives = 80/133 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+R LIG I+   E  G  +   KF  + R  A+  Y    D+PFFP 
Sbjct: 1   MEQTFIMIKPDGVQRGLIGDIISRFEKKGFYLKGMKFMNVERSFAQQHYADLSDKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ +ISGPV   V +G++ +   R ++G T P +A  GTIR  Y + +G N IHGSDS+
Sbjct: 61  LVEYIISGPVVAMVWEGKDVVLTGRRIIGATRPWEAAPGTIRGDYAVEVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFAR 135
           +   +EI+ WF  
Sbjct: 121 ENGKKEIALWFPE 133


>gi|73662586|ref|YP_301367.1| nucleoside diphosphate kinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|92090400|sp|Q49XS3|NDK_STAS1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|72495101|dbj|BAE18422.1| nucleoside diphosphate kinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 149

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 93/136 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPDAV+RNLIG I+  +E  GL +V  KF  + +  AE+ Y  H D+PF+  
Sbjct: 1   MERTFLMIKPDAVQRNLIGEIISRIERKGLKLVGGKFMTVPQSLAEEHYAEHTDKPFYKH 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE+A+   R ++G T+P +A  GTIR   G+++G N IHGSDS+
Sbjct: 61  LISFITSAPVFAMVVEGEDAVHVARHIIGKTNPSEATPGTIRGDLGLTVGRNIIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A +EI+ WF  +E+
Sbjct: 121 ESANKEINLWFKADEL 136


>gi|258406284|ref|YP_003199026.1| Nucleoside-diphosphate kinase [Desulfohalobium retbaense DSM 5692]
 gi|257798511|gb|ACV69448.1| Nucleoside-diphosphate kinase [Desulfohalobium retbaense DSM 5692]
          Length = 139

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 100/139 (71%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + ++T S+IKPDAV+R L G+I+  ++D GL +VA K   ++  +AE FY +HKD+PFF 
Sbjct: 1   MTQQTLSIIKPDAVERGLTGTILARIQDAGLRLVALKMLHLDTTEAEAFYAVHKDKPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L   M SGP+ + VL+GE AIS+ R++MG T+P+KA +GT+R  + + +  NS+HGSD+
Sbjct: 61  SLTSYMSSGPIVVAVLEGENAISRYRDLMGATNPEKAAEGTLRKTFAVDLERNSVHGSDA 120

Query: 122 LKTALEEISYWFARNEIIG 140
            +TA  EI+Y+F + E++G
Sbjct: 121 PETAATEIAYFFNQLELVG 139


>gi|213510934|ref|NP_001133149.1| non-metastatic cells 1 protein [Salmo salar]
 gi|197632153|gb|ACH70800.1| non-metastatic cells 1 protein [Salmo salar]
          Length = 152

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 77/136 (56%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +VA K    +    +  Y+  KD PF+  L
Sbjct: 5   ERTFIAIKPDGVQRGLVGEIIKRFEQRGFRLVAMKMVQASEDLVKQHYIDLKDMPFYGGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
              M SGPV   + +G   +   R ++G+T+P  +  G+IR    I++G N IHGSDSL 
Sbjct: 65  CSFMHSGPVVAMIWEGLNIVKNGRLMLGETNPADSKPGSIRGDLCITLGRNIIHGSDSLD 124

Query: 124 TALEEISYWFARNEII 139
           +A +EI  WF   E++
Sbjct: 125 SAKKEIGLWFKPEEMV 140


>gi|164521906|gb|ABY60741.1| hypothetical protein [Trichinella spiralis]
          Length = 153

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 74/140 (52%), Gaps = 1/140 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M   E+TF  +KPD V+R L+  +++  E  G  ++  K    N       Y  H  + F
Sbjct: 1   MSTPERTFLAVKPDGVQRGLVNEVLRRFEQRGYKLIGLKMLIANDDLLNKHYAEHVGKGF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           FP L   M SGPV   V +G + +   R ++G T P ++  GT+R  + I +G N +HGS
Sbjct: 61  FPSLKAYMSSGPVVAMVWEGRDVVKAARNMLGATRPLESAPGTLRGDFCIDVGRNLVHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+++A  EI+ WF   E+ 
Sbjct: 121 DSIESAKREIALWFKPEELC 140


>gi|33593206|ref|NP_880850.1| nucleoside diphosphate kinase [Bordetella pertussis Tohama I]
 gi|33597414|ref|NP_885057.1| nucleoside diphosphate kinase [Bordetella parapertussis 12822]
 gi|33602155|ref|NP_889715.1| nucleoside diphosphate kinase [Bordetella bronchiseptica RB50]
 gi|67460707|sp|Q7VWK7|NDK_BORPE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67460708|sp|Q7W6P4|NDK_BORPA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67460709|sp|Q7WHM7|NDK_BORBR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|33563581|emb|CAE42480.1| nucleoside diphosphate kinase [Bordetella pertussis Tohama I]
 gi|33573841|emb|CAE38150.1| nucleoside diphosphate kinase [Bordetella parapertussis]
 gi|33576593|emb|CAE33671.1| nucleoside diphosphate kinase [Bordetella bronchiseptica RB50]
 gi|332382617|gb|AEE67464.1| nucleoside diphosphate kinase [Bordetella pertussis CS]
          Length = 141

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/138 (53%), Positives = 100/138 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N++G IV   E  GL V+AA+   ++R  AE FY +HK+RPFF
Sbjct: 1   MSIERTLSIIKPDAVAKNVVGQIVARFEQAGLKVIAARMQQLSRTDAERFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPVF+QVL+GE AI KNR++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVFVQVLEGESAIQKNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  E++++F    I
Sbjct: 121 APETAAVEVAFFFPEINI 138


>gi|121533825|ref|ZP_01665652.1| Nucleoside-diphosphate kinase [Thermosinus carboxydivorans Nor1]
 gi|121307816|gb|EAX48731.1| Nucleoside-diphosphate kinase [Thermosinus carboxydivorans Nor1]
          Length = 138

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 84/137 (61%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT  +IKPD V R L G I+   E  GL ++A K   ++R+QA + Y  H+ +PFF  
Sbjct: 1   MEKTLVLIKPDGVARGLCGEIISRFERRGLRILALKMMTLSREQAYNHYAEHQGKPFFDG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGP+   V+ GE AI   R +MG TDP  A  GTIR  + +S+  N IHGSDS 
Sbjct: 61  LIDFITSGPLVAMVVGGENAIKVVRTMMGPTDPAGAAPGTIRGDFALSVDNNVIHGSDSA 120

Query: 123 KTALEEISYWFARNEII 139
            +A+ EI  +FA +EI+
Sbjct: 121 SSAMREIDLFFAAHEIM 137


>gi|94501128|ref|ZP_01307651.1| Nucleoside diphosphate kinase [Oceanobacter sp. RED65]
 gi|94426704|gb|EAT11689.1| Nucleoside diphosphate kinase [Oceanobacter sp. RED65]
          Length = 141

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S++KPDAV +N+IG I    E  GL +VAAK   M+ + A  FY  HK+RPFF
Sbjct: 1   MAVERTLSIVKPDAVGKNVIGEIYSRFEKAGLQIVAAKMIKMDEEMAGGFYAEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE A+ KNRE+MG T+P++A  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVGFMTSGPVMVQVLEGEGAVLKNRELMGATNPQEADAGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  E+SY+F   EI 
Sbjct: 121 STESAAREVSYFFNEEEIC 139


>gi|19744167|dbj|BAB86842.1| NDPK III [Brassica rapa]
          Length = 235

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 78/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 85  MERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVVVPSKDFAQKHYHDLKERPFFNG 144

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K   GTIR    + +G N IHGSD  
Sbjct: 145 LCDFLSSGPVIAMVWEGEGVIRYGRKLIGATDPQKFEPGTIRGDLAVVVGRNIIHGSDGP 204

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 205 ETAKDEINLWFKPQELV 221


>gi|261365782|ref|ZP_05978665.1| nucleoside diphosphate kinase [Neisseria mucosa ATCC 25996]
 gi|288565689|gb|EFC87249.1| nucleoside diphosphate kinase [Neisseria mucosa ATCC 25996]
          Length = 141

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N+IG I    ED GL +VAAK   ++ ++A++FY +HK+RPF+
Sbjct: 1   MAIERTISIVKPDAVGKNVIGKIYSRFEDNGLRIVAAKMKHLSVREAQEFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A++KNRE+MG T+P +A  GTIR  +  S+  N++HGSD
Sbjct: 61  DSLVAFMTSGPVMIQVLEGENAVAKNRELMGATNPAEAAPGTIRADFAESLSVNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+Y+F+++EI 
Sbjct: 121 SLENAAIEIAYFFSQSEIC 139


>gi|78214018|ref|YP_382797.1| nucleoside diphosphate kinase [Synechococcus sp. CC9605]
 gi|109892796|sp|Q3AGP0|NDK_SYNSC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|78198477|gb|ABB36242.1| Nucleoside-diphosphate kinase [Synechococcus sp. CC9605]
          Length = 151

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R  AE  Y +HK+RPFF
Sbjct: 1   MA-ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEQHYGVHKERPFF 59

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 60  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 119

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 120 AAETAQFEIGLWFQASEL 137


>gi|119372031|sp|Q0BQG5|NDK_GRABC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 140

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDA +RNL G I    E+ GL +VA K   +++ QAE FY +H++RPFF
Sbjct: 1   MAIERTFSIIKPDATRRNLTGRINAVFEENGLRIVAQKRVQLSQAQAEAFYGVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE A+++NRE+MG TDPKKA  GTIR ++  SI  NS+HGSD
Sbjct: 61  NDLVSFMISGPVVVQVLEGENAVARNRELMGATDPKKADAGTIRAQFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  EI+Y+FA +EI+
Sbjct: 121 SAENAAIEIAYFFAGSEIV 139


>gi|83945454|ref|ZP_00957801.1| nucleoside diphosphate kinase [Oceanicaulis alexandrii HTCC2633]
 gi|83851030|gb|EAP88888.1| nucleoside diphosphate kinase [Oceanicaulis alexandrii HTCC2633]
          Length = 140

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 108/140 (77%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA  RNL G+I  ++E+ GL ++A K   ++++QAE FY +HK+RPFF
Sbjct: 1   MAIQRTFSIIKPDATARNLTGAINAKIEEAGLRIIAQKRIRLSKEQAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE+AI+K R+VMG T+P+ A  GTIR ++  SI  NS+HGSD
Sbjct: 61  GDLVSFMISGPVVVQVLEGEDAIAKYRDVMGATNPENAEPGTIRKEFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI ++F+ +EI+G
Sbjct: 121 APETAAQEIPFFFSEDEIVG 140


>gi|224436812|ref|ZP_03657810.1| nucleoside diphosphate kinase [Helicobacter cinaedi CCUG 18818]
 gi|313143301|ref|ZP_07805494.1| nucleoside diphosphate kinase [Helicobacter cinaedi CCUG 18818]
 gi|313128332|gb|EFR45949.1| nucleoside diphosphate kinase [Helicobacter cinaedi CCUG 18818]
          Length = 137

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 95/137 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAVK+ +IG I+   E   L + A K   + +  A+ FY IHKDRPFF +
Sbjct: 1   MEQTLSIIKPDAVKKGVIGKIIDRFESNNLRIAAIKKLQLTQCDAQSFYAIHKDRPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  MISGPV + VL+G+ A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDFMISGPVVVMVLEGQNAVAKNRELMGATNPKEAAAGTIRADFADSIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++F   EI 
Sbjct: 121 ENAKNEIAFFFGTREIC 137


>gi|170694775|ref|ZP_02885926.1| Nucleoside-diphosphate kinase [Burkholderia graminis C4D1M]
 gi|170140406|gb|EDT08583.1| Nucleoside-diphosphate kinase [Burkholderia graminis C4D1M]
          Length = 141

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 98/134 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE A+ K+R++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVEFMISGPVVVQVLEGENAVLKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           + +TA  EI+++F 
Sbjct: 121 AAETAAVEIAFFFP 134


>gi|82703495|ref|YP_413061.1| nucleoside-diphosphate kinase [Nitrosospira multiformis ATCC 25196]
 gi|109892778|sp|Q2Y6F2|NDK_NITMU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|82411560|gb|ABB75669.1| nucleoside diphosphate kinase [Nitrosospira multiformis ATCC 25196]
          Length = 141

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 101/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VA++   +++  AE FY +H++RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNIIGEIYSRFERNGLKIVASRMVRLSQADAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE+AI KNR++MG TDP+KA KGTIR  +  SI  N++HGSD
Sbjct: 61  NDLVKFMISGPVMVQVLEGEDAIRKNRDLMGATDPRKAEKGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI+Y+F    I
Sbjct: 121 APETAAVEIAYFFPELNI 138


>gi|302390188|ref|YP_003826009.1| nucleoside diphosphate kinase [Thermosediminibacter oceani DSM
           16646]
 gi|302200816|gb|ADL08386.1| nucleoside diphosphate kinase [Thermosediminibacter oceani DSM
           16646]
          Length = 134

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 84/133 (63%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD VKR L+G+I++  E  GL +VAAK   ++R+ AE+ Y  H  +PFF E
Sbjct: 1   MERTFVMIKPDGVKRGLVGTILQRYEQKGLTLVAAKLLTVSRQLAEEHYREHSSKPFFRE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  VL+GE AI   R + G T  ++AL GTIR  +  S   N +H SDS 
Sbjct: 61  LVDYITSGPVFAMVLEGENAIKLVRLLNGATKVEEALPGTIRGDFATSTTHNLVHASDSP 120

Query: 123 KTALEEISYWFAR 135
           + A  EI+ WF  
Sbjct: 121 ENARREINLWFPE 133


>gi|217963919|ref|YP_002349597.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Listeria monocytogenes HCC23]
 gi|254767237|sp|B8DBZ7|NDK_LISMH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|217333189|gb|ACK38983.1| nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P
           kinase) [Listeria monocytogenes HCC23]
 gi|307571511|emb|CAR84690.1| ndk [Listeria monocytogenes L99]
 gi|313607944|gb|EFR84078.1| nucleoside diphosphate kinase [Listeria monocytogenes FSL F2-208]
          Length = 147

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R LIG IV  +E  GL +VA K   ++R+ AE  Y  H  + FF +
Sbjct: 1   MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFED 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + SGPVF  VL+G++AI+  R +MG T+P +A  GTIR  Y I    N IHGSDSL
Sbjct: 61  LIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +FA  EI+
Sbjct: 121 ESAKREIQLFFAPQEIL 137


>gi|219109896|ref|XP_002176701.1| nucleoside diphosphate kinase 1 [Phaeodactylum tricornutum CCAP
           1055/1]
 gi|217411236|gb|EEC51164.1| nucleoside diphosphate kinase 1 [Phaeodactylum tricornutum CCAP
           1055/1]
          Length = 152

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 57/138 (41%), Positives = 87/138 (63%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+T+ MIKPD ++R ++G+IV   E  G  +VA K      +  E  Y    D+PFFP
Sbjct: 3   ASERTYIMIKPDGIQRGIVGNIVNRFETKGYKLVAMKTKQATSELLETHYKDLVDKPFFP 62

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           +L + M+SGPV   V +G+EA+S  R+++G T+P ++  GTIR  + I +G N  HGSDS
Sbjct: 63  KLKEYMMSGPVVSMVWEGKEAVSTGRKMLGATNPLESAPGTIRGDFCIEVGRNICHGSDS 122

Query: 122 LKTALEEISYWFARNEII 139
           ++ A +EI+ WF  +EI+
Sbjct: 123 VENAEKEIALWFEEDEIL 140


>gi|15803041|ref|NP_289071.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 EDL933]
 gi|15832634|ref|NP_311407.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str. Sakai]
 gi|16130443|ref|NP_417013.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24113847|ref|NP_708357.1| nucleoside diphosphate kinase [Shigella flexneri 2a str. 301]
 gi|30063910|ref|NP_838081.1| nucleoside diphosphate kinase [Shigella flexneri 2a str. 2457T]
 gi|74313044|ref|YP_311463.1| nucleoside diphosphate kinase [Shigella sonnei Ss046]
 gi|82544967|ref|YP_408914.1| nucleoside diphosphate kinase [Shigella boydii Sb227]
 gi|82777903|ref|YP_404252.1| nucleoside diphosphate kinase [Shigella dysenteriae Sd197]
 gi|89109324|ref|AP_003104.1| multifunctional nucleoside diphosphate kinase, apyrimidinic
           endonuclease, and 3'-phosphodiesterase [Escherichia coli
           str. K-12 substr. W3110]
 gi|110806449|ref|YP_689969.1| nucleoside diphosphate kinase [Shigella flexneri 5 str. 8401]
 gi|157157218|ref|YP_001463840.1| nucleoside diphosphate kinase [Escherichia coli E24377A]
 gi|157161993|ref|YP_001459311.1| nucleoside diphosphate kinase [Escherichia coli HS]
 gi|170019199|ref|YP_001724153.1| nucleoside diphosphate kinase [Escherichia coli ATCC 8739]
 gi|170082128|ref|YP_001731448.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|187731779|ref|YP_001881309.1| nucleoside diphosphate kinase [Shigella boydii CDC 3083-94]
 gi|187775812|ref|ZP_02798575.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188024719|ref|ZP_02773445.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188494483|ref|ZP_03001753.1| nucleoside diphosphate kinase [Escherichia coli 53638]
 gi|189009921|ref|ZP_02803491.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189402270|ref|ZP_02781297.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189403150|ref|ZP_02793617.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189403947|ref|ZP_02786135.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189405033|ref|ZP_02812871.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str. EC869]
 gi|189405737|ref|ZP_02823896.2| nucleoside diphosphate kinase [Escherichia coli O157:H7 str. EC508]
 gi|191167682|ref|ZP_03029491.1| nucleoside diphosphate kinase [Escherichia coli B7A]
 gi|193064012|ref|ZP_03045097.1| nucleoside diphosphate kinase [Escherichia coli E22]
 gi|193068351|ref|ZP_03049314.1| nucleoside diphosphate kinase [Escherichia coli E110019]
 gi|194427281|ref|ZP_03059831.1| nucleoside diphosphate kinase [Escherichia coli B171]
 gi|194432068|ref|ZP_03064357.1| nucleoside diphosphate kinase [Shigella dysenteriae 1012]
 gi|194437712|ref|ZP_03069808.1| nucleoside diphosphate kinase [Escherichia coli 101-1]
 gi|195936660|ref|ZP_03082042.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208808047|ref|ZP_03250384.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813684|ref|ZP_03255013.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820790|ref|ZP_03261110.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209399802|ref|YP_002271988.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209919995|ref|YP_002294079.1| nucleoside diphosphate kinase [Escherichia coli SE11]
 gi|217326704|ref|ZP_03442787.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218548045|ref|YP_002381836.1| nucleoside diphosphate kinase [Escherichia fergusonii ATCC 35469]
 gi|218555043|ref|YP_002387956.1| nucleoside diphosphate kinase [Escherichia coli IAI1]
 gi|218696145|ref|YP_002403812.1| nucleoside diphosphate kinase [Escherichia coli 55989]
 gi|218706021|ref|YP_002413540.1| nucleoside diphosphate kinase [Escherichia coli UMN026]
 gi|238901683|ref|YP_002927479.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           BW2952]
 gi|253772588|ref|YP_003035419.1| nucleoside diphosphate kinase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162492|ref|YP_003045600.1| nucleoside diphosphate kinase [Escherichia coli B str. REL606]
 gi|254794464|ref|YP_003079301.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256017334|ref|ZP_05431199.1| nucleoside diphosphate kinase [Shigella sp. D9]
 gi|256021796|ref|ZP_05435661.1| nucleoside diphosphate kinase [Escherichia sp. 4_1_40B]
 gi|260845148|ref|YP_003222926.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O103:H2 str. 12009]
 gi|260856612|ref|YP_003230503.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O26:H11 str. 11368]
 gi|260869207|ref|YP_003235609.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O111:H- str. 11128]
 gi|261223050|ref|ZP_05937331.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261259399|ref|ZP_05951932.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291283739|ref|YP_003500557.1| Nucleoside diphosphate kinase [Escherichia coli O55:H7 str. CB9615]
 gi|293405959|ref|ZP_06649951.1| nucleoside diphosphate kinase [Escherichia coli FVEC1412]
 gi|293410932|ref|ZP_06654508.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293415782|ref|ZP_06658425.1| nucleoside diphosphate kinase [Escherichia coli B185]
 gi|293446871|ref|ZP_06663293.1| nucleoside-diphosphate kinase [Escherichia coli B088]
 gi|297519093|ref|ZP_06937479.1| nucleoside diphosphate kinase [Escherichia coli OP50]
 gi|298381760|ref|ZP_06991359.1| nucleoside diphosphate kinase [Escherichia coli FVEC1302]
 gi|300817712|ref|ZP_07097927.1| nucleoside diphosphate kinase [Escherichia coli MS 107-1]
 gi|300820812|ref|ZP_07100962.1| nucleoside diphosphate kinase [Escherichia coli MS 119-7]
 gi|300898378|ref|ZP_07116721.1| nucleoside diphosphate kinase [Escherichia coli MS 198-1]
 gi|300904308|ref|ZP_07122165.1| nucleoside diphosphate kinase [Escherichia coli MS 84-1]
 gi|300920673|ref|ZP_07137084.1| nucleoside diphosphate kinase [Escherichia coli MS 115-1]
 gi|300927119|ref|ZP_07142867.1| nucleoside diphosphate kinase [Escherichia coli MS 182-1]
 gi|300930158|ref|ZP_07145579.1| nucleoside diphosphate kinase [Escherichia coli MS 187-1]
 gi|300951777|ref|ZP_07165592.1| nucleoside diphosphate kinase [Escherichia coli MS 116-1]
 gi|300958852|ref|ZP_07170960.1| nucleoside diphosphate kinase [Escherichia coli MS 175-1]
 gi|301022378|ref|ZP_07186265.1| nucleoside diphosphate kinase [Escherichia coli MS 196-1]
 gi|301302875|ref|ZP_07209003.1| nucleoside diphosphate kinase [Escherichia coli MS 124-1]
 gi|301330391|ref|ZP_07223033.1| nucleoside diphosphate kinase [Escherichia coli MS 78-1]
 gi|301648273|ref|ZP_07248016.1| nucleoside diphosphate kinase [Escherichia coli MS 146-1]
 gi|307139153|ref|ZP_07498509.1| nucleoside diphosphate kinase [Escherichia coli H736]
 gi|307312487|ref|ZP_07592120.1| Nucleoside-diphosphate kinase [Escherichia coli W]
 gi|309784731|ref|ZP_07679364.1| nucleoside diphosphate kinase [Shigella dysenteriae 1617]
 gi|309794435|ref|ZP_07688858.1| nucleoside diphosphate kinase [Escherichia coli MS 145-7]
 gi|312973241|ref|ZP_07787413.1| nucleoside diphosphate kinase [Escherichia coli 1827-70]
 gi|331643138|ref|ZP_08344273.1| nucleoside diphosphate kinase [Escherichia coli H736]
 gi|331653946|ref|ZP_08354947.1| nucleoside diphosphate kinase [Escherichia coli M718]
 gi|331664081|ref|ZP_08364991.1| nucleoside diphosphate kinase [Escherichia coli TA143]
 gi|331669264|ref|ZP_08370112.1| nucleoside diphosphate kinase [Escherichia coli TA271]
 gi|331673973|ref|ZP_08374736.1| nucleoside diphosphate kinase [Escherichia coli TA280]
 gi|331678509|ref|ZP_08379184.1| nucleoside diphosphate kinase [Escherichia coli H591]
 gi|332278329|ref|ZP_08390742.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Shigella sp. D9]
 gi|67469208|sp|P0A763|NDK_ECOLI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67469209|sp|P0A764|NDK_ECO57 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|67469210|sp|P0A765|NDK_SHIFL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|90110373|sp|Q31XX2|NDK_SHIBS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|90110374|sp|Q32D44|NDK_SHIDS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|92090398|sp|Q3YZ34|NDK_SHISS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|123146824|sp|Q0T201|NDK_SHIF8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|167016276|sp|A7ZPW1|NDK_ECO24 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|167016277|sp|A8A324|NDK_ECOHS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029039|sp|B1IWE3|NDK_ECOLC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729800|sp|B5Z0Y7|NDK_ECO5E RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729802|sp|B7M7M2|NDK_ECO8A RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729803|sp|B1XAZ3|NDK_ECODH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729804|sp|B7N6A6|NDK_ECOLU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729805|sp|B6I590|NDK_ECOSE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729808|sp|B7LKC0|NDK_ESCF3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729862|sp|B2TXU3|NDK_SHIB3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|254767232|sp|B7LDB0|NDK_ECO55 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|259511700|sp|C4ZX93|NDK_ECOBW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|12516912|gb|AAG57628.1|AE005481_4 nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EDL933]
 gi|416172|emb|CAA40780.1| nucleoside diphosphate kinase [Escherichia coli K-12]
 gi|1788866|gb|AAC75571.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|1799917|dbj|BAA16405.1| multifunctional nucleoside diphosphate kinase, apyrimidinic
           endonuclease, and 3'-phosphodiesterase [Escherichia coli
           str. K12 substr. W3110]
 gi|13362850|dbj|BAB36803.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str. Sakai]
 gi|24052940|gb|AAN44064.1| nucleoside diphosphate kinase [Shigella flexneri 2a str. 301]
 gi|30042166|gb|AAP17891.1| nucleoside diphosphate kinase [Shigella flexneri 2a str. 2457T]
 gi|73856521|gb|AAZ89228.1| nucleoside diphosphate kinase [Shigella sonnei Ss046]
 gi|81242051|gb|ABB62761.1| nucleoside diphosphate kinase [Shigella dysenteriae Sd197]
 gi|81246378|gb|ABB67086.1| nucleoside diphosphate kinase [Shigella boydii Sb227]
 gi|110615997|gb|ABF04664.1| nucleoside diphosphate kinase [Shigella flexneri 5 str. 8401]
 gi|157067673|gb|ABV06928.1| nucleoside diphosphate kinase [Escherichia coli HS]
 gi|157079248|gb|ABV18956.1| nucleoside diphosphate kinase [Escherichia coli E24377A]
 gi|169754127|gb|ACA76826.1| Nucleoside-diphosphate kinase [Escherichia coli ATCC 8739]
 gi|169889963|gb|ACB03670.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|187428771|gb|ACD08045.1| nucleoside diphosphate kinase [Shigella boydii CDC 3083-94]
 gi|187770567|gb|EDU34411.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017087|gb|EDU55209.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489682|gb|EDU64785.1| nucleoside diphosphate kinase [Escherichia coli 53638]
 gi|189003160|gb|EDU72146.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356646|gb|EDU75065.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362277|gb|EDU80696.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368425|gb|EDU86841.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372243|gb|EDU90659.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str. EC869]
 gi|189378597|gb|EDU97013.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str. EC508]
 gi|190902281|gb|EDV62021.1| nucleoside diphosphate kinase [Escherichia coli B7A]
 gi|192929247|gb|EDV82856.1| nucleoside diphosphate kinase [Escherichia coli E22]
 gi|192958303|gb|EDV88743.1| nucleoside diphosphate kinase [Escherichia coli E110019]
 gi|194414602|gb|EDX30874.1| nucleoside diphosphate kinase [Escherichia coli B171]
 gi|194419597|gb|EDX35677.1| nucleoside diphosphate kinase [Shigella dysenteriae 1012]
 gi|194423518|gb|EDX39509.1| nucleoside diphosphate kinase [Escherichia coli 101-1]
 gi|208727848|gb|EDZ77449.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734961|gb|EDZ83648.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740913|gb|EDZ88595.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161202|gb|ACI38635.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209763348|gb|ACI79986.1| nucleoside diphosphate kinase [Escherichia coli]
 gi|209763350|gb|ACI79987.1| nucleoside diphosphate kinase [Escherichia coli]
 gi|209763352|gb|ACI79988.1| nucleoside diphosphate kinase [Escherichia coli]
 gi|209763354|gb|ACI79989.1| nucleoside diphosphate kinase [Escherichia coli]
 gi|209763356|gb|ACI79990.1| nucleoside diphosphate kinase [Escherichia coli]
 gi|209913254|dbj|BAG78328.1| nucleoside diphosphate kinase [Escherichia coli SE11]
 gi|217319071|gb|EEC27496.1| nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352877|emb|CAU98676.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           55989]
 gi|218355586|emb|CAQ88197.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia
           fergusonii ATCC 35469]
 gi|218361811|emb|CAQ99410.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           IAI1]
 gi|218433118|emb|CAR14015.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           UMN026]
 gi|238861829|gb|ACR63827.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           BW2952]
 gi|242378116|emb|CAQ32889.1| nucleoside diphosphate kinase [Escherichia coli BL21(DE3)]
 gi|253323632|gb|ACT28234.1| Nucleoside-diphosphate kinase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974393|gb|ACT40064.1| nucleoside diphosphate kinase [Escherichia coli B str. REL606]
 gi|253978560|gb|ACT44230.1| nucleoside diphosphate kinase [Escherichia coli BL21(DE3)]
 gi|254593864|gb|ACT73225.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O157:H7 str. TW14359]
 gi|257755261|dbj|BAI26763.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O26:H11 str. 11368]
 gi|257760295|dbj|BAI31792.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O103:H2 str. 12009]
 gi|257765563|dbj|BAI37058.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O111:H- str. 11128]
 gi|260448402|gb|ACX38824.1| Nucleoside-diphosphate kinase [Escherichia coli DH1]
 gi|290763612|gb|ADD57573.1| Nucleoside diphosphate kinase [Escherichia coli O55:H7 str. CB9615]
 gi|291323701|gb|EFE63129.1| nucleoside-diphosphate kinase [Escherichia coli B088]
 gi|291428167|gb|EFF01194.1| nucleoside diphosphate kinase [Escherichia coli FVEC1412]
 gi|291433430|gb|EFF06409.1| nucleoside diphosphate kinase [Escherichia coli B185]
 gi|291471400|gb|EFF13884.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298279202|gb|EFI20716.1| nucleoside diphosphate kinase [Escherichia coli FVEC1302]
 gi|299881277|gb|EFI89488.1| nucleoside diphosphate kinase [Escherichia coli MS 196-1]
 gi|300314504|gb|EFJ64288.1| nucleoside diphosphate kinase [Escherichia coli MS 175-1]
 gi|300357918|gb|EFJ73788.1| nucleoside diphosphate kinase [Escherichia coli MS 198-1]
 gi|300403740|gb|EFJ87278.1| nucleoside diphosphate kinase [Escherichia coli MS 84-1]
 gi|300412354|gb|EFJ95664.1| nucleoside diphosphate kinase [Escherichia coli MS 115-1]
 gi|300416889|gb|EFK00200.1| nucleoside diphosphate kinase [Escherichia coli MS 182-1]
 gi|300448974|gb|EFK12594.1| nucleoside diphosphate kinase [Escherichia coli MS 116-1]
 gi|300461964|gb|EFK25457.1| nucleoside diphosphate kinase [Escherichia coli MS 187-1]
 gi|300526565|gb|EFK47634.1| nucleoside diphosphate kinase [Escherichia coli MS 119-7]
 gi|300529700|gb|EFK50762.1| nucleoside diphosphate kinase [Escherichia coli MS 107-1]
 gi|300841810|gb|EFK69570.1| nucleoside diphosphate kinase [Escherichia coli MS 124-1]
 gi|300843620|gb|EFK71380.1| nucleoside diphosphate kinase [Escherichia coli MS 78-1]
 gi|301073660|gb|EFK88466.1| nucleoside diphosphate kinase [Escherichia coli MS 146-1]
 gi|306907410|gb|EFN37914.1| Nucleoside-diphosphate kinase [Escherichia coli W]
 gi|308121891|gb|EFO59153.1| nucleoside diphosphate kinase [Escherichia coli MS 145-7]
 gi|308927101|gb|EFP72575.1| nucleoside diphosphate kinase [Shigella dysenteriae 1617]
 gi|309702850|emb|CBJ02181.1| putative nucleoside diphosphate kinase [Escherichia coli ETEC
           H10407]
 gi|310331836|gb|EFP99071.1| nucleoside diphosphate kinase [Escherichia coli 1827-70]
 gi|313651004|gb|EFS15404.1| nucleoside diphosphate kinase [Shigella flexneri 2a str. 2457T]
 gi|315061837|gb|ADT76164.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           W]
 gi|315137142|dbj|BAJ44301.1| nucleoside diphosphate kinase [Escherichia coli DH1]
 gi|315256538|gb|EFU36506.1| nucleoside diphosphate kinase [Escherichia coli MS 85-1]
 gi|315615777|gb|EFU96409.1| nucleoside diphosphate kinase [Escherichia coli 3431]
 gi|320175081|gb|EFW50194.1| Nucleoside diphosphate kinase [Shigella dysenteriae CDC 74-1112]
 gi|320180508|gb|EFW55439.1| Nucleoside diphosphate kinase [Shigella boydii ATCC 9905]
 gi|320185218|gb|EFW59998.1| Nucleoside diphosphate kinase [Shigella flexneri CDC 796-83]
 gi|320188851|gb|EFW63510.1| Nucleoside diphosphate kinase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320200082|gb|EFW74671.1| Nucleoside diphosphate kinase [Escherichia coli EC4100B]
 gi|320640862|gb|EFX10350.1| mulitfunctional nucleoside diphosphate kinase [Escherichia coli
           O157:H7 str. G5101]
 gi|320646305|gb|EFX15232.1| mulitfunctional nucleoside diphosphate kinase [Escherichia coli
           O157:H- str. 493-89]
 gi|320651810|gb|EFX20190.1| mulitfunctional nucleoside diphosphate kinase [Escherichia coli
           O157:H- str. H 2687]
 gi|320657196|gb|EFX25005.1| mulitfunctional nucleoside diphosphate kinase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320662802|gb|EFX30134.1| mulitfunctional nucleoside diphosphate kinase [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320667606|gb|EFX34521.1| mulitfunctional nucleoside diphosphate kinase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323156173|gb|EFZ42332.1| nucleoside diphosphate kinase [Escherichia coli EPECa14]
 gi|323159388|gb|EFZ45373.1| nucleoside diphosphate kinase [Escherichia coli E128010]
 gi|323169038|gb|EFZ54715.1| nucleoside diphosphate kinase [Shigella sonnei 53G]
 gi|323170209|gb|EFZ55862.1| nucleoside diphosphate kinase [Escherichia coli LT-68]
 gi|323177358|gb|EFZ62946.1| nucleoside diphosphate kinase [Escherichia coli 1180]
 gi|323184421|gb|EFZ69796.1| nucleoside diphosphate kinase [Escherichia coli 1357]
 gi|323377582|gb|ADX49850.1| Nucleoside-diphosphate kinase [Escherichia coli KO11]
 gi|323936411|gb|EGB32701.1| nucleoside diphosphate kinase [Escherichia coli E1520]
 gi|323941220|gb|EGB37405.1| nucleoside diphosphate kinase [Escherichia coli E482]
 gi|323944740|gb|EGB40807.1| nucleoside diphosphate kinase [Escherichia coli H120]
 gi|323961334|gb|EGB56946.1| nucleoside diphosphate kinase [Escherichia coli H489]
 gi|323971069|gb|EGB66317.1| nucleoside diphosphate kinase [Escherichia coli TA007]
 gi|323977299|gb|EGB72385.1| nucleoside diphosphate kinase [Escherichia coli TW10509]
 gi|324008526|gb|EGB77745.1| nucleoside diphosphate kinase [Escherichia coli MS 57-2]
 gi|324020078|gb|EGB89297.1| nucleoside diphosphate kinase [Escherichia coli MS 117-3]
 gi|324113012|gb|EGC06988.1| nucleoside diphosphate kinase [Escherichia fergusonii B253]
 gi|324118138|gb|EGC12035.1| nucleoside diphosphate kinase [Escherichia coli E1167]
 gi|325496449|gb|EGC94308.1| hypothetical protein ECD227_0546 [Escherichia fergusonii ECD227]
 gi|326340316|gb|EGD64120.1| Nucleoside diphosphate kinase [Escherichia coli O157:H7 str. 1125]
 gi|326345000|gb|EGD68744.1| Nucleoside diphosphate kinase [Escherichia coli O157:H7 str. 1044]
 gi|331039936|gb|EGI12156.1| nucleoside diphosphate kinase [Escherichia coli H736]
 gi|331048795|gb|EGI20871.1| nucleoside diphosphate kinase [Escherichia coli M718]
 gi|331059880|gb|EGI31857.1| nucleoside diphosphate kinase [Escherichia coli TA143]
 gi|331064458|gb|EGI36369.1| nucleoside diphosphate kinase [Escherichia coli TA271]
 gi|331069246|gb|EGI40638.1| nucleoside diphosphate kinase [Escherichia coli TA280]
 gi|331074969|gb|EGI46289.1| nucleoside diphosphate kinase [Escherichia coli H591]
 gi|331691477|gb|AED89581.1| nucleoside diphosphate kinase [Escherichia coli]
 gi|332087965|gb|EGI93090.1| nucleoside diphosphate kinase [Shigella boydii 5216-82]
 gi|332089705|gb|EGI94806.1| nucleoside diphosphate kinase [Shigella dysenteriae 155-74]
 gi|332092782|gb|EGI97851.1| nucleoside diphosphate kinase [Shigella boydii 3594-74]
 gi|332100681|gb|EGJ04027.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Shigella sp. D9]
 gi|332344390|gb|AEE57724.1| nucleoside diphosphate kinase [Escherichia coli UMNK88]
 gi|332755568|gb|EGJ85932.1| nucleoside diphosphate kinase [Shigella flexneri K-671]
 gi|332756479|gb|EGJ86830.1| nucleoside diphosphate kinase [Shigella flexneri 2747-71]
 gi|332766351|gb|EGJ96561.1| ndk [Shigella flexneri 2930-71]
 gi|333000706|gb|EGK20282.1| nucleoside diphosphate kinase [Shigella flexneri VA-6]
 gi|333002313|gb|EGK21877.1| nucleoside diphosphate kinase [Shigella flexneri K-272]
 gi|333016136|gb|EGK35468.1| nucleoside diphosphate kinase [Shigella flexneri K-227]
 gi|333016505|gb|EGK35836.1| nucleoside diphosphate kinase [Shigella flexneri K-304]
          Length = 143

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 121 SVESAAREIAYFFGEGEVC 139


>gi|295676906|ref|YP_003605430.1| Nucleoside-diphosphate kinase [Burkholderia sp. CCGE1002]
 gi|295436749|gb|ADG15919.1| Nucleoside-diphosphate kinase [Burkholderia sp. CCGE1002]
          Length = 141

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 96/134 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYTRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +Q L+GE AI K+R++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVEFMISGPVVVQALEGENAILKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
             +TA  EI+++F 
Sbjct: 121 GPETAAAEIAFFFP 134


>gi|148222683|ref|NP_001091338.1| nucleoside diphosphate kinase 3 [Xenopus laevis]
 gi|125858115|gb|AAI29550.1| LOC100037175 protein [Xenopus laevis]
          Length = 169

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD  +R L+G I++  E  G C+VA K    + K     Y+  +D+PF+  L
Sbjct: 22  ERTFLAIKPDGYQRRLVGEIIRRFEKKGFCLVALKIMQASEKLLRQHYIALQDKPFYDRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +   R ++G+T+P  +L GTIR  + I +G N IHGSDS +
Sbjct: 82  VKYMGSGPVVAMVWQGLDVVKTARVMIGETNPAHSLPGTIRGDFCIDVGRNVIHGSDSRE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SAQREIALWFQPDELV 157


>gi|17987539|ref|NP_540173.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|256044386|ref|ZP_05447290.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260563738|ref|ZP_05834224.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|265990805|ref|ZP_06103362.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|20138834|sp|Q8YGA4|NDK_BRUME RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|17983241|gb|AAL52437.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260153754|gb|EEW88846.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|263001589|gb|EEZ14164.1| nucleoside diphosphate kinase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 140

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 88/140 (62%), Positives = 113/140 (80%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA +RNL G+I+ +LE+ GL VVA+K  WM+R++AE FY +HKDRPFF
Sbjct: 1   MAIERTFSMIKPDATRRNLTGAIIAKLEEAGLRVVASKRVWMSRREAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR  + +SIGENS+HGSD
Sbjct: 61  GELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPANADEGTIRKAFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+YWF+  EI+G
Sbjct: 121 APETAAEEIAYWFSGTEIVG 140


>gi|114328703|ref|YP_745860.1| nucleoside diphosphate kinase [Granulibacter bethesdensis CGDNIH1]
 gi|114316877|gb|ABI62937.1| nucleoside diphosphate kinase [Granulibacter bethesdensis CGDNIH1]
          Length = 158

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDA +RNL G I    E+ GL +VA K   +++ QAE FY +H++RPFF
Sbjct: 19  MAIERTFSIIKPDATRRNLTGRINAVFEENGLRIVAQKRVQLSQAQAEAFYGVHRERPFF 78

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE A+++NRE+MG TDPKKA  GTIR ++  SI  NS+HGSD
Sbjct: 79  NDLVSFMISGPVVVQVLEGENAVARNRELMGATDPKKADAGTIRAQFAESIEANSVHGSD 138

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  EI+Y+FA +EI+
Sbjct: 139 SAENAAIEIAYFFAGSEIV 157


>gi|308174065|ref|YP_003920770.1| nucleoside diphosphate kinase [Bacillus amyloliquefaciens DSM 7]
 gi|307606929|emb|CBI43300.1| nucleoside diphosphate kinase [Bacillus amyloliquefaciens DSM 7]
 gi|328552809|gb|AEB23301.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Bacillus
           amyloliquefaciens TA208]
 gi|328912395|gb|AEB63991.1| nucleoside diphosphate kinase [Bacillus amyloliquefaciens LL3]
          Length = 148

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 92/137 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LIG I+   E  GL +  AK   ++ + AE+ Y  HK +PFF E
Sbjct: 1   MEKTFIMVKPDGVQRQLIGEILSRFERKGLQLAGAKLMQVSEQMAENHYAEHKGKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  V +GE  +   R+++G T+PK AL GTIR  YG+ +G+N IHGSDSL
Sbjct: 61  LVEFITSGPVFAMVWEGENVVEITRQLIGKTNPKDALPGTIRGDYGMFVGKNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F + E++
Sbjct: 121 ESAEREIQIFFKQEELV 137


>gi|255321900|ref|ZP_05363050.1| nucleoside diphosphate kinase [Campylobacter showae RM3277]
 gi|255301004|gb|EET80271.1| nucleoside diphosphate kinase [Campylobacter showae RM3277]
          Length = 137

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 98/137 (71%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T S+IKPDAVK+ +IG I+   E  GL + A K   ++   A+ FY +HKDRPFF +
Sbjct: 1   MQQTLSIIKPDAVKKGVIGKIMDRFESNGLRIAAMKKVKLSTCDAKAFYAVHKDRPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  M+SGPV + VL+G++A++KNR++MG T+PK+A  GTIR  +  +I  N++HGSDSL
Sbjct: 61  LVDFMVSGPVVVMVLEGDDAVAKNRDLMGATNPKEAKPGTIRADFAENIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++FA  EI 
Sbjct: 121 ENAKNEIAFFFATREIC 137


>gi|77460826|ref|YP_350333.1| nucleoside diphosphate kinase [Pseudomonas fluorescens Pf0-1]
 gi|92090394|sp|Q3K7B2|NDK_PSEPF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|77384829|gb|ABA76342.1| nucleoside diphosphate kinase [Pseudomonas fluorescens Pf0-1]
          Length = 141

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDAV +N+IG I    ED GL VVA+K   +++ +AE FY  H  R FF
Sbjct: 1   MAVQRTFSIIKPDAVAKNVIGKITTRFEDAGLRVVASKLKQLSKAEAEGFYAEHSARGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  M SGPV +QVL+GE AI++NRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  GELVAFMTSGPVVVQVLEGENAIARNRELMGATNPKEAAPGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S   A  EI+Y+FA  E+
Sbjct: 121 SEAAAAREIAYFFAATEV 138


>gi|46446002|ref|YP_007367.1| nucleoside-diphosphate kinase [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|81697687|sp|Q6MEA7|NDK2_PARUW RecName: Full=Nucleoside diphosphate kinase 2; Short=NDK 2;
           Short=NDP kinase 2; AltName: Full=Nucleoside-2-P kinase
           2
 gi|46399643|emb|CAF23092.1| probable nucleoside-diphosphate kinase [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 143

 Score =  171 bits (434), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV  N IG I+   E  GL +VAAK   ++RK AE FY +HK RPFF
Sbjct: 1   MTLERTLSIIKPDAVGNNHIGEIIARFEKAGLRIVAAKMKQLDRKDAEGFYAVHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M +GPV + VL+GE AI+KNRE+MG TDPKKA  GTIR  +  +I EN++HGSD
Sbjct: 61  EDLVGFMTTGPVMIMVLEGENAINKNREIMGATDPKKAAPGTIRADFAQTIDENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA  EI Y+F   ++ 
Sbjct: 121 AAETAKTEIEYFFKSQDVC 139


>gi|326403504|ref|YP_004283586.1| nucleoside diphosphate kinase [Acidiphilium multivorum AIU301]
 gi|325050366|dbj|BAJ80704.1| nucleoside diphosphate kinase [Acidiphilium multivorum AIU301]
          Length = 172

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/140 (51%), Positives = 100/140 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA +RNL G I  + E+ GL +VA K   + + QAE FY +HK+RPFF
Sbjct: 33  MATERTLSIIKPDATRRNLTGRINAKFEEAGLRIVAQKRIRLTKDQAEAFYGVHKERPFF 92

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+G++A+++NR +MG TDP+KA  GTIR ++   I  NS+HGSD
Sbjct: 93  AGLVSFMTSGPVVVQVLEGDDAVARNRAIMGATDPRKAEAGTIRAEFAEDIEANSVHGSD 152

Query: 121 SLKTALEEISYWFARNEIIG 140
           +  TA +EI+++FA  EI+G
Sbjct: 153 AADTAAQEIAFFFAGVEIVG 172


>gi|332239952|ref|XP_003269155.1| PREDICTED: nucleoside diphosphate kinase, mitochondrial-like
           [Nomascus leucogenys]
          Length = 187

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 74/136 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 38  ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLQRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G TD  +A  GT+R  + + I  N IH SDS++
Sbjct: 98  IRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTVRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 158 GAQREIQLWFQSSELV 173


>gi|187478837|ref|YP_786861.1| nucleoside diphosphate kinase [Bordetella avium 197N]
 gi|109892766|sp|Q2KY86|NDK_BORA1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|115423423|emb|CAJ49957.1| nucleoside diphosphate kinase [Bordetella avium 197N]
          Length = 141

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 99/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++T S+IKPDAV +N+IG IV   E  GL V+AA+   ++R  AE FY +HK+RPFF
Sbjct: 1   MSIQRTLSIIKPDAVAKNVIGQIVARFEQAGLKVIAARLQQLSRADAERFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPVF+QVL+GE AI  NR++MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVFVQVLEGENAIQVNRDLMGATDPKKAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  E++++F    I
Sbjct: 121 APETAAVEVAFFFPEINI 138


>gi|20090383|ref|NP_616458.1| nucleoside diphosphate kinase [Methanosarcina acetivorans C2A]
 gi|19915391|gb|AAM04938.1| nucleoside-diphosphate kinase [Methanosarcina acetivorans C2A]
          Length = 151

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 82/138 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T+ M+KPD V+R L+G ++  +E  GL ++A +   +    A++ Y  H  RPFF
Sbjct: 1   MNMEQTYVMVKPDGVQRGLVGEVISRIEKRGLKILALRMNVIAEATAKEHYGEHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L++ + SGP    V+ G++AI   R + G T+P  A  GTIR  + + +G N +H SD
Sbjct: 61  PSLIEFITSGPSVSMVVAGKDAIKVMRAINGATNPVDAAPGTIRGDFALDVGRNVVHASD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S + A  EI+  F  +EI
Sbjct: 121 SPEAAAREIAIHFKDSEI 138


>gi|8272416|dbj|BAA96460.1| nucleoside diphosphate kinase 3 [Brassica rapa]
          Length = 194

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  IV   E  G  +V  K    ++  A+  Y   K+RPFF  
Sbjct: 44  MERTFIAIKPDGVQRGLISEIVARFERKGFKLVGIKVVVPSKDFAQKHYHDLKERPFFNG 103

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I   R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 104 LCDFLSSGPVIAMVWEGEGVIRYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGP 163

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI+ WF   E++
Sbjct: 164 ETAKDEINLWFKPQELV 180


>gi|157832086|pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside,
           Diphosphate Kinases
          Length = 150

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 80/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 4   ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 63

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+P  +  G+IR  +G+ +G N IHGSDS++
Sbjct: 64  VSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAGGSIRGDFGVDVGRNIIHGSDSVE 123

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 124 SANREIALWFKPEELL 139


>gi|197336190|ref|YP_002155382.1| nucleoside diphosphate kinase [Vibrio fischeri MJ11]
 gi|226729871|sp|B5FAW8|NDK_VIBFM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|197317680|gb|ACH67127.1| nucleoside diphosphate kinase [Vibrio fischeri MJ11]
          Length = 144

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAVKRNLIG+I + +E  G+ +VAAK   + ++QAE FY  H+ + FF
Sbjct: 1   MTIERTFSIVKPDAVKRNLIGAIYRRIEKTGMQIVAAKMLRLTKEQAEGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  M+SGPV +QVL+GE A+ + RE+MG T+P++A  G++R  Y IS+  NS+HG+D
Sbjct: 61  DELVAYMMSGPVMVQVLEGENAVVRYRELMGKTNPEEAACGSLRADYAISMRYNSVHGAD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA +EI 
Sbjct: 121 SPESAAREIAYFFAEDEIC 139


>gi|215487868|ref|YP_002330299.1| nucleoside diphosphate kinase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218690638|ref|YP_002398850.1| nucleoside diphosphate kinase [Escherichia coli ED1a]
 gi|312965434|ref|ZP_07779666.1| nucleoside diphosphate kinase [Escherichia coli 2362-75]
 gi|254767231|sp|B7UGW4|NDK_ECO27 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|254767233|sp|B7MYF2|NDK_ECO81 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|215265940|emb|CAS10349.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218428202|emb|CAR09118.2| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           ED1a]
 gi|312289854|gb|EFR17742.1| nucleoside diphosphate kinase [Escherichia coli 2362-75]
          Length = 143

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IGSI    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGSIFARFETAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 121 SVESAAREIAYFFGEGEVC 139


>gi|157423016|gb|AAI53641.1| Nme4 protein [Danio rerio]
          Length = 190

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 76/136 (55%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R LIG ++K  E  G  +V  K      K     Y+  + +PF+  L
Sbjct: 42  ERTLVAVKPDGVQRRLIGEVIKRFEQRGFRLVGLKMLQAPDKLLAQHYVSLQKKPFYSSL 101

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGP+   V +G   +  +R ++GDTDP  A  GTIR  + + I  N +H SDS++
Sbjct: 102 LYYMTSGPIVAMVWEGHNVVKTSRMMVGDTDPAAAAPGTIRGDFSVHISRNVVHASDSVE 161

Query: 124 TALEEISYWFARNEII 139
            A  EIS WF R+E++
Sbjct: 162 GAQREISLWFHRSELV 177


>gi|41055200|ref|NP_957489.1| nucleoside diphosphate kinase, mitochondrial [Danio rerio]
 gi|29124448|gb|AAH49030.1| Non-metastatic cells 4, protein expressed in [Danio rerio]
          Length = 190

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 76/136 (55%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R LIG ++K  E  G  +V  K      K     Y+  + +PF+  L
Sbjct: 42  ERTLVAVKPDGVQRRLIGEVIKRFEQRGFRLVGLKMLQAPDKLLAQHYVSLQKKPFYSSL 101

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGP+   V +G   +  +R ++GDTDP  A  GTIR  + + I  N +H SDS++
Sbjct: 102 LYYMTSGPIVAMVWEGHNVVKTSRMMVGDTDPAAAAPGTIRGDFSVHISRNVVHASDSVE 161

Query: 124 TALEEISYWFARNEII 139
            A  EIS WF R+E++
Sbjct: 162 GAQREISLWFHRSELV 177


>gi|163749687|ref|ZP_02156933.1| nucleoside diphosphate kinase [Shewanella benthica KT99]
 gi|161330500|gb|EDQ01458.1| nucleoside diphosphate kinase [Shewanella benthica KT99]
          Length = 143

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV +N IG+I    E  GL ++A+K   ++++QAE FY  H +RPFF
Sbjct: 1   MAIERTFSIIKPDAVAKNNIGAIYNRFETAGLKIIASKMVHLSKEQAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +Q L+GE A+  +R+++G TDP  A  GTIR  +  SI EN+ HGSD
Sbjct: 61  GALVAFMTSGPIMVQALEGENAVLAHRDILGATDPADAASGTIRADFAESIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+ +A  E++Y+F+  E+ 
Sbjct: 121 SVASAEREVAYFFSTEELC 139


>gi|73670823|ref|YP_306838.1| nucleoside diphosphate kinase [Methanosarcina barkeri str. Fusaro]
 gi|92090387|sp|Q466D4|NDK_METBF RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|72397985|gb|AAZ72258.1| nucleoside diphosphate kinase [Methanosarcina barkeri str. Fusaro]
          Length = 149

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 82/136 (60%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T+ M+KPD V+R L+G I+  +E  GL +VA +   ++   A++ Y  H  +PFFP 
Sbjct: 1   MEQTYVMVKPDGVQRGLVGEIISRIEKRGLKIVALRMNVISEATAKEHYSEHAAKPFFPG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGP    V++G++AI   R + G T+P  A  GT+R  + + +G N +H SDS 
Sbjct: 61  LVGFITSGPSVSMVVEGKDAIRVMRAINGATNPVDAAPGTVRGDFALDVGRNVVHASDSP 120

Query: 123 KTALEEISYWFARNEI 138
           + A  EI+  F  +EI
Sbjct: 121 EAAAREIAIHFKDSEI 136


>gi|301024750|ref|ZP_07188390.1| nucleoside diphosphate kinase [Escherichia coli MS 69-1]
 gi|300396419|gb|EFJ79957.1| nucleoside diphosphate kinase [Escherichia coli MS 69-1]
 gi|323967966|gb|EGB63378.1| nucleoside diphosphate kinase [Escherichia coli M863]
 gi|327252225|gb|EGE63897.1| nucleoside diphosphate kinase [Escherichia coli STEC_7v]
          Length = 143

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IG+I    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 121 SVESAAREIAYFFGEGEVC 139


>gi|26248883|ref|NP_754923.1| nucleoside diphosphate kinase [Escherichia coli CFT073]
 gi|91211845|ref|YP_541831.1| nucleoside diphosphate kinase [Escherichia coli UTI89]
 gi|110642683|ref|YP_670413.1| nucleoside diphosphate kinase [Escherichia coli 536]
 gi|117624747|ref|YP_853660.1| nucleoside diphosphate kinase [Escherichia coli APEC O1]
 gi|170680359|ref|YP_001744706.1| nucleoside diphosphate kinase [Escherichia coli SMS-3-5]
 gi|191172594|ref|ZP_03034133.1| nucleoside diphosphate kinase [Escherichia coli F11]
 gi|218559444|ref|YP_002392357.1| nucleoside diphosphate kinase [Escherichia coli S88]
 gi|218701028|ref|YP_002408657.1| nucleoside diphosphate kinase [Escherichia coli IAI39]
 gi|227887553|ref|ZP_04005358.1| nucleoside diphosphate kinase [Escherichia coli 83972]
 gi|237705028|ref|ZP_04535509.1| nucleoside diphosphate kinase [Escherichia sp. 3_2_53FAA]
 gi|300940231|ref|ZP_07154829.1| nucleoside diphosphate kinase [Escherichia coli MS 21-1]
 gi|300981980|ref|ZP_07175826.1| nucleoside diphosphate kinase [Escherichia coli MS 45-1]
 gi|300998074|ref|ZP_07181934.1| nucleoside diphosphate kinase [Escherichia coli MS 200-1]
 gi|301047151|ref|ZP_07194246.1| nucleoside diphosphate kinase [Escherichia coli MS 185-1]
 gi|306814412|ref|ZP_07448574.1| nucleoside diphosphate kinase [Escherichia coli NC101]
 gi|331648215|ref|ZP_08349305.1| nucleoside diphosphate kinase [Escherichia coli M605]
 gi|331658663|ref|ZP_08359607.1| nucleoside diphosphate kinase [Escherichia coli TA206]
 gi|331684166|ref|ZP_08384762.1| nucleoside diphosphate kinase [Escherichia coli H299]
 gi|34222691|sp|Q8FF53|NDK_ECOL6 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119372027|sp|Q0TEW7|NDK_ECOL5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119372028|sp|Q1R8L4|NDK_ECOUT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166232969|sp|A1AE56|NDK_ECOK1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729799|sp|B7MI03|NDK_ECO45 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729801|sp|B7NRG8|NDK_ECO7I RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729806|sp|B1LNH3|NDK_ECOSM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|26109289|gb|AAN81491.1|AE016764_173 Nucleoside diphosphate kinase [Escherichia coli CFT073]
 gi|91073419|gb|ABE08300.1| nucleoside diphosphate kinase [Escherichia coli UTI89]
 gi|110344275|gb|ABG70512.1| nucleoside diphosphate kinase [Escherichia coli 536]
 gi|115513871|gb|ABJ01946.1| nucleoside diphosphate kinase [Escherichia coli APEC O1]
 gi|170518077|gb|ACB16255.1| nucleoside diphosphate kinase [Escherichia coli SMS-3-5]
 gi|190907067|gb|EDV66667.1| nucleoside diphosphate kinase [Escherichia coli F11]
 gi|218366213|emb|CAR03961.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           S88]
 gi|218371014|emb|CAR18842.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Escherichia coli
           IAI39]
 gi|222034229|emb|CAP76970.1| Nucleoside diphosphate kinase [Escherichia coli LF82]
 gi|226901394|gb|EEH87653.1| nucleoside diphosphate kinase [Escherichia sp. 3_2_53FAA]
 gi|227835903|gb|EEJ46369.1| nucleoside diphosphate kinase [Escherichia coli 83972]
 gi|281179572|dbj|BAI55902.1| nucleoside diphosphate kinase [Escherichia coli SE15]
 gi|294489751|gb|ADE88507.1| nucleoside diphosphate kinase [Escherichia coli IHE3034]
 gi|300300937|gb|EFJ57322.1| nucleoside diphosphate kinase [Escherichia coli MS 185-1]
 gi|300304053|gb|EFJ58573.1| nucleoside diphosphate kinase [Escherichia coli MS 200-1]
 gi|300408875|gb|EFJ92413.1| nucleoside diphosphate kinase [Escherichia coli MS 45-1]
 gi|300454927|gb|EFK18420.1| nucleoside diphosphate kinase [Escherichia coli MS 21-1]
 gi|305851806|gb|EFM52258.1| nucleoside diphosphate kinase [Escherichia coli NC101]
 gi|307554541|gb|ADN47316.1| nucleoside diphosphate kinase [Escherichia coli ABU 83972]
 gi|307625926|gb|ADN70230.1| nucleoside diphosphate kinase [Escherichia coli UM146]
 gi|312947095|gb|ADR27922.1| nucleoside diphosphate kinase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315288070|gb|EFU47470.1| nucleoside diphosphate kinase [Escherichia coli MS 110-3]
 gi|315292441|gb|EFU51793.1| nucleoside diphosphate kinase [Escherichia coli MS 153-1]
 gi|315300491|gb|EFU59720.1| nucleoside diphosphate kinase [Escherichia coli MS 16-3]
 gi|320196355|gb|EFW70979.1| Nucleoside diphosphate kinase [Escherichia coli WV_060327]
 gi|323188364|gb|EFZ73656.1| nucleoside diphosphate kinase [Escherichia coli RN587/1]
 gi|323949178|gb|EGB45069.1| nucleoside diphosphate kinase [Escherichia coli H252]
 gi|323955759|gb|EGB51517.1| nucleoside diphosphate kinase [Escherichia coli H263]
 gi|324011225|gb|EGB80444.1| nucleoside diphosphate kinase [Escherichia coli MS 60-1]
 gi|330912293|gb|EGH40803.1| nucleoside diphosphate kinase [Escherichia coli AA86]
 gi|331043075|gb|EGI15215.1| nucleoside diphosphate kinase [Escherichia coli M605]
 gi|331054328|gb|EGI26355.1| nucleoside diphosphate kinase [Escherichia coli TA206]
 gi|331079118|gb|EGI50320.1| nucleoside diphosphate kinase [Escherichia coli H299]
          Length = 143

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 91/139 (65%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IGSI    E  G  +V  K   +  +QA  FY  H  +PFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F   E+ 
Sbjct: 121 SVESAAREIAYFFGEGEVC 139


>gi|59711232|ref|YP_204008.1| nucleoside diphosphate kinase [Vibrio fischeri ES114]
 gi|67460601|sp|Q5E776|NDK_VIBF1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|59479333|gb|AAW85120.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Vibrio fischeri
           ES114]
          Length = 144

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 104/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAVKRNLIG+I + +E  G+ +VAAK   + ++QAE FY  H+ + FF
Sbjct: 1   MTIERTFSIVKPDAVKRNLIGAIYRRIEKTGMQIVAAKMLRLTKEQAEGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  M+SGPV +QVL+GE A+ + RE+MG T+P++A  G++R  Y IS+  NS+HG+D
Sbjct: 61  DELVAYMMSGPVMVQVLEGENAVVRYRELMGKTNPEEAACGSLRADYAISMRYNSVHGAD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+FA +EI 
Sbjct: 121 SPESAAREIAYFFAEDEIC 139


>gi|157832095|pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase
          Length = 155

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 9   ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 68

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+P  +  G+IR  +G+ +G N I GSDS++
Sbjct: 69  VSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIICGSDSVE 128

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 129 SANREIALWFKPEELL 144


>gi|270264733|ref|ZP_06192998.1| nucleoside diphosphate kinase [Serratia odorifera 4Rx13]
 gi|270041416|gb|EFA14515.1| nucleoside diphosphate kinase [Serratia odorifera 4Rx13]
          Length = 141

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++A+K   + R+QAE FY  HK RPFF
Sbjct: 1   MTVERTFSIIKPNAVANNDIGAIYARFERAGFKIIASKMLRLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+ E A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIVVQVLEAENAVQRNRDIMGATNPDNALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F  +EI 
Sbjct: 121 AVESAQREIAYFFNESEIC 139


>gi|23501581|ref|NP_697708.1| nucleoside diphosphate kinase [Brucella suis 1330]
 gi|62289656|ref|YP_221449.1| nucleoside diphosphate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82699583|ref|YP_414157.1| nucleoside diphosphate kinase [Brucella melitensis biovar Abortus
           2308]
 gi|161618663|ref|YP_001592550.1| nucleoside diphosphate kinase [Brucella canis ATCC 23365]
 gi|163842964|ref|YP_001627368.1| nucleoside diphosphate kinase [Brucella suis ATCC 23445]
 gi|189023905|ref|YP_001934673.1| nucleoside diphosphate kinase [Brucella abortus S19]
 gi|225627191|ref|ZP_03785229.1| Nucleoside diphosphate kinase [Brucella ceti str. Cudo]
 gi|225852214|ref|YP_002732447.1| nucleoside diphosphate kinase [Brucella melitensis ATCC 23457]
 gi|237815145|ref|ZP_04594143.1| Nucleoside diphosphate kinase [Brucella abortus str. 2308 A]
 gi|254688965|ref|ZP_05152219.1| nucleoside diphosphate kinase [Brucella abortus bv. 6 str. 870]
 gi|254693447|ref|ZP_05155275.1| nucleoside diphosphate kinase [Brucella abortus bv. 3 str. Tulya]
 gi|254697100|ref|ZP_05158928.1| nucleoside diphosphate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701477|ref|ZP_05163305.1| nucleoside diphosphate kinase [Brucella suis bv. 5 str. 513]
 gi|254704024|ref|ZP_05165852.1| nucleoside diphosphate kinase [Brucella suis bv. 3 str. 686]
 gi|254707604|ref|ZP_05169432.1| nucleoside diphosphate kinase [Brucella pinnipedialis M163/99/10]
 gi|254709815|ref|ZP_05171626.1| nucleoside diphosphate kinase [Brucella pinnipedialis B2/94]
 gi|254713819|ref|ZP_05175630.1| nucleoside diphosphate kinase [Brucella ceti M644/93/1]
 gi|254717123|ref|ZP_05178934.1| nucleoside diphosphate kinase [Brucella ceti M13/05/1]
 gi|254729995|ref|ZP_05188573.1| nucleoside diphosphate kinase [Brucella abortus bv. 4 str. 292]
 gi|256031306|ref|ZP_05444920.1| nucleoside diphosphate kinase [Brucella pinnipedialis M292/94/1]
 gi|256060819|ref|ZP_05450979.1| nucleoside diphosphate kinase [Brucella neotomae 5K33]
 gi|256113229|ref|ZP_05454097.1| nucleoside diphosphate kinase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159419|ref|ZP_05457197.1| nucleoside diphosphate kinase [Brucella ceti M490/95/1]
 gi|256254714|ref|ZP_05460250.1| nucleoside diphosphate kinase [Brucella ceti B1/94]
 gi|256257214|ref|ZP_05462750.1| nucleoside diphosphate kinase [Brucella abortus bv. 9 str. C68]
 gi|256264278|ref|ZP_05466810.1| nucleoside diphosphate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369128|ref|YP_003106636.1| nucleoside diphosphate kinase [Brucella microti CCM 4915]
 gi|260168445|ref|ZP_05755256.1| nucleoside diphosphate kinase [Brucella sp. F5/99]
 gi|260545593|ref|ZP_05821334.1| nucleoside diphosphate kinase [Brucella abortus NCTC 8038]
 gi|260566728|ref|ZP_05837198.1| nucleoside diphosphate kinase [Brucella suis bv. 4 str. 40]
 gi|260754455|ref|ZP_05866803.1| nucleoside-2-P kinase [Brucella abortus bv. 6 str. 870]
 gi|260757674|ref|ZP_05870022.1| nucleoside-2-P kinase [Brucella abortus bv. 4 str. 292]
 gi|260761501|ref|ZP_05873844.1| nucleoside-2-P kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883484|ref|ZP_05895098.1| nucleoside diphosphate kinase [Brucella abortus bv. 9 str. C68]
 gi|261213701|ref|ZP_05927982.1| nucleoside-2-P kinase [Brucella abortus bv. 3 str. Tulya]
 gi|261218938|ref|ZP_05933219.1| nucleoside diphosphate kinase [Brucella ceti M13/05/1]
 gi|261221894|ref|ZP_05936175.1| nucleoside diphosphate kinase [Brucella ceti B1/94]
 gi|261315092|ref|ZP_05954289.1| nucleoside diphosphate kinase [Brucella pinnipedialis M163/99/10]
 gi|261317353|ref|ZP_05956550.1| nucleoside diphosphate kinase [Brucella pinnipedialis B2/94]
 gi|261321563|ref|ZP_05960760.1| nucleoside diphosphate kinase [Brucella ceti M644/93/1]
 gi|261324811|ref|ZP_05964008.1| nucleoside diphosphate kinase [Brucella neotomae 5K33]
 gi|261752020|ref|ZP_05995729.1| nucleoside diphosphate kinase [Brucella suis bv. 5 str. 513]
 gi|261754679|ref|ZP_05998388.1| nucleoside diphosphate kinase [Brucella suis bv. 3 str. 686]
 gi|261757907|ref|ZP_06001616.1| nucleoside diphosphate kinase [Brucella sp. F5/99]
 gi|265988391|ref|ZP_06100948.1| nucleoside diphosphate kinase [Brucella pinnipedialis M292/94/1]
 gi|265994641|ref|ZP_06107198.1| nucleoside diphosphate kinase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997857|ref|ZP_06110414.1| nucleoside diphosphate kinase [Brucella ceti M490/95/1]
 gi|297248063|ref|ZP_06931781.1| nucleoside-diphosphate kinase [Brucella abortus bv. 5 str. B3196]
 gi|306838752|ref|ZP_07471586.1| nucleoside diphosphate kinase [Brucella sp. NF 2653]
 gi|306842040|ref|ZP_07474713.1| nucleoside diphosphate kinase [Brucella sp. BO2]
 gi|306845294|ref|ZP_07477870.1| nucleoside diphosphate kinase [Brucella sp. BO1]
 gi|38257860|sp|Q8G1L9|NDK_BRUSU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|75505315|sp|Q57E46|NDK_BRUAB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|90110366|sp|Q2YN40|NDK_BRUA2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029014|sp|A9MA67|NDK_BRUC2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|189029032|sp|B0CL18|NDK_BRUSI RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226726292|sp|B2S4V2|NDK_BRUA1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|254767219|sp|C0RI35|NDK_BRUMB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|23347495|gb|AAN29623.1| nucleoside diphosphate kinase [Brucella suis 1330]
 gi|62195788|gb|AAX74088.1| Ndk, nucleoside diphosphate kinase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615684|emb|CAJ10671.1| Nucleoside diphosphate kinase [Brucella melitensis biovar Abortus
           2308]
 gi|161335474|gb|ABX61779.1| Nucleoside diphosphate kinase [Brucella canis ATCC 23365]
 gi|163673687|gb|ABY37798.1| Nucleoside diphosphate kinase [Brucella suis ATCC 23445]
 gi|189019477|gb|ACD72199.1| Nucleoside diphosphate kinase [Brucella abortus S19]
 gi|225618026|gb|EEH15070.1| Nucleoside diphosphate kinase [Brucella ceti str. Cudo]
 gi|225640579|gb|ACO00493.1| Nucleoside diphosphate kinase [Brucella melitensis ATCC 23457]
 gi|237789982|gb|EEP64192.1| Nucleoside diphosphate kinase [Brucella abortus str. 2308 A]
 gi|255999288|gb|ACU47687.1| nucleoside diphosphate kinase [Brucella microti CCM 4915]
 gi|260097000|gb|EEW80875.1| nucleoside diphosphate kinase [Brucella abortus NCTC 8038]
 gi|260156246|gb|EEW91326.1| nucleoside diphosphate kinase [Brucella suis bv. 4 str. 40]
 gi|260667992|gb|EEX54932.1| nucleoside-2-P kinase [Brucella abortus bv. 4 str. 292]
 gi|260671933|gb|EEX58754.1| nucleoside-2-P kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674563|gb|EEX61384.1| nucleoside-2-P kinase [Brucella abortus bv. 6 str. 870]
 gi|260873012|gb|EEX80081.1| nucleoside diphosphate kinase [Brucella abortus bv. 9 str. C68]
 gi|260915308|gb|EEX82169.1| nucleoside-2-P kinase [Brucella abortus bv. 3 str. Tulya]
 gi|260920478|gb|EEX87131.1| nucleoside diphosphate kinase [Brucella ceti B1/94]
 gi|260924027|gb|EEX90595.1| nucleoside diphosphate kinase [Brucella ceti M13/05/1]
 gi|261294253|gb|EEX97749.1| nucleoside diphosphate kinase [Brucella ceti M644/93/1]
 gi|261296576|gb|EEY00073.1| nucleoside diphosphate kinase [Brucella pinnipedialis B2/94]
 gi|261300791|gb|EEY04288.1| nucleoside diphosphate kinase [Brucella neotomae 5K33]
 gi|261304118|gb|EEY07615.1| nucleoside diphosphate kinase [Brucella pinnipedialis M163/99/10]
 gi|261737891|gb|EEY25887.1| nucleoside diphosphate kinase [Brucella sp. F5/99]
 gi|261741773|gb|EEY29699.1| nucleoside diphosphate kinase [Brucella suis bv. 5 str. 513]
 gi|261744432|gb|EEY32358.1| nucleoside diphosphate kinase [Brucella suis bv. 3 str. 686]
 gi|262552325|gb|EEZ08315.1| nucleoside diphosphate kinase [Brucella ceti M490/95/1]
 gi|262765754|gb|EEZ11543.1| nucleoside diphosphate kinase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094538|gb|EEZ18347.1| nucleoside diphosphate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660588|gb|EEZ30849.1| nucleoside diphosphate kinase [Brucella pinnipedialis M292/94/1]
 gi|297175232|gb|EFH34579.1| nucleoside-diphosphate kinase [Brucella abortus bv. 5 str. B3196]
 gi|306274453|gb|EFM56260.1| nucleoside diphosphate kinase [Brucella sp. BO1]
 gi|306287881|gb|EFM59301.1| nucleoside diphosphate kinase [Brucella sp. BO2]
 gi|306406154|gb|EFM62399.1| nucleoside diphosphate kinase [Brucella sp. NF 2653]
 gi|326538437|gb|ADZ86652.1| nucleoside diphosphate kinase [Brucella melitensis M5-90]
          Length = 140

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 88/140 (62%), Positives = 113/140 (80%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA +RNL G+I+ +LE+ GL VVA+K  WM+R++AE FY +HKDRPFF
Sbjct: 1   MAIERTFSMIKPDATRRNLTGAIIAKLEEAGLRVVASKRVWMSRREAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR  + +SIGENS+HGSD
Sbjct: 61  GELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPANADEGTIRKTFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+YWF+  EI+G
Sbjct: 121 APETAAEEIAYWFSGTEIVG 140


>gi|114320404|ref|YP_742087.1| nucleoside diphosphate kinase [Alkalilimnicola ehrlichii MLHE-1]
 gi|119372018|sp|Q0A990|NDK_ALHEH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|114226798|gb|ABI56597.1| nucleoside diphosphate kinase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 141

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAA+   ++R+QAE FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNIIGEIYNRFEKAGLKIVAARMVHLSREQAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE AI KNRE+MG T+P +A  GT+R+ Y  +I  N++HGSD
Sbjct: 61  NDLVGFMISGPVMVQVLEGENAIVKNREIMGATNPAEAAAGTLRHDYAETIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA +EI ++F  +E+ 
Sbjct: 121 APETAKQEIEFFFKADELC 139


>gi|212224100|ref|YP_002307336.1| nucleoside diphosphate kinase [Thermococcus onnurineus NA1]
 gi|212009057|gb|ACJ16439.1| nucleoside diphosphate kinase [Thermococcus onnurineus NA1]
          Length = 170

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           IE+T  ++KPDAV R L+G I+   E  GL +V  K  W+ R+ AE  Y  HK +PFF  
Sbjct: 6   IERTLVILKPDAVVRGLMGEIISRFEKRGLKIVGMKMIWITRELAEKHYEEHKGKPFFEP 65

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGS 119
           L+  +   P  + V++G  AIS  R++ G TDPK A  G+IR  YG+ +G+   N IH S
Sbjct: 66  LIDYITKAPSVVMVVEGRYAISVVRKMAGATDPKDAEPGSIRGDYGLDVGDAIYNVIHAS 125

Query: 120 DSLKTALEEISYWFARNEI 138
           DS ++A  EI  +F+ +EI
Sbjct: 126 DSPESAEREIKLYFSEDEI 144


>gi|291276957|ref|YP_003516729.1| nucleoside diphosphate kinase [Helicobacter mustelae 12198]
 gi|290964151|emb|CBG39996.1| nucleoside diphosphate kinase [Helicobacter mustelae 12198]
          Length = 137

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 98/136 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAVK+N+IG IV   E  GL + A K   ++++ A+ FY +H++RPFF +
Sbjct: 1   MEQTLSIIKPDAVKKNVIGKIVDRFESSGLRIAAMKKVQLSKEDAQRFYAVHQERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV + +L+G +A+ KNR +MG T+PK+A KGTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMTSGPVVVMILEGVDAVGKNRNLMGATNPKEAQKGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEI 138
           + A  EI ++F + EI
Sbjct: 121 ENAKIEIDFFFPKREI 136


>gi|218247001|ref|YP_002372372.1| nucleoside diphosphate kinase [Cyanothece sp. PCC 8801]
 gi|218167479|gb|ACK66216.1| Nucleoside-diphosphate kinase [Cyanothece sp. PCC 8801]
          Length = 143

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 55/130 (42%), Positives = 84/130 (64%)

Query: 9   MIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELVQAMI 68
           MIKPD V+R L+G ++   E  G  +V  K   ++++ AE  Y +HK+RPFF  LV+ + 
Sbjct: 1   MIKPDGVQRGLVGEVISRFEAKGFTLVGMKLMQVSKELAEKHYDVHKERPFFKGLVEFIS 60

Query: 69  SGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKTALEE 128
           S PV   V +G+  ++  R+++G T+P  A  GTIR  YG+S+G N IHGSD+++TA  E
Sbjct: 61  SSPVVAMVWEGDGVVASARKLIGATNPLTAEPGTIRGDYGVSVGRNLIHGSDAIETAQTE 120

Query: 129 ISYWFARNEI 138
           I+ WF+  E+
Sbjct: 121 INLWFSSEEL 130


>gi|283955191|ref|ZP_06372693.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           414]
 gi|283793404|gb|EFC32171.1| nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni
           414]
          Length = 137

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 101/137 (73%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAV++ +IG I+   E+ GL + A K   +N++QAE+FY +HK+RPFF +
Sbjct: 1   MEKTLSIIKPDAVRKGVIGKILDRFENNGLRIAAMKKIQLNKEQAENFYAVHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGENAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F  NEI 
Sbjct: 121 ENAKIEIEFFFKSNEIC 137


>gi|157736552|ref|YP_001489235.1| nucleoside diphosphate kinase [Arcobacter butzleri RM4018]
 gi|315635713|ref|ZP_07890976.1| nucleoside diphosphate kinase [Arcobacter butzleri JV22]
 gi|167016275|sp|A8ERJ2|NDK_ARCB4 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|157698406|gb|ABV66566.1| nucleoside diphosphate kinase [Arcobacter butzleri RM4018]
 gi|315480010|gb|EFU70680.1| nucleoside diphosphate kinase [Arcobacter butzleri JV22]
          Length = 137

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 98/137 (71%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV +N++G I+   E  GL + A K   +++  AE FY +H  RPFF +
Sbjct: 1   MEQTLSIIKPDAVAKNVVGKILDRFESAGLKIAATKKLQLSQADAEAFYAVHAARPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+GE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMISGPVVVSVLEGENAMAKNRELMGATNPKEAAAGTIRADFADSIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++FA+ EI 
Sbjct: 121 ENAKNEIAFFFAQREIC 137


>gi|167465852|ref|ZP_02330941.1| Nucleoside diphosphate kinase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 147

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 86/137 (62%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LIG IVK LE  G  ++  K   M + QAE  Y  HKD+PFF E
Sbjct: 1   MEKTFLMVKPDGVQRGLIGEIVKRLEQKGFQMIGCKLFQMTKGQAETHYAEHKDKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPV   V +G++ I+ +R +MG T+   A  GTIR  + +    N IHGSDS 
Sbjct: 61  LVGFITSGPVLAMVWQGDQIIALSRTLMGKTNVMDAAPGTIRGDFALHTSNNLIHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+++F   E++
Sbjct: 121 ESAEREINHFFKPEELV 137


>gi|34498997|ref|NP_903212.1| nucleoside diphosphate kinase [Chromobacterium violaceum ATCC
           12472]
 gi|67460701|sp|Q7NS84|NDK_CHRVO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|34104847|gb|AAQ61204.1| nucleoside-diphosphate kinase [Chromobacterium violaceum ATCC
           12472]
          Length = 141

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/138 (54%), Positives = 101/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N+IG I    E  GL +VAAK   ++R +AE FY +HK+RPFF
Sbjct: 1   MAIERTLSIVKPDAVAKNVIGKIYDRFESAGLKIVAAKMKQLSRAEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPV +Q L+GE A+ KNRE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMVSGPVMIQALEGENAVLKNRELMGATDPKKAEAGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A  E++Y+FA +EI
Sbjct: 121 SVENAAIEVAYFFAASEI 138


>gi|90407087|ref|ZP_01215276.1| Ndk protein [Psychromonas sp. CNPT3]
 gi|90311809|gb|EAS39905.1| Ndk protein [Psychromonas sp. CNPT3]
          Length = 142

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/139 (46%), Positives = 90/139 (64%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T SMIKPDAV + LIG+I+   E   L  VA K   + + QAE FY  H+ + FF
Sbjct: 1   MPLQRTLSMIKPDAVSKMLIGTIIARFEKAQLTPVAIKMLHLTKAQAEGFYAEHQGKGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE  I+  RE++G TDP KAL GTIR  +  S+  N++HGSD
Sbjct: 61  ENLVEFMSSGPILVLVLEGENGIAHYRELIGQTDPAKALAGTIRADFAESLSCNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+F+  EI 
Sbjct: 121 SPASASREIAYFFSDEEIC 139


>gi|52346142|ref|NP_001005115.1| nucleoside diphosphate kinase 3 [Xenopus (Silurana) tropicalis]
 gi|49900051|gb|AAH77052.1| MGC89980 protein [Xenopus (Silurana) tropicalis]
 gi|89268745|emb|CAJ82615.1| non-metastatic cells 3, protein expressed in [Xenopus (Silurana)
           tropicalis]
          Length = 169

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD  +R LIG I++  E  G  +VA K    + +  +  Y+  +D+PF+  L
Sbjct: 22  ERTFLAIKPDGYQRRLIGEIIRRFEKKGFHLVAMKIMQASEQLLKQHYIALQDKPFYDRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +   R ++G+T+P  +L GTIR  + + +G N IHGSDS +
Sbjct: 82  VKYMGSGPVVAMVWQGLDVVKTARLMIGETNPAHSLPGTIRGDFCVDVGRNVIHGSDSRE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SAQREIALWFQPDELV 157


>gi|281203980|gb|EFA78176.1| nucleoside diphosphate kinase [Polysphondylium pallidum PN500]
          Length = 154

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 57/140 (40%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 1   MVI-EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M + E++F  IKPD V RNL+G I+   E  G  +V  K        A+  Y  H +RPF
Sbjct: 1   MSVTERSFIAIKPDGVARNLVGEIIARFERKGFVLVGLKQIVPTADLAKSHYAEHAERPF 60

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           F  LV  + SGPV   V +G+  I+  R ++G T+P  +  GTIR    I +G N IHGS
Sbjct: 61  FGGLVSFITSGPVVAMVWEGKGVIAAARALIGATNPLASAPGTIRGDLAIDVGRNIIHGS 120

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+ +A  EI+ WFA  E++
Sbjct: 121 DSVDSAKREIALWFAETELL 140


>gi|218778249|ref|YP_002429567.1| nucleoside-diphosphate kinase [Desulfatibacillum alkenivorans
           AK-01]
 gi|254767226|sp|B8FH11|NDK_DESAA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|218759633|gb|ACL02099.1| Nucleoside-diphosphate kinase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 138

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 98/138 (71%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKT S+IKPDAV+RNLIG+IVK  ED G+ +VA K   +++ QAE FY +HK+RPF+ E
Sbjct: 1   MEKTLSIIKPDAVERNLIGNIVKRFEDAGIKIVAMKLLKLSKAQAEAFYAVHKERPFYGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   M SGP    +L+GE  I KNRE+MG TDPK+A  GTIR    I   +NS+HGSD+ 
Sbjct: 61  LTDYMSSGPCVPMILEGEGVILKNREIMGATDPKEAAAGTIRADLAIDKEKNSVHGSDAP 120

Query: 123 KTALEEISYWFARNEIIG 140
           +TA +EI+++F   E+ G
Sbjct: 121 ETAAQEIAFFFTEYELAG 138


>gi|222151367|ref|YP_002560523.1| nucleoside-diphosphate kinase [Macrococcus caseolyticus JCSC5402]
 gi|254767238|sp|B9E6K9|NDK_MACCJ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|222120492|dbj|BAH17827.1| nucleoside-diphosphate kinase [Macrococcus caseolyticus JCSC5402]
          Length = 148

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 93/137 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF MIKPD V R LIG IVK +E+ G+ VV AK   ++   A+  Y  H ++PFF E
Sbjct: 1   MEKTFLMIKPDGVGRGLIGEIVKRIENKGIKVVGAKLMTVSEDLAKTHYGEHSEKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  VL+G+  +   R ++G T+P ++  GTIR  +G+++G+N IHGSDS+
Sbjct: 61  LVEFITSGPVFAMVLEGDNVVEIGRTLVGKTNPAESAPGTIRGDFGMTVGKNIIHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
            +A +EI+ WF   EI+
Sbjct: 121 ASADKEIALWFKEEEIL 137


>gi|163759149|ref|ZP_02166235.1| nucleoside diphosphate kinase [Hoeflea phototrophica DFL-43]
 gi|162283553|gb|EDQ33838.1| nucleoside diphosphate kinase [Hoeflea phototrophica DFL-43]
          Length = 140

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 87/140 (62%), Positives = 110/140 (78%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+I K  ED GL +VA+K  WM++++AE FY +HK+RPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAITKVFEDNGLRIVASKRVWMSKREAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI KNRE+MG T+P  A +GTIR  Y +SIGENS+HGSD
Sbjct: 61  GELVEGMTSGPTIVQVLEGENAILKNREIMGATNPADAAEGTIRKTYALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EISYWF+  EI+G
Sbjct: 121 APETAAQEISYWFSGTEIVG 140


>gi|148559468|ref|YP_001258675.1| nucleoside diphosphate kinase [Brucella ovis ATCC 25840]
 gi|166232950|sp|A5VPM8|NDK_BRUO2 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|148370725|gb|ABQ60704.1| nucleoside diphosphate kinase [Brucella ovis ATCC 25840]
          Length = 140

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 88/140 (62%), Positives = 113/140 (80%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA +RNL G+I+ +LE+ GL VVA+K  WM+R++AE FY +HKDRPFF
Sbjct: 1   MAIERTFSMIKPDATRRNLTGAIIAKLEEAGLRVVASKRVWMSRREAEGFYTVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR  + +SIGENS+HGSD
Sbjct: 61  GELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPANADEGTIRKTFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+YWF+  EI+G
Sbjct: 121 APETAAEEIAYWFSGTEIVG 140


>gi|119364621|sp|Q976A0|NDK_SULTO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 147

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 90/139 (64%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TF MIKPD V+RNLIG I+   E  GL ++  K   ++R  AE  Y  HK + FF
Sbjct: 1   MSIQRTFVMIKPDGVRRNLIGEIISRFEKRGLKIIGLKMVKIDRPTAERLYEEHKGKSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL+  + SGPV   V++G+EA+S  R+++G+TDPK+A  GTIR  Y +S  EN IH SD
Sbjct: 61  EELISYITSGPVVCMVIEGDEAVSVVRKMIGNTDPKEAPPGTIRGDYALSKAENVIHASD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  E+S +F   E++
Sbjct: 121 SEEKAKREMSIFFKEEELV 139


>gi|1346672|sp|P47922|NDK1_PEA RecName: Full=Nucleoside diphosphate kinase 1; AltName:
           Full=Nucleoside diphosphate kinase I; Short=NDK I;
           Short=NDP kinase I; Short=NDPK I
 gi|296174|emb|CAA50511.1| nucleoside-diphosphate kinase [Pisum sativum]
          Length = 149

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 54/134 (40%), Positives = 81/134 (60%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TF MIKPD V+R L+G I+   E  G  +   KF  + R  AE  Y     +PFF 
Sbjct: 1   MAEQTFIMIKPDGVQRGLVGEIISRFEKKGFYLKGLKFVNVERAFAEKHYADLSAKPFFS 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  +ISGPV   + +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD+
Sbjct: 61  GLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDA 120

Query: 122 LKTALEEISYWFAR 135
           +++A +EI+ WF  
Sbjct: 121 VESANKEIALWFPE 134


>gi|15888460|ref|NP_354141.1| nucleoside diphosphate kinase [Agrobacterium tumefaciens str. C58]
 gi|325292496|ref|YP_004278360.1| Nucleoside diphosphate kinase [Agrobacterium sp. H13-3]
 gi|22095926|sp|Q8UGB6|NDK_AGRT5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|15156156|gb|AAK86926.1| nucleoside diphosphate kinase [Agrobacterium tumefaciens str. C58]
 gi|325060349|gb|ADY64040.1| Nucleoside diphosphate kinase [Agrobacterium sp. H13-3]
          Length = 140

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 86/140 (61%), Positives = 111/140 (79%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+I K  ED GL +VA+K  WM++++AE FY +HK+RPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAITKVFEDNGLRIVASKRVWMSKREAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI KNRE+MG T+P +A +GTIR  + +SIGENS+HGSD
Sbjct: 61  GELVEGMTSGPTIVQVLEGENAILKNREIMGATNPAQAAEGTIRKSFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA +EI+YWFA  EI+G
Sbjct: 121 APETAAQEIAYWFAETEIVG 140


>gi|159111729|ref|XP_001706095.1| Nucleoside diphosphate kinase [Giardia lamblia ATCC 50803]
 gi|157434188|gb|EDO78421.1| Nucleoside diphosphate kinase [Giardia lamblia ATCC 50803]
          Length = 151

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 80/138 (57%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF M+KPD V+R L+G I+   E  G  +VA KF   ++   E+ Y  H  RPFF
Sbjct: 1   MARERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             L + + SGPV   V +G   +S +R +MG T P ++  GTIR  +GI +G N IHGS 
Sbjct: 61  AGLCKFLSSGPVCAMVWEGANVVSISRTMMGVTKPAESAPGTIRGDFGIDVGRNIIHGSA 120

Query: 121 SLKTALEEISYWFARNEI 138
           +L  A  EI+ WF   E+
Sbjct: 121 NLDDAAREIALWFKPEEV 138


>gi|271501575|ref|YP_003334601.1| Nucleoside-diphosphate kinase [Dickeya dadantii Ech586]
 gi|270345130|gb|ACZ77895.1| Nucleoside-diphosphate kinase [Dickeya dadantii Ech586]
          Length = 142

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV +N IG+I    E  G  ++A+K   ++R+QAE FY  HK +PFF
Sbjct: 1   MTVERTFSIIKPNAVAKNAIGAIYARFESAGFTIIASKMLHLSREQAEGFYAEHKGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+ E A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVDFMTSGPIMVQVLQAENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI+Y+F+ +EI
Sbjct: 121 SVESAEREIAYFFSADEI 138


>gi|285018370|ref|YP_003376081.1| nucleoside diphosphate kinase (ndk) (ndp kinase)(nucleoside-2-p
           kinase) protein [Xanthomonas albilineans GPE PC73]
 gi|283473588|emb|CBA16091.1| probable nucleoside diphosphate kinase (ndk) (ndp
           kinase)(nucleoside-2-p kinase) protein [Xanthomonas
           albilineans]
          Length = 141

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +QVL+GE A++ +RE++G T+PK A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVMIQVLEGENAVAAHRELLGATNPKDAAPGTIRADFADSIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A+ E+SY+FA  E++
Sbjct: 121 SVENAVNEVSYFFAATEVV 139


>gi|325265755|ref|ZP_08132442.1| nucleoside diphosphate kinase [Kingella denitrificans ATCC 33394]
 gi|324982738|gb|EGC18363.1| nucleoside diphosphate kinase [Kingella denitrificans ATCC 33394]
          Length = 144

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 100/138 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL +VAAK   + R++AE FY +HK+RPFF
Sbjct: 1   MAIERTVSIIKPDAVSKNVIGKIYDRFESNGLKIVAAKMKHLTREEAEAFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M+SGPV +QVL+GE A++KNRE+MG T+P+ A +GTIR  +  +  EN++HGSD
Sbjct: 61  NDLVAFMVSGPVMVQVLEGENAVAKNREIMGATNPENAAEGTIRKDFAHNTRENAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           SL+ A  EI ++F   E+
Sbjct: 121 SLENAKIEIDFFFNPEEV 138


>gi|157371848|ref|YP_001479837.1| nucleoside diphosphate kinase [Serratia proteamaculans 568]
 gi|167016280|sp|A8GHW9|NDK_SERP5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|157323612|gb|ABV42709.1| Nucleoside-diphosphate kinase [Serratia proteamaculans 568]
          Length = 141

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 95/139 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++A+K   + R+QAE FY  HK RPFF
Sbjct: 1   MTVERTFSIIKPNAVANNDIGAIYARFERAGFKIIASKMLRLTREQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+ E A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIVVQVLEAENAVQRNRDIMGATNPDNALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++A  EI+Y+F  +EI 
Sbjct: 121 AVESAQREIAYFFNESEIC 139


>gi|187924521|ref|YP_001896163.1| nucleoside diphosphate kinase [Burkholderia phytofirmans PsJN]
 gi|226729784|sp|B2SXT3|NDK_BURPP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|187715715|gb|ACD16939.1| Nucleoside-diphosphate kinase [Burkholderia phytofirmans PsJN]
          Length = 141

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 71/134 (52%), Positives = 96/134 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE AI K+R++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVVVQALEGENAILKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           + +TA  EI+++F 
Sbjct: 121 AAETAAVEIAFFFP 134


>gi|315658248|ref|ZP_07911120.1| nucleoside diphosphate kinase [Staphylococcus lugdunensis M23590]
 gi|315496577|gb|EFU84900.1| nucleoside diphosphate kinase [Staphylococcus lugdunensis M23590]
          Length = 174

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 92/137 (67%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
            +E+TF M+KPDAV+RNLIG+I+  +E+ GL +V AK   ++   AE  Y  HK +PF+ 
Sbjct: 25  TVERTFLMLKPDAVQRNLIGNIISRIENKGLKLVGAKLMTVSTSLAEAHYAEHKGKPFYD 84

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L+  + S PVF  V++GE A++ +R ++G T+P +A  G+IR   G+++G N IHGSDS
Sbjct: 85  GLISFITSAPVFAMVVEGENAVNVSRHIIGQTNPAEAAPGSIRGDLGLTVGRNVIHGSDS 144

Query: 122 LKTALEEISYWFARNEI 138
           L +A  EI  WF  NEI
Sbjct: 145 LASAEREIHLWFDENEI 161


>gi|289596913|ref|YP_003483609.1| Nucleoside-diphosphate kinase [Aciduliprofundum boonei T469]
 gi|289534700|gb|ADD09047.1| Nucleoside-diphosphate kinase [Aciduliprofundum boonei T469]
          Length = 148

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 90/138 (65%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + ++T  ++KPDAV R L+G I+   E  GL +VA K  WM+R++AE  Y +HKD+PF+ 
Sbjct: 1   MKQRTLVLLKPDAVNRRLMGEIISRFEKKGLKIVAMKMLWMSRERAEKHYEVHKDKPFYE 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            L+  + SGP+   VL+G+ AI   R++MG T+  +A  GTIR  + +SI  N +HGSDS
Sbjct: 61  SLIDYITSGPIVAMVLEGDRAIEVVRKMMGKTNGIEAEPGTIRGDFAMSIQNNLVHGSDS 120

Query: 122 LKTALEEISYWFARNEII 139
            ++A  EI  +F  +EI+
Sbjct: 121 EESAKREIPIFFDDSEIL 138


>gi|254282738|ref|ZP_04957706.1| nucleoside diphosphate kinase [gamma proteobacterium NOR51-B]
 gi|219678941|gb|EED35290.1| nucleoside diphosphate kinase [gamma proteobacterium NOR51-B]
          Length = 141

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 96/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S++KPDAV +N+IG I    E  GL +VAAK   ++  +A  FY  H+ RPFF
Sbjct: 1   MAVERTLSIVKPDAVGKNVIGEIYSRFEKNGLAIVAAKMVQLDATRAGGFYAEHRGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +L+  M SGPV +QVL+GE AI+KNRE+MG T+P+ A  GTIR  +  SI  N++HGSD
Sbjct: 61  DDLITFMTSGPVMIQVLEGEGAIAKNRELMGATNPQDADAGTIRADFAQSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S  +A  EI+Y+FA +++ 
Sbjct: 121 SAASAEREIAYFFAASDLC 139


>gi|330795043|ref|XP_003285585.1| hypothetical protein DICPUDRAFT_97095 [Dictyostelium purpureum]
 gi|325084498|gb|EGC37925.1| hypothetical protein DICPUDRAFT_97095 [Dictyostelium purpureum]
          Length = 152

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 57/141 (40%), Positives = 83/141 (58%), Gaps = 2/141 (1%)

Query: 1   MVI--EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRP 58
           M +  E+TF  +KPD V R L+G I+   E  G  VV  K     ++ AE  Y  HK+RP
Sbjct: 1   MSVQRERTFIAVKPDGVARGLVGEIIARFEKKGFVVVGLKQLTPTKELAEAHYAEHKERP 60

Query: 59  FFPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHG 118
           FF  LV  + SGPV    L+G+  ++  R ++G T+P  +  GTIR  Y I + +N IHG
Sbjct: 61  FFGGLVSFITSGPVVAICLEGKGVVAAARLMIGVTNPLASAPGTIRGDYAIDVAKNIIHG 120

Query: 119 SDSLKTALEEISYWFARNEII 139
           SDS++++  E+  WFA NE++
Sbjct: 121 SDSVESSTRELKLWFADNELL 141


>gi|149177235|ref|ZP_01855841.1| nucleoside diphosphate kinase (NDK) [Planctomyces maris DSM 8797]
 gi|148843949|gb|EDL58306.1| nucleoside diphosphate kinase (NDK) [Planctomyces maris DSM 8797]
          Length = 155

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 85/139 (61%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T  +IKPDA++R L G+I+   E+ GL +V  K   + ++ A + Y  H ++PF+
Sbjct: 1   MALERTLILIKPDAIQRRLAGTILTRFENKGLKIVGLKLLQVTKELAAEHYAEHVEKPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L + + +GPV   V +G EAI+  R +MG T+ +++  GTIR  YGIS   N +HGSD
Sbjct: 61  PLLEEFITAGPVVAIVAEGPEAITVVRSMMGSTNGRESAPGTIRGDYGISRQMNLVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
             + A  EI  +F   E+I
Sbjct: 121 GPEAATREIKIYFKPEELI 139


>gi|238758831|ref|ZP_04620004.1| Nucleoside diphosphate kinase [Yersinia aldovae ATCC 35236]
 gi|238702939|gb|EEP95483.1| Nucleoside diphosphate kinase [Yersinia aldovae ATCC 35236]
          Length = 141

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 98/139 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV +N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MALERTFSIIKPNAVAKNNIGAIYARFESAGFKIIAAKMLKLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  +  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFSESFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           ++++AL EI+Y+F  +EI 
Sbjct: 121 AVESALREIAYFFTESEIC 139


>gi|260435440|ref|ZP_05789410.1| nucleoside diphosphate kinase [Synechococcus sp. WH 8109]
 gi|260413314|gb|EEX06610.1| nucleoside diphosphate kinase [Synechococcus sp. WH 8109]
          Length = 170

 Score =  171 bits (433), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  IKPD V+R L+G I+   E  G  +V  K    +R  AE  Y +HK+RPFF
Sbjct: 20  MA-ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEQHYGVHKERPFF 78

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  + SGPV   V +G+  I+  R+++G T P +A  GTIR    ++IG N IHGSD
Sbjct: 79  AGLVDFITSGPVVAMVWEGDGVIASARKLIGATKPLEAEPGTIRGDLAVNIGRNVIHGSD 138

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  EI  WF  +E+
Sbjct: 139 AAETAAFEIGLWFEASEL 156


>gi|322381821|ref|ZP_08055775.1| nucleoside diphosphate kinase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154209|gb|EFX46531.1| nucleoside diphosphate kinase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 171

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 62/139 (44%), Positives = 87/139 (62%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           + +EKTF M+KPD V+R LIG IVK LE  G  ++  K   M + QAE  Y  HKD+PFF
Sbjct: 23  INMEKTFLMVKPDGVQRGLIGEIVKRLEQKGFQMIGCKLFQMTKGQAETHYAEHKDKPFF 82

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  + SGPV   V +G++ I+ +R +MG T+   A  GTIR  + +    N IHGSD
Sbjct: 83  GELVGFITSGPVLAMVWQGDQIIALSRTLMGKTNVMDAAPGTIRGDFALHTSNNLIHGSD 142

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+++F   E++
Sbjct: 143 SPESAEREINHFFKPEELV 161


>gi|269468800|gb|EEZ80404.1| nucleoside diphosphate kinase [uncultured SUP05 cluster bacterium]
          Length = 141

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 96/137 (70%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV +N+IG I    E  G  +VAAK   ++   A  FY +HKDRPF+ +
Sbjct: 1   MERTLSIIKPDAVAKNVIGQIYSRFESAGFKIVAAKMLHLDSDLAGGFYAVHKDRPFYND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV +QVL+G+ A++K+RE+MG T+PK+A  GTIR  +  S+ EN++HGSDS 
Sbjct: 61  LVEFMTSGPVMVQVLEGDNAVAKHREIMGATNPKEADAGTIRADFANSLDENAVHGSDSA 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI Y+F ++ + 
Sbjct: 121 ENAAIEIEYFFGKDGVC 137


>gi|50980820|gb|AAT91256.1| nucleoside diphosphate kinase [Paxillus involutus]
          Length = 152

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 55/134 (41%), Positives = 82/134 (61%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
             E+T+ M+KPD V R LIG I+   E  G  ++AAK    +++  E  Y   KD+PFFP
Sbjct: 4   AAERTYIMLKPDGVDRGLIGEILARFEKRGFKLIAAKLALPSKEHLEKHYADLKDKPFFP 63

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            +++ M SGPVF  V +G +A+   R ++G T+P  +  GTIR  Y +++G N  HGSDS
Sbjct: 64  GMIKYMQSGPVFCMVFEGLDAVKTGRAMLGATNPLASQPGTIRGDYALAVGRNICHGSDS 123

Query: 122 LKTALEEISYWFAR 135
           ++ A +EI+ WF  
Sbjct: 124 VENAEKEIALWFPD 137


>gi|50083793|ref|YP_045303.1| nucleoside diphosphate kinase [Acinetobacter sp. ADP1]
 gi|67460667|sp|Q6FEM7|NDK_ACIAD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|49529769|emb|CAG67481.1| nucleoside diphosphate kinase (NDK) (NDP kinase) (Nucleoside-2-P
           kinase) [Acinetobacter sp. ADP1]
          Length = 143

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/138 (49%), Positives = 95/138 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N IG I+   E  GL  VA K+  +++ +AE FY  HK+R FF
Sbjct: 1   MAVERTLSIIKPDAVGKNHIGEIIARFEKAGLKPVAMKYKHLSQAEAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +  L+GE A+  +RE++G T+PK+A  GTIR  +  SI EN+ HGSD
Sbjct: 61  ADLVAFMTSGPVVVSALEGENAVLAHREILGATNPKEAAPGTIRADFATSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+ +A  EI+Y+FA +EI
Sbjct: 121 SVASAEREIAYFFAADEI 138


>gi|307132064|ref|YP_003884080.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Dickeya dadantii
           3937]
 gi|306529593|gb|ADM99523.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Dickeya dadantii
           3937]
          Length = 143

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV +N IG+I    E  G  ++A+K   ++R+QAE FY  H+ +PFF
Sbjct: 1   MTVERTFSIIKPNAVAKNAIGAIYARFESAGFTIIASKMLHLSREQAEGFYAEHQGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGP+ +QVL+ E A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVDFMTSGPIMVQVLQAENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+++A  EI+Y+F+ +E+
Sbjct: 121 SVESAEREIAYFFSADEV 138


>gi|85709215|ref|ZP_01040281.1| nucleoside diphosphate kinase [Erythrobacter sp. NAP1]
 gi|85690749|gb|EAQ30752.1| nucleoside diphosphate kinase [Erythrobacter sp. NAP1]
          Length = 140

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 80/140 (57%), Positives = 111/140 (79%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M + +TFS+IKPDA KRNL G++ K+LE+ GL VVA+K   M R+QAE FY +HK+RPFF
Sbjct: 1   MAVTRTFSIIKPDATKRNLTGAVTKKLEEAGLRVVASKRIHMTREQAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M+S PV +QVL+GE+A+ +NR+VMG T+P +A +GTIR +Y +SIGENS+HGSD
Sbjct: 61  GELVEFMMSEPVVVQVLEGEDAVKRNRDVMGATNPAEADEGTIRKEYALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+++F  +EI+G
Sbjct: 121 SEENAAIEIAFFFNDDEIVG 140


>gi|15602893|ref|NP_245965.1| nucleoside diphosphate kinase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|18202822|sp|Q9CM17|NDK_PASMU RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|12721360|gb|AAK03112.1| Ndk [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 139

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 70/138 (50%), Positives = 92/138 (66%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAVKR+LIG+I+   E  G  VVAAK   + + QAE FY  H+D+ FF
Sbjct: 1   MAVERTLSLIKPDAVKRHLIGAILSRFEQAGFRVVAAKMLHLTQAQAEGFYAEHQDKAFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           PELV  MIS PV   VL+ E A+   R ++G T+P  A +GTIR  + I    NS+HGSD
Sbjct: 61  PELVAYMISAPVLALVLEKENAVKDYRTLIGATNPAVAAEGTIRRDFAIDGRHNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           SL +A  EI+Y+F  +EI
Sbjct: 121 SLDSAKREIAYFFVESEI 138


>gi|331695819|ref|YP_004332058.1| Nucleoside diphosphate kinase [Pseudonocardia dioxanivorans CB1190]
 gi|326950508|gb|AEA24205.1| Nucleoside diphosphate kinase [Pseudonocardia dioxanivorans CB1190]
          Length = 136

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+T  ++KPD V+R LIG ++  +E  GL +VA     ++R+ A   Y  H  +PFF 
Sbjct: 1   MTERTLVLVKPDGVERRLIGEVISRIERKGLTLVALDLRTVDRELASQHYAEHDGKPFFE 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDP-KKALKGTIRNKYGISIGENSIHGSD 120
            L++ + SGPV   V +G  AIS  R++ G TDP +KA  G+IR  +G+ +  N +HGSD
Sbjct: 61  SLLEFITSGPVLAAVAEGPRAISAWRQLAGGTDPVEKAAPGSIRGDFGLEVQYNLVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S ++A  EI  WF  
Sbjct: 121 SPESAAREIKLWFPN 135


>gi|320161273|ref|YP_004174497.1| nucleoside diphosphate kinase [Anaerolinea thermophila UNI-1]
 gi|319995126|dbj|BAJ63897.1| nucleoside diphosphate kinase [Anaerolinea thermophila UNI-1]
          Length = 152

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF ++KPD V+R LIG ++  LE  GL +V AKF  ++RK AE+ Y +HK +PF+  
Sbjct: 1   MEQTFVLVKPDGVQRGLIGEVIARLERRGLKLVGAKFLHVSRKLAEEHYAVHKGKPFYEG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PV   V +G  A++  R+ MG T P +A  GTIR+ +G+++  N  H SDS+
Sbjct: 61  LINYITSAPVMAMVWEGPNAVAVVRQTMGATRPYEAAPGTIRHDFGLTVSRNLTHASDSV 120

Query: 123 KTALEEISYWFARNEII 139
           + A+ EI+ WF   E++
Sbjct: 121 ENAIAEITLWFKPEELV 137


>gi|148222335|ref|NP_001087358.1| nucleoside diphosphate kinase 3 [Xenopus laevis]
 gi|51873806|gb|AAH78612.1| MGC85572 protein [Xenopus laevis]
          Length = 169

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 83/136 (61%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD  +R L+G I++  E  G  +VA K    + K  +  Y+  +D+PF+  L
Sbjct: 22  ERTFLAIKPDGYQRRLLGEIIRRFEKKGFRLVAMKIVQASEKLLKQHYIALQDKPFYDRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   V +G + +   R ++G+T+P  +L GTIR  + I +G N IHGSDS +
Sbjct: 82  VKYMGSGPVVAMVWQGLDVVKTARLMIGETNPAHSLPGTIRGDFCIDVGRNVIHGSDSRE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SAEREIALWFQPDELV 157


>gi|307729246|ref|YP_003906470.1| Nucleoside-diphosphate kinase [Burkholderia sp. CCGE1003]
 gi|323526581|ref|YP_004228734.1| Nucleoside-diphosphate kinase [Burkholderia sp. CCGE1001]
 gi|307583781|gb|ADN57179.1| Nucleoside-diphosphate kinase [Burkholderia sp. CCGE1003]
 gi|323383583|gb|ADX55674.1| Nucleoside-diphosphate kinase [Burkholderia sp. CCGE1001]
          Length = 141

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/134 (53%), Positives = 98/134 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE AI K+R++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVEFMISGPVVVQVLEGENAILKHRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           + +TA  EI+++F 
Sbjct: 121 AAETAAVEIAFFFP 134


>gi|332844984|ref|XP_523261.3| PREDICTED: nucleoside diphosphate kinase 3 [Pan troglodytes]
          Length = 169

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 78/136 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G IV+  E  G  +VA K    + +   + Y   ++RPF+  L
Sbjct: 22  ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
                      QV +G + +  +R ++G T+P  A  GTIR  + I +G+N IHGSDS++
Sbjct: 82  XXXXXXXXXXAQVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVE 141

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF  +E++
Sbjct: 142 SARREIALWFRADELL 157


>gi|296113051|ref|YP_003626989.1| nucleoside diphosphate kinase [Moraxella catarrhalis RH4]
 gi|295920745|gb|ADG61096.1| nucleoside diphosphate kinase [Moraxella catarrhalis RH4]
 gi|326560427|gb|EGE10809.1| nucleoside diphosphate kinase [Moraxella catarrhalis 7169]
 gi|326561631|gb|EGE11968.1| nucleoside diphosphate kinase [Moraxella catarrhalis 103P14B1]
 gi|326562594|gb|EGE12905.1| nucleoside diphosphate kinase [Moraxella catarrhalis 46P47B1]
 gi|326564030|gb|EGE14274.1| nucleoside diphosphate kinase [Moraxella catarrhalis 12P80B1]
 gi|326565838|gb|EGE16000.1| nucleoside diphosphate kinase [Moraxella catarrhalis BC1]
 gi|326570493|gb|EGE20533.1| nucleoside diphosphate kinase [Moraxella catarrhalis BC8]
 gi|326571176|gb|EGE21200.1| nucleoside diphosphate kinase [Moraxella catarrhalis BC7]
 gi|326573467|gb|EGE23435.1| nucleoside diphosphate kinase [Moraxella catarrhalis 101P30B1]
 gi|326575635|gb|EGE25558.1| nucleoside diphosphate kinase [Moraxella catarrhalis CO72]
 gi|326577099|gb|EGE26993.1| nucleoside diphosphate kinase [Moraxella catarrhalis O35E]
          Length = 143

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 67/138 (48%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N IG I+   E  GL  VA K+  +++  AE FY  HK+R FF
Sbjct: 1   MAIERTLSIIKPDAVGKNHIGDIIARFEKAGLKPVAMKYKHLSQADAEGFYAEHKERGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+  +RE++G T+P++A +GTIR  + +SI EN+ HGSD
Sbjct: 61  GDLVSFMTSGPVVVSVLEGENAVLAHREILGATNPQEAAQGTIRADFAVSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S+ +A  EI+Y+F  +E+
Sbjct: 121 SVASAEREIAYFFGDDEV 138


>gi|254449212|ref|ZP_05062661.1| nucleoside-diphosphate kinase [gamma proteobacterium HTCC5015]
 gi|198261189|gb|EDY85485.1| nucleoside-diphosphate kinase [gamma proteobacterium HTCC5015]
          Length = 143

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/136 (50%), Positives = 98/136 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL +VAAK   ++ ++A  FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAKNVIGEIYSRFEKAGLQIVAAKMVHLSDEEAGAFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+G+ AI+KNR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVGFMTSGPVMVQVLEGDNAIAKNRDLMGATNPKEAEAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARN 136
           + +TA +EI ++F+  
Sbjct: 121 AAETAAQEIQFFFSGE 136


>gi|186476181|ref|YP_001857651.1| nucleoside diphosphate kinase [Burkholderia phymatum STM815]
 gi|226729783|sp|B2JIV4|NDK_BURP8 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|184192640|gb|ACC70605.1| Nucleoside-diphosphate kinase [Burkholderia phymatum STM815]
          Length = 141

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 98/135 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VA++   ++R  AE FY +H  RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVASRMVHLSRADAEKFYAVHAARPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE AI KNR++MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 61  KDLVEFMISGPVQVQVLEGEGAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           + +TA  E++++F  
Sbjct: 121 APETAAVEVAFFFPE 135


>gi|148263643|ref|YP_001230349.1| nucleoside diphosphate kinase [Geobacter uraniireducens Rf4]
 gi|189029041|sp|A5GEC1|NDK_GEOUR RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|146397143|gb|ABQ25776.1| nucleoside diphosphate kinase [Geobacter uraniireducens Rf4]
          Length = 137

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 61/137 (44%), Positives = 94/137 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF++IKPDAV+RN+ G ++ ++E  G  +V  K   + + +AE FY +HK+RPFF +
Sbjct: 1   MERTFAIIKPDAVERNITGKVLDKIEGAGFKIVGMKKIHLTKNEAEGFYYVHKERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   M   PV +  L+ E AI+  RE+MG T+P  A  GTIR  +G+SI EN++HGSDS 
Sbjct: 61  LCTFMSRNPVVVLALEKENAIAAWRELMGATNPANAEAGTIRKDFGVSIEENTVHGSDSP 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI Y+F++ E++
Sbjct: 121 ESAAFEIPYFFSQLELV 137


>gi|162147798|ref|YP_001602259.1| nucleoside diphosphate kinase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|189029042|sp|A9HJV3|NDK_GLUDA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|161786375|emb|CAP55957.1| Nucleoside diphosphate kinase [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 140

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA +RNL G I    ED GL +VA K   ++  +A  FY +HKDRPF+
Sbjct: 1   MATERTLSIIKPDATRRNLTGKINAVFEDAGLRIVAQKRVQLSEAEAGAFYAVHKDRPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  M+SGPV LQVL+GE A+ K+R+VMG TDPKKA  GT+R ++  SI  NS+HGSD
Sbjct: 61  GELVSFMVSGPVVLQVLEGENAVLKHRDVMGATDPKKAAPGTVRAQFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+++FA+ EI+
Sbjct: 121 SLENANTEIAFFFAQTEIL 139


>gi|261377751|ref|ZP_05982324.1| nucleoside diphosphate kinase [Neisseria cinerea ATCC 14685]
 gi|269146036|gb|EEZ72454.1| nucleoside diphosphate kinase [Neisseria cinerea ATCC 14685]
          Length = 141

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E+ GL +VAAK   +  K+A++FY IHK+RPF+
Sbjct: 1   MAIERTVSIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAIHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M SGPV +QVL+GE A+ KNRE+MG T+P +A +GTIR  +  S+  N++HGSD
Sbjct: 61  AKLVEFMTSGPVMIQVLEGENAVLKNRELMGATNPAEAAEGTIRADFATSVSINAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  EI+Y+F++ EI 
Sbjct: 121 STENAALEIAYFFSQTEIC 139


>gi|296445847|ref|ZP_06887799.1| Nucleoside-diphosphate kinase [Methylosinus trichosporium OB3b]
 gi|296256675|gb|EFH03750.1| Nucleoside-diphosphate kinase [Methylosinus trichosporium OB3b]
          Length = 140

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 81/140 (57%), Positives = 104/140 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDA KRNL G I   +ED GL +VA K   M R+QAE FY +HK+RPFF
Sbjct: 1   MAIERTFSIIKPDATKRNLTGKINALIEDAGLRIVAQKRIRMTREQAETFYGVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL++++ SGPV +QVL+GE AI K R VMG T+P  A  GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELIESITSGPVVVQVLEGEGAILKYRTVMGATNPASADPGTIRKEFAVSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI  +F+ NEI+G
Sbjct: 121 APETAAIEIPQFFSGNEIVG 140


>gi|14548112|sp|Q9UZ13|NDK_PYRAB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
          Length = 159

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 56/138 (40%), Positives = 83/138 (60%), Gaps = 3/138 (2%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T  +IKPDAV R LIG I+   E  GL +V  K  W++++ AE  Y  H+++PFF  L
Sbjct: 7   ERTLVIIKPDAVIRGLIGEIISRFEKRGLKIVGMKMIWISKELAEKHYAEHREKPFFKSL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGSD 120
           V+ +   PV + V++G  AI   R++ G TDPK A  GTIR  + + + +   N +H SD
Sbjct: 67  VEYITRTPVVVMVVEGRCAIEVVRKMAGATDPKNAEPGTIRGDFALEVSDAICNVVHASD 126

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI  +F  +EI
Sbjct: 127 SKESAEREIKLYFRDDEI 144


>gi|114669522|ref|XP_511889.2| PREDICTED: similar to NME1-NME2 protein [Pan troglodytes]
          Length = 352

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 1/140 (0%)

Query: 1   MV-IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPF 59
           M  +E+TF  IKPD V+R L+G I+K  E  G  +VA KF      +        K++ F
Sbjct: 201 MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRTLSPKTNQNNTPKKEQSF 260

Query: 60  FPELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGS 119
           +  L     S  V + V +G   +   R ++G+T+P  +  GTIR  + I +G N IHGS
Sbjct: 261 YWPLSPFFTSSSVLMAVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNVIHGS 320

Query: 120 DSLKTALEEISYWFARNEII 139
           DS+K+A +EIS WF   E++
Sbjct: 321 DSVKSAEKEISLWFKPEELV 340



 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 63/110 (57%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  IKPD V+R L+G I+K  E  G  +V  KF   +    ++ Y+  KDRPFF  L
Sbjct: 90  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGL 149

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE 113
           V+ M SGPV   V +G   +   R ++G+T+P  +  GTIR  + I +G 
Sbjct: 150 VKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR 199


>gi|209694314|ref|YP_002262242.1| nucleoside diphosphate kinase [Aliivibrio salmonicida LFI1238]
 gi|226724549|sp|B6EGY3|NDK_ALISL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|208008265|emb|CAQ78410.1| nucleoside diphosphate kinase [Aliivibrio salmonicida LFI1238]
          Length = 144

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 102/139 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAVKRNLIG+I + +E  G+ VVAAK   + ++QA+ FY  H+ + FF
Sbjct: 1   MTIERTFSIVKPDAVKRNLIGAIYRRIEKTGMQVVAAKMLSLTKEQAQGFYAEHEGKEFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE  I++ RE+MG T+P +A  G++R+ Y IS+  NS+HGSD
Sbjct: 61  DALVEYMTSGPVMVQVLEGESVITRYRELMGKTNPDEAACGSLRSDYAISMRYNSVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S ++A  EI+Y+F  +EI 
Sbjct: 121 SPESAAREIAYFFVEDEIC 139


>gi|121593578|ref|YP_985474.1| nucleoside diphosphate kinase [Acidovorax sp. JS42]
 gi|166232941|sp|A1W573|NDK_ACISJ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|120605658|gb|ABM41398.1| nucleoside diphosphate kinase [Acidovorax sp. JS42]
          Length = 141

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I    E  GL + AA+   ++R +AE FY +HK+RPFF
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGQIYARFEAAGLKIAAARMIHLSRAEAEQFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +Q L+GE A+ KNRE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVDFMISGPVMVQALEGENAVLKNRELMGATDPKKAAPGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           + +TA  E++++F    I
Sbjct: 121 AAETAQVEVAFFFPGLNI 138


>gi|318206757|ref|NP_001187567.1| nucleoside diphosphate kinase 3 [Ictalurus punctatus]
 gi|308323379|gb|ADO28826.1| nucleoside diphosphate kinase 3 [Ictalurus punctatus]
          Length = 152

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 82/131 (62%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R L+G I++  E  G  +   KF   + ++  + Y   +++PF+  L
Sbjct: 22  ERTFIAVKPDGVQRKLVGEIIRRFERKGFKLAGLKFLQASEEKLREHYWELREKPFYKGL 81

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGP+   V +G + +  +R+++G+T+P  +L GTIR  Y + +G N +HGSDS++
Sbjct: 82  VKYMSSGPIVAMVWQGLDVVKTSRKMLGETNPADSLPGTIRGDYSVEVGRNIVHGSDSVE 141

Query: 124 TALEEISYWFA 134
           +A  EIS WF 
Sbjct: 142 SAQREISLWFK 152


>gi|328544005|ref|YP_004304114.1| Nucleoside diphosphate kinase [polymorphum gilvum SL003B-26A1]
 gi|326413749|gb|ADZ70812.1| Nucleoside diphosphate kinase [Polymorphum gilvum SL003B-26A1]
          Length = 140

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 88/140 (62%), Positives = 111/140 (79%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+I   LE+ GL VVA+K  WM+++QAE FY +HKDRPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAITAMLEEAGLRVVASKRVWMSQRQAEAFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGP  +QVL+GE AI++NREVMG T+P  A +GTIR KY +SIGENS+HGSD
Sbjct: 61  GELTEFMSSGPTVVQVLEGENAIARNREVMGATNPANAEEGTIRKKYALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           +  TA EEI++WF+ +EI+G
Sbjct: 121 AADTAAEEIAFWFSGSEIVG 140


>gi|319786997|ref|YP_004146472.1| nucleoside-diphosphate kinase [Pseudoxanthomonas suwonensis 11-1]
 gi|317465509|gb|ADV27241.1| Nucleoside-diphosphate kinase [Pseudoxanthomonas suwonensis 11-1]
          Length = 141

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N+IG I    E  GL VVAAK+  ++R++AE FY +H++RPFF
Sbjct: 1   MALERTLSIIKPDAVAKNVIGEIYTRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ MISGPV +QVL+GE A+ K+RE++G T+PK+A  GTIR  +  SI  N+ HGSD
Sbjct: 61  NALVEFMISGPVMIQVLEGENAVLKHRELLGATNPKEAAPGTIRADFAESIDANAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S++ A  E++Y+FA  E++
Sbjct: 121 SVENAAIEVAYFFAATEVV 139


>gi|227112691|ref|ZP_03826347.1| nucleoside diphosphate kinase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328681|ref|ZP_03832705.1| nucleoside diphosphate kinase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 142

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 99/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KP+AV +N IG+I    E  G  +VAAK   ++R+QAE FY  HK +PFF
Sbjct: 1   MTIERTFSIVKPNAVAKNAIGAIYARFESAGFTIVAAKMLRLSREQAEGFYAEHKGKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M+SGP+ +QVL+ E A+ +NR++MG T+P  AL GT+R  Y  S   N++HGSD
Sbjct: 61  DGLVEFMMSGPIMVQVLESENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+Y+F+ +EI 
Sbjct: 121 SIESAQREIAYFFSDDEIC 139


>gi|149183311|ref|ZP_01861751.1| nucleoside diphosphate kinase [Bacillus sp. SG-1]
 gi|148848969|gb|EDL63179.1| nucleoside diphosphate kinase [Bacillus sp. SG-1]
          Length = 148

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 89/137 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LI   V   E  G  +  AK   ++++ AE+ Y  HK+RPFF E
Sbjct: 1   MEKTFLMVKPDGVQRGLIAEFVSRFEKKGFQLAGAKLMSISKELAEEHYGEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+PK A  GTIR  +GI++G+N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWQGENVIATARQMMGATNPKDAAPGTIRGDFGITVGKNVIHGSDSA 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F   E++
Sbjct: 121 ESAEREIGLFFKDEELV 137


>gi|32266176|ref|NP_860208.1| nucleoside diphosphate kinase [Helicobacter hepaticus ATCC 51449]
 gi|38372265|sp|Q7VIC9|NDK_HELHP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|32262226|gb|AAP77274.1| nucleoside diphosphate kinase [Helicobacter hepaticus ATCC 51449]
          Length = 137

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 94/137 (68%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAVK+ +IG I+   E   L + A K   + R  AE FY IHK+RPFF +
Sbjct: 1   MEQTLSIIKPDAVKKGVIGKIIDRFESNNLRICAMKKLQLTRCDAEAFYAIHKERPFFKD 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  MISGPV + VL+G  A+ KNR++MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVDFMISGPVVVMVLEGNNAVMKNRDLMGATNPKEAEAGTIRADFAQSIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI+++F+  EI 
Sbjct: 121 ENAKNEIAFFFSTREIC 137


>gi|88799902|ref|ZP_01115474.1| nucleoside diphosphate kinase [Reinekea sp. MED297]
 gi|88777333|gb|EAR08536.1| nucleoside diphosphate kinase [Reinekea sp. MED297]
          Length = 141

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/138 (54%), Positives = 101/138 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAV R+LIG +    E  GL +VA+K   M ++QAE FY  HK+RPFF
Sbjct: 1   MAIERTFSIVKPDAVARDLIGKVYSRFESAGLKIVASKMIHMTKEQAEGFYGEHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P LV+ M SGPV +QVL+G+ AI+KNRE+MG T+P +A  GTIR+ +  SI  NS+HGSD
Sbjct: 61  PNLVEFMTSGPVMVQVLEGDNAIAKNREIMGATNPAEAAAGTIRHDFAKSIDANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           +  +A  EI+Y+F  +EI
Sbjct: 121 APASAAREIAYFFEESEI 138


>gi|311030285|ref|ZP_07708375.1| nucleoside diphosphate kinase [Bacillus sp. m3-13]
          Length = 148

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+RNLIG IV   E  G  +V AK   +  + AE+ Y  HK+RPFF E
Sbjct: 1   MEKTFLMVKPDGVQRNLIGEIVSRFEKKGFQLVGAKLMQIPTELAEEHYGEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  V +GE  I+  R +MG T+PK A  GTIR +YG+ +G+N IHGSDS 
Sbjct: 61  LVEFITSGPVFAMVWQGENVIATARHMMGATNPKDAAPGTIRGEYGVIVGKNIIHGSDSS 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F    ++
Sbjct: 121 ESAEREIGLFFKGEGLV 137


>gi|71277786|ref|YP_270906.1| nucleoside diphosphate kinase [Colwellia psychrerythraea 34H]
 gi|92090381|sp|Q47WB6|NDK_COLP3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|71143526|gb|AAZ23999.1| nucleoside diphosphate kinase [Colwellia psychrerythraea 34H]
          Length = 143

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 100/139 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDAV +N IG I    E  GL +VA+K   +++++AE FY  H +RPFF
Sbjct: 1   MAIERTFSIVKPDAVAKNFIGQIYNRFETAGLKIVASKMIHLSQEKAEGFYAEHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGPV +QVL+GE A+ KNRE+MG T+P +AL GTIR     SI EN+ HGSD
Sbjct: 61  GALVEFMTSGPVMVQVLEGENAVLKNREIMGATNPAEALAGTIRADLADSIDENAAHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           +L++A  EI+Y+F+ +EI 
Sbjct: 121 ALESAAREIAYFFSDDEIC 139


>gi|253996235|ref|YP_003048299.1| Nucleoside-diphosphate kinase [Methylotenera mobilis JLW8]
 gi|253982914|gb|ACT47772.1| Nucleoside-diphosphate kinase [Methylotenera mobilis JLW8]
          Length = 135

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 96/135 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++T S+IKPDAV +N+IG I    E+ GL +V AK   + + +AE FY +HK+RPFF
Sbjct: 1   MAVQRTLSIIKPDAVAKNVIGKIYTRFENAGLKIVEAKMAQLTQAEAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ M+SGPV +Q L+GE A+  NR++MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  ADLVKFMVSGPVMIQALEGENAVQVNRDLMGATNPKEAAAGTIRADFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S + A  EI+Y+F +
Sbjct: 121 SAENAAIEIAYFFGK 135


>gi|319775191|ref|YP_004137679.1| nucleoside diphosphate kinase [Haemophilus influenzae F3047]
 gi|329122887|ref|ZP_08251458.1| nucleoside diphosphate kinase [Haemophilus aegyptius ATCC 11116]
 gi|317449782|emb|CBY85989.1| nucleoside diphosphate kinase [Haemophilus influenzae F3047]
 gi|327471818|gb|EGF17258.1| nucleoside diphosphate kinase [Haemophilus aegyptius ATCC 11116]
          Length = 140

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 93/137 (67%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFFA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVDYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           ++ A  EI+Y+F   EI
Sbjct: 121 IENANREIAYFFTDCEI 137


>gi|237745508|ref|ZP_04575988.1| nucleoside diphosphate kinase [Oxalobacter formigenes HOxBLS]
 gi|229376859|gb|EEO26950.1| nucleoside diphosphate kinase [Oxalobacter formigenes HOxBLS]
          Length = 180

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S++KPDAV +N+IG I    E+ GL +VAA+   ++R  AE FY +HKDRPFF
Sbjct: 40  MAVERTLSIVKPDAVAKNVIGKIYSRFEEAGLKIVAARMLQLSRADAEGFYAVHKDRPFF 99

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV+ MISGPV +QVL+GE AI+KNRE+MG TDPKKA KGTIR  +  SI  N++HGSD
Sbjct: 100 KDLVEFMISGPVMVQVLEGENAIAKNRELMGATDPKKADKGTIRADFADSIDANAVHGSD 159

Query: 121 SLKTALEEISYWFARNEII 139
           + +TA  EI+Y+F   ++ 
Sbjct: 160 APETAAVEIAYFFPSMQVC 178


>gi|319651347|ref|ZP_08005476.1| nucleoside diphosphate kinase [Bacillus sp. 2_A_57_CT2]
 gi|317396878|gb|EFV77587.1| nucleoside diphosphate kinase [Bacillus sp. 2_A_57_CT2]
          Length = 148

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/131 (49%), Positives = 88/131 (67%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+RNLIG IV   E  G  +V  K   ++++ AE+ Y  HK+RPFF E
Sbjct: 1   MERTFLMVKPDGVQRNLIGEIVSRFEKKGFQLVGGKLMSISKELAEEHYGEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+PK A  GTIR  +GI++G+N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGENVIATARQMMGSTNPKDAAPGTIRGDFGITVGKNVIHGSDSP 120

Query: 123 KTALEEISYWF 133
            +A  EI  +F
Sbjct: 121 ASAEREIGLFF 131


>gi|186896256|ref|YP_001873368.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis PB1/+]
 gi|238797960|ref|ZP_04641450.1| Nucleoside diphosphate kinase [Yersinia mollaretii ATCC 43969]
 gi|226729877|sp|B2K9Q4|NDK_YERPB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|186699282|gb|ACC89911.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis PB1/+]
 gi|238718165|gb|EEQ09991.1| Nucleoside diphosphate kinase [Yersinia mollaretii ATCC 43969]
          Length = 142

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MALERTFSIIKPNAVANNNIGAIYARFESAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  +  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           ++++A  EI+Y+FA +EI
Sbjct: 121 AVESAQREIAYFFAADEI 138


>gi|89892948|ref|YP_516435.1| hypothetical protein DSY0202 [Desulfitobacterium hafniense Y51]
 gi|119372026|sp|Q251Q1|NDK_DESHY RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|89332396|dbj|BAE81991.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 149

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 82/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPDAV+R L+G I+   E  G  +V  K   +++  AE  Y  HK + FF  
Sbjct: 1   MEKTFIMLKPDAVQRGLVGQIIARFETKGCKLVGMKLMSVDQALAEQHYAEHKGKSFFEP 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
            VQ ++S PV   V +G+  ++  RE+MG T+P  A  G+IR  +G+ I  N IHGSDS+
Sbjct: 61  TVQYIMSSPVVAMVWEGKNVVALARELMGATNPANANPGSIRGSFGMDISRNVIHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
            +A  EI+ +F   E+ 
Sbjct: 121 ASAEREIALYFRPEELC 137


>gi|14521543|ref|NP_127019.1| nucleoside diphosphate kinase [Pyrococcus abyssi GE5]
 gi|5458762|emb|CAB50249.1| ndk nucleoside diphosphate kinase [Pyrococcus abyssi GE5]
          Length = 162

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 56/138 (40%), Positives = 83/138 (60%), Gaps = 3/138 (2%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T  +IKPDAV R LIG I+   E  GL +V  K  W++++ AE  Y  H+++PFF  L
Sbjct: 10  ERTLVIIKPDAVIRGLIGEIISRFEKRGLKIVGMKMIWISKELAEKHYAEHREKPFFKSL 69

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGE---NSIHGSD 120
           V+ +   PV + V++G  AI   R++ G TDPK A  GTIR  + + + +   N +H SD
Sbjct: 70  VEYITRTPVVVMVVEGRCAIEVVRKMAGATDPKNAEPGTIRGDFALEVSDAICNVVHASD 129

Query: 121 SLKTALEEISYWFARNEI 138
           S ++A  EI  +F  +EI
Sbjct: 130 SKESAEREIKLYFRDDEI 147


>gi|119897214|ref|YP_932427.1| nucleoside diphosphate kinase [Azoarcus sp. BH72]
 gi|166232946|sp|A1K3Y5|NDK_AZOSB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119669627|emb|CAL93540.1| Nucleoside-diphosphate kinase [Azoarcus sp. BH72]
          Length = 141

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 98/134 (73%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S+IKPDAV +N+IG I +  ED GL ++AAK   ++ ++A  FY +HK+RPF+
Sbjct: 1   MAIERTLSIIKPDAVAKNVIGKIYQRFEDAGLKIIAAKMVHLSEQEAGQFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +Q L+GE AI+KNRE+MG TDPKKA  GTIR  +  SI  N++HGSD
Sbjct: 61  KDLVSFMTSGPVMIQCLEGENAIAKNRELMGATDPKKADAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFA 134
           + +TA  E++++F 
Sbjct: 121 APETAAVEVAFFFP 134


>gi|156375298|ref|XP_001630018.1| predicted protein [Nematostella vectensis]
 gi|156217031|gb|EDO37955.1| predicted protein [Nematostella vectensis]
          Length = 152

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 77/136 (56%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF MIKPDAV R LIG I+   E  G  +VA KF   +       Y       F+  L
Sbjct: 5   ERTFLMIKPDAVSRGLIGEIISRFEKKGFKLVAMKFVKKSEDHFRKHYESLAKLKFYDGL 64

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
            + M   PV   V +G   +   R ++G+TDP K+L GTIR  + I IG N IHGSD+++
Sbjct: 65  CKYMSQTPVCAMVWEGLGVVKTARVMLGETDPAKSLPGTIRGDFSIHIGRNIIHGSDAVE 124

Query: 124 TALEEISYWFARNEII 139
           TA EEI+ WF  +E++
Sbjct: 125 TAKEEIALWFKDDELV 140


>gi|219666215|ref|YP_002456650.1| nucleoside diphosphate kinase [Desulfitobacterium hafniense DCB-2]
 gi|254767228|sp|B8FZD1|NDK_DESHD RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|219536475|gb|ACL18214.1| Nucleoside-diphosphate kinase [Desulfitobacterium hafniense DCB-2]
          Length = 149

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 82/137 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPDAV+R L+G I+   E  G  +V  K   +++  AE  Y  HK + FF  
Sbjct: 1   MEKTFIMLKPDAVQRGLVGQIIARFEAKGCKLVGMKLMSVDQALAEQHYAEHKGKSFFEP 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
            VQ ++S PV   V +G+  ++  RE+MG T+P  A  G+IR  +G+ I  N IHGSDS+
Sbjct: 61  TVQYIMSSPVVAMVWEGKNVVALARELMGATNPANANPGSIRGSFGMDISRNVIHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
            +A  EI+ +F   E+ 
Sbjct: 121 ASAEREIALYFRPEELC 137


>gi|254437727|ref|ZP_05051221.1| Nucleoside diphosphate kinase superfamily [Octadecabacter
           antarcticus 307]
 gi|198253173|gb|EDY77487.1| Nucleoside diphosphate kinase superfamily [Octadecabacter
           antarcticus 307]
          Length = 140

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 109/140 (77%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA KRNL G+IV + E  GL ++A+K   ++  QA++FY +H +RPFF
Sbjct: 1   MAIQRTFSIIKPDATKRNLTGAIVAKFEAAGLRIIASKRIQLSLAQAQEFYGVHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M+S P+ +QVL+GE+AI+KNREVMG T+P  A  GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELTEFMVSEPIVVQVLEGEDAIAKNREVMGATNPADAADGTIRKEFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+Y+F+  E++G
Sbjct: 121 APETAAEEIAYFFSGLELVG 140


>gi|15920470|ref|NP_376139.1| nucleoside diphosphate kinase [Sulfolobus tokodaii str. 7]
 gi|15621253|dbj|BAB65248.1| 148aa long hypothetical nucleoside diphosphate kinase [Sulfolobus
           tokodaii str. 7]
          Length = 148

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 90/139 (64%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TF MIKPD V+RNLIG I+   E  GL ++  K   ++R  AE  Y  HK + FF
Sbjct: 2   MSIQRTFVMIKPDGVRRNLIGEIISRFEKRGLKIIGLKMVKIDRPTAERLYEEHKGKSFF 61

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL+  + SGPV   V++G+EA+S  R+++G+TDPK+A  GTIR  Y +S  EN IH SD
Sbjct: 62  EELISYITSGPVVCMVIEGDEAVSVVRKMIGNTDPKEAPPGTIRGDYALSKAENVIHASD 121

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  E+S +F   E++
Sbjct: 122 SEEKAKREMSIFFKEEELV 140


>gi|2392444|pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase
 gi|2392445|pdb|1LWX|B Chain B, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase
 gi|2392446|pdb|1LWX|C Chain C, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase
          Length = 155

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 9   ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 68

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+P  +  G+IR  +G+ +G   IHGSDS++
Sbjct: 69  VSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRAIIHGSDSVE 128

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 129 SANREIALWFKPEELL 144


>gi|145634038|ref|ZP_01789749.1| nucleoside diphosphate kinase [Haemophilus influenzae PittAA]
 gi|145268482|gb|EDK08475.1| nucleoside diphosphate kinase [Haemophilus influenzae PittAA]
          Length = 140

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 94/137 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFFA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           ++ A  EI+Y+F   EI
Sbjct: 121 IENANREIAYFFTDCEI 137


>gi|26245395|gb|AAN77500.1| nucleoside diphosphate kinase [Glycine max]
          Length = 149

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 54/134 (40%), Positives = 82/134 (61%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           ++E+T  MIKPD V+R LIG I+  LE  G  +   K   ++R  AE  Y     +PFF 
Sbjct: 1   MVEQTSIMIKPDGVQRGLIGEIISRLEKKGFYLKGLKLVTVDRPFAEKHYAHLSAKPFFS 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV  +ISGPV   + +G+  ++  R+++G T+P ++  GTIR  + I IG N IHGSD+
Sbjct: 61  GLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDA 120

Query: 122 LKTALEEISYWFAR 135
           +++A +EI+ WF  
Sbjct: 121 VESANKEIALWFPE 134


>gi|255262690|ref|ZP_05342032.1| nucleoside diphosphate kinase [Thalassiobium sp. R2A62]
 gi|255105025|gb|EET47699.1| nucleoside diphosphate kinase [Thalassiobium sp. R2A62]
          Length = 140

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 106/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA KRNL G I  + E+ GL +VA+K   +   QA+ FY +H +RPFF
Sbjct: 1   MAIQRTFSIIKPDATKRNLTGQIAAKFEEAGLRIVASKRIQLTLAQAQQFYGVHSERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + MIS P+ +QVL+GE+AI+KNREVMG T+P  A  GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELCEFMISEPIVVQVLEGEDAIAKNREVMGATNPADAADGTIRKEFAMSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+++F+  E++G
Sbjct: 121 APETAAEEIAFFFSGLELVG 140


>gi|154175138|ref|YP_001408843.1| nucleoside diphosphate kinase [Campylobacter curvus 525.92]
 gi|166232959|sp|A7H051|NDK_CAMC5 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|112803719|gb|EAU01063.1| guanosine pentaphosphate phosphohydrolase [Campylobacter curvus
           525.92]
          Length = 137

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 100/137 (72%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +++T S+IKPDAVK+N++G I+   E  GL + AAK   +++  A+ FY +H +RPFF +
Sbjct: 1   MQRTLSIIKPDAVKKNVVGKIIDRFESNGLRIAAAKKVKLSKCDAKAFYAVHSERPFFND 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGPV + VL+GE A++KNRE+MG T+PK+A  GTIR  +  SI  N++HGSDSL
Sbjct: 61  LVEFMTSGPVVVMVLEGENAVAKNRELMGATNPKEAAAGTIRADFAESIDANAVHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           + A+ EI+++FA  EI 
Sbjct: 121 ENAINEINFFFAAREIC 137


>gi|54023318|ref|YP_117560.1| nucleoside diphosphate kinase [Nocardia farcinica IFM 10152]
 gi|67460641|sp|Q5Z045|NDK_NOCFA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|54014826|dbj|BAD56196.1| putative nucleoside diphosphate kinase [Nocardia farcinica IFM
           10152]
          Length = 139

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+T  +IKPD V R L+G ++  +E  GL + A +   ++ + A + Y  H D+PFF 
Sbjct: 1   MTEQTLVLIKPDGVSRGLVGEVLARIERKGLKIAALELKQVSDELAREHYAEHADKPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDP-KKALKGTIRNKYGISIGENSIHGSD 120
            L++ + SGPV   VL+G  AI+  R++ G TDP +KA  G+IR  +G+    N +HGSD
Sbjct: 61  SLIEFITSGPVVAAVLEGPRAIAAFRQLAGGTDPVEKAAPGSIRGDFGLETQYNLVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           S ++A  EI  WF  
Sbjct: 121 SPESAKREIGLWFPE 135


>gi|87118481|ref|ZP_01074380.1| putative nucleoside diphosphate kinase [Marinomonas sp. MED121]
 gi|86166115|gb|EAQ67381.1| putative nucleoside diphosphate kinase [Marinomonas sp. MED121]
          Length = 135

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/135 (48%), Positives = 92/135 (68%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N++G I    E  GL VV AK   ++ + A  FY  HK+RPF+
Sbjct: 1   MAVERTLSIIKPDAVAKNVVGEIYSRFERSGLKVVEAKMVQLDDELAGGFYAEHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV + VL+GE A+ ++RE+MG T+P +A  GT+R  Y  SI  N++HGSD
Sbjct: 61  KDLVGFMTSGPVMISVLEGEGAVLRHRELMGATNPAEAAAGTLRADYAASIDANAVHGSD 120

Query: 121 SLKTALEEISYWFAR 135
           SL++A  EI Y+F +
Sbjct: 121 SLESAAREIGYFFGK 135


>gi|255067155|ref|ZP_05319010.1| nucleoside diphosphate kinase [Neisseria sicca ATCC 29256]
 gi|255048523|gb|EET43987.1| nucleoside diphosphate kinase [Neisseria sicca ATCC 29256]
          Length = 141

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 103/139 (74%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDAV +N+IG I    E+ GL +VAAK   ++ ++A++FY +HK+RPF+
Sbjct: 1   MAIERTISIVKPDAVGKNVIGKIYSRFEENGLRIVAAKMKHLSVREAQEFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  M SGPV +QVL+GE A++KNRE+MG T+P +A  GTIR  +  S+  N++HGSD
Sbjct: 61  DSLVAFMTSGPVMIQVLEGENAVAKNRELMGATNPAEAAPGTIRADFAESLSVNAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           SL+ A  EI+Y+F+++EI 
Sbjct: 121 SLENAAIEIAYFFSQSEIC 139


>gi|296274272|ref|YP_003656903.1| nucleoside-diphosphate kinase [Arcobacter nitrofigilis DSM 7299]
 gi|296098446|gb|ADG94396.1| Nucleoside-diphosphate kinase [Arcobacter nitrofigilis DSM 7299]
          Length = 137

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 95/137 (69%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T S+IKPDAV +N++G I+   E  GL + A +   ++R  AE FY +H +RPFF E
Sbjct: 1   MEQTLSIIKPDAVAKNVVGKILDRFESAGLRIAATRKMQLSRADAEAFYAVHAERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ MISGPV + VL+G  A+S NR++MG T+PK+A  GTIR  +  SI  N++HGSDS+
Sbjct: 61  LVEFMISGPVVVSVLEGVNAMSINRDLMGATNPKEAAAGTIRADFADSIDANAVHGSDSV 120

Query: 123 KTALEEISYWFARNEII 139
           + A  EI ++F+  EI 
Sbjct: 121 ENAANEIKFFFSDREIC 137


>gi|323697923|ref|ZP_08109835.1| Nucleoside-diphosphate kinase [Desulfovibrio sp. ND132]
 gi|323457855|gb|EGB13720.1| Nucleoside-diphosphate kinase [Desulfovibrio desulfuricans ND132]
          Length = 140

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/140 (51%), Positives = 97/140 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDAV+R LI  I+K + D GL +   K   M+R +AE FY +HK+RPFF
Sbjct: 1   MAIEQTFSIIKPDAVERGLIAEILKMITDSGLKIKGMKMMRMDRAKAEGFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  MISGPV +  L+G+ AI + R +MG T+P  A +GTIR  YGI+I  N+ HGSD
Sbjct: 61  GELVDYMISGPVVVSCLEGDNAIERYRALMGATNPADAAEGTIRAAYGINIQNNACHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
              TA  E++Y+F  +E++G
Sbjct: 121 GPDTARTEVAYFFNDDELVG 140


>gi|332977218|gb|EGK14014.1| nucleoside diphosphate kinase [Desmospora sp. 8437]
          Length = 148

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 90/136 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF M+KPD V+R L+G IV   E  G  +V  K   ++R+ AE+ Y  HK++PFF E
Sbjct: 1   MEQTFIMVKPDGVQRGLVGEIVARFEKKGFQMVGGKLMTVSRELAEEHYAEHKEKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V  GE+ I+  R +MG T P +A  GTIR  +G+++G+N +HGSDS 
Sbjct: 61  LVDFITSGPVFAMVWAGEDVIATARHMMGKTKPSEAAPGTIRGDFGLTVGKNIVHGSDSP 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  WF ++E+
Sbjct: 121 QSAHREIHLWFGQDEL 136


>gi|145636994|ref|ZP_01792658.1| nucleoside diphosphate kinase [Haemophilus influenzae PittHH]
 gi|145269852|gb|EDK09791.1| nucleoside diphosphate kinase [Haemophilus influenzae PittHH]
          Length = 140

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 93/137 (67%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R QAE FY  H+ + FF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGAILTRFEKNGFKIIASKMVRLTRDQAEGFYAEHQGKEFFA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           ++ A  EI+Y+F   EI
Sbjct: 121 IENANREIAYFFTDCEI 137


>gi|152971379|ref|YP_001336488.1| nucleoside diphosphate kinase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206580859|ref|YP_002237131.1| nucleoside diphosphate kinase [Klebsiella pneumoniae 342]
 gi|238895974|ref|YP_002920710.1| nucleoside diphosphate kinase [Klebsiella pneumoniae NTUH-K2044]
 gi|262040255|ref|ZP_06013506.1| nucleoside diphosphate kinase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330007756|ref|ZP_08306072.1| nucleoside diphosphate kinase [Klebsiella sp. MS 92-3]
 gi|166232978|sp|A6TCD7|NDK_KLEP7 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729825|sp|B5XNL1|NDK_KLEP3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|150956228|gb|ABR78258.1| nucleoside diphosphate kinase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206569917|gb|ACI11693.1| nucleoside diphosphate kinase [Klebsiella pneumoniae 342]
 gi|238548292|dbj|BAH64643.1| nucleoside diphosphate kinase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042364|gb|EEW43384.1| nucleoside diphosphate kinase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328535329|gb|EGF61813.1| nucleoside diphosphate kinase [Klebsiella sp. MS 92-3]
          Length = 143

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 92/139 (66%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IGSI    E  G  +V  K   +  +QA  FY  H+ RPFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGSIFSRFEAAGFKIVGTKMLHLTVEQARGFYAEHEGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S  EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSFTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+++FA  E+ 
Sbjct: 121 SVESAAREIAFFFAEGEVC 139


>gi|219111569|ref|XP_002177536.1| nucleoside diphosphate kinase 3 [Phaeodactylum tricornutum CCAP
           1055/1]
 gi|217412071|gb|EEC51999.1| nucleoside diphosphate kinase 3 [Phaeodactylum tricornutum CCAP
           1055/1]
          Length = 217

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 72/132 (54%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  +KPD V+R LIG I+   E  G  +V  K  W   + A + Y     +PFF  L
Sbjct: 71  ERTFLAVKPDGVQRGLIGDIIVRFEKRGYKLVGLKMVWPTEEMAAEHYADLSKKPFFSGL 130

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+   SGP+     +G++ I + R+++G+T P  +  G+IR  + I +G N  HGSDS  
Sbjct: 131 VKFFSSGPIVCMCWEGKDIIKQGRQMLGETQPLASKPGSIRGDFSIDLGRNICHGSDSPD 190

Query: 124 TALEEISYWFAR 135
           +A  E+  WF  
Sbjct: 191 SAEHELKMWFPE 202


>gi|319892459|ref|YP_004149334.1| Nucleoside diphosphate kinase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162155|gb|ADV05698.1| Nucleoside diphosphate kinase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464438|gb|ADX76591.1| nucleoside diphosphate kinase [Staphylococcus pseudintermedius
           ED99]
          Length = 150

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 62/136 (45%), Positives = 89/136 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EK+F MIKPDAV+R LIG IV+ +E  GL +V AK   + +  AE  Y  HK +PF+  
Sbjct: 1   MEKSFVMIKPDAVQRKLIGEIVQRIEQKGLKLVGAKLMTVPQSLAETHYGEHKGKPFYDS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L+  + S PVF  V++GE A++  R ++G T+P +A  G+IR   G+++G N IHGSDS+
Sbjct: 61  LISFITSAPVFAMVVEGENAVAVARHIIGSTNPSEATPGSIRGDLGLTVGRNVIHGSDSV 120

Query: 123 KTALEEISYWFARNEI 138
           ++A  EI  WF   EI
Sbjct: 121 ESAEREIGLWFKDEEI 136


>gi|217977152|ref|YP_002361299.1| nucleoside diphosphate kinase [Methylocella silvestris BL2]
 gi|254767242|sp|B8EJZ0|NDK_METSB RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|217502528|gb|ACK49937.1| Nucleoside-diphosphate kinase [Methylocella silvestris BL2]
          Length = 140

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKPDA +RNL G+I   +E  GL ++A K   + R QAE FY +HK+RPFF
Sbjct: 1   MAIERTFSIIKPDATRRNLTGAINALIEKAGLRIIAQKRVQITRPQAETFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV  MISGPV +QVL+GE AI   R+V+G TDP KA  GTIR ++ +S+GENS HGSD
Sbjct: 61  GALVDTMISGPVVVQVLEGENAIKAYRDVLGATDPAKAAPGTIRKEFALSVGENSGHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA  EI+ WF+ NEI+G
Sbjct: 121 ASETAAIEIAQWFSGNEIVG 140


>gi|150395999|ref|YP_001326466.1| nucleoside diphosphate kinase [Sinorhizobium medicae WSM419]
 gi|166233024|sp|A6U7K1|NDK_SINMW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|150027514|gb|ABR59631.1| Nucleoside-diphosphate kinase [Sinorhizobium medicae WSM419]
          Length = 140

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 91/140 (65%), Positives = 112/140 (80%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+I K LED GL VVA+K  WM+R++AE FY +HKDRPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAITKMLEDAGLRVVASKRVWMSRREAEGFYAVHKDRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR  + +SIGENS+HGSD
Sbjct: 61  GELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPANAAEGTIRKVHALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI+YWF+  EI+G
Sbjct: 121 APETAAEEIAYWFSGTEIVG 140


>gi|51597161|ref|YP_071352.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis IP
           32953]
 gi|170023535|ref|YP_001720040.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis YPIII]
 gi|67460654|sp|Q667Z5|NDK_YERPS RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729879|sp|B1JS01|NDK_YERPY RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|51590443|emb|CAH22083.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis IP
           32953]
 gi|169750069|gb|ACA67587.1| Nucleoside-diphosphate kinase [Yersinia pseudotuberculosis YPIII]
          Length = 142

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MALERTFSIIKPNAVANNNIGAIYARFESAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  +  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIIVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           ++++A  EI+Y+FA +EI
Sbjct: 121 AVESAQREIAYFFAADEI 138


>gi|145640987|ref|ZP_01796569.1| nucleoside diphosphate kinase [Haemophilus influenzae R3021]
 gi|148826479|ref|YP_001291232.1| nucleoside diphosphate kinase [Haemophilus influenzae PittEE]
 gi|148828058|ref|YP_001292811.1| nucleoside diphosphate kinase [Haemophilus influenzae PittGG]
 gi|229844755|ref|ZP_04464894.1| nucleoside diphosphate kinase [Haemophilus influenzae 6P18H1]
 gi|260581704|ref|ZP_05849501.1| nucleoside diphosphate kinase [Haemophilus influenzae NT127]
 gi|319897636|ref|YP_004135833.1| nucleoside diphosphate kinase [Haemophilus influenzae F3031]
 gi|226729817|sp|A5UDJ8|NDK_HAEIE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729818|sp|A5UI22|NDK_HAEIG RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|145274501|gb|EDK14365.1| nucleoside diphosphate kinase [Haemophilus influenzae 22.4-21]
 gi|148716639|gb|ABQ98849.1| nucleoside diphosphate kinase [Haemophilus influenzae PittEE]
 gi|148719300|gb|ABR00428.1| nucleoside diphosphate kinase [Haemophilus influenzae PittGG]
 gi|229812469|gb|EEP48159.1| nucleoside diphosphate kinase [Haemophilus influenzae 6P18H1]
 gi|260095297|gb|EEW79188.1| nucleoside diphosphate kinase [Haemophilus influenzae NT127]
 gi|301169595|emb|CBW29196.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Haemophilus
           influenzae 10810]
 gi|317433142|emb|CBY81516.1| nucleoside diphosphate kinase [Haemophilus influenzae F3031]
          Length = 140

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 94/137 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFFA 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           ++ A  EI+Y+F   EI
Sbjct: 121 IENANREIAYFFTDCEI 137


>gi|12857112|dbj|BAB30896.1| unnamed protein product [Mus musculus]
          Length = 197

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 73/136 (53%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G++++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 48  ERTLVAVKPDGVQRRLVGTVIQRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPAL 107

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS+ 
Sbjct: 108 ISYMSSGPVVAMVWEGPNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVD 167

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 168 GAQREIELWFQSSELL 183


>gi|9790123|ref|NP_062705.1| nucleoside diphosphate kinase, mitochondrial precursor [Mus
           musculus]
 gi|12230351|sp|Q9WV84|NDKM_MOUSE RecName: Full=Nucleoside diphosphate kinase, mitochondrial;
           Short=NDK; Short=NDP kinase, mitochondrial; AltName:
           Full=Nucleoside diphosphate kinase D; Short=NDPKD;
           AltName: Full=nm23-M4; Flags: Precursor
 gi|5059340|gb|AAD38977.1|AF153451_1 nucleoside diphosphate kinase [Mus musculus]
 gi|9931514|gb|AAG02200.1|AF288690_1 nucleoside diphosphate kinase D [Mus musculus]
 gi|9931518|gb|AAG02202.1|AF288692_1 nucleoside diphosphate kinase D [Mus musculus]
 gi|20071041|gb|AAH27277.1| Non-metastatic cells 4, protein expressed in [Mus musculus]
 gi|148690539|gb|EDL22486.1| expressed in non-metastatic cells 4, protein [Mus musculus]
          Length = 186

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 73/136 (53%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G++++  E  G  +V  K          + Y   + +PF+P L
Sbjct: 37  ERTLVAVKPDGVQRRLVGTVIQRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPAL 96

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           +  M SGPV   V +G   +  +R ++G TD  +A  GTIR  + + I  N IH SDS+ 
Sbjct: 97  ISYMSSGPVVAMVWEGPNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVD 156

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF  +E++
Sbjct: 157 GAQREIELWFQSSELL 172


>gi|1346674|sp|P47919|NDKA_FLABI RecName: Full=Nucleoside diphosphate kinase A; Short=NDK A;
           Short=NDP kinase A
 gi|499110|gb|AAA19004.1| nucleoside diphosphate kinase [Flaveria bidentis]
          Length = 148

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 52/133 (39%), Positives = 79/133 (59%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF MIKPD V+  L+G I+   E  G  +   K   ++R  AE  Y     +PFF  
Sbjct: 1   MEQTFIMIKPDGVQSGLVGEIIGRFEKKGFSLKGLKLLTVDRAFAEKHYADLSSKPFFNG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ ++SGPV   V +G+  ++  RE++G T+P ++  GTIR  + I IG N IHGSD++
Sbjct: 61  LVEYIVSGPVVAMVWEGKNVVTTGREIIGATNPAESAPGTIRGDFAIDIGRNVIHGSDAV 120

Query: 123 KTALEEISYWFAR 135
           ++A + I  WF  
Sbjct: 121 ESARKVIGLWFPE 133


>gi|4176739|gb|AAD08900.1| nucleoside diphosphate kinase [Scyliorhinus torazame]
          Length = 149

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 77/137 (56%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+T   +K D V+R LIG I+K  E  G  ++  K        A+  Y+  KD+PF+  
Sbjct: 1   MERTLIAVKSDGVQRGLIGEIIKRFEHRGFKLIGLKMVKPTEDLAKHHYIDLKDKPFYAG 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L +   +GP      +G+  +   R++MG+T+P  +  GTIR    + +G N IHGSDSL
Sbjct: 61  LCKFTSAGPFVAMCWEGQNIVKMGRDMMGETNPADSKPGTIRGDLCVQVGRNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           +TA +E++ WF   E+I
Sbjct: 121 ETAKKEVALWFKPEELI 137


>gi|15897176|ref|NP_341781.1| nucleoside diphosphate kinase [Sulfolobus solfataricus P2]
 gi|284174421|ref|ZP_06388390.1| nucleoside diphosphate kinase [Sulfolobus solfataricus 98/2]
 gi|18202636|sp|Q980Q7|NDK_SULSO RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|13813367|gb|AAK40571.1| Nucleoside diphosphate kinase (NDP kinase) (ndk) [Sulfolobus
           solfataricus P2]
 gi|261601842|gb|ACX91445.1| Nucleoside-diphosphate kinase [Sulfolobus solfataricus 98/2]
          Length = 138

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 63/138 (45%), Positives = 89/138 (64%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           MV ++TF MIKPD VKR LIG I+   E  GL +V+ K   M+R  AE  Y  HK + FF
Sbjct: 1   MVAQRTFVMIKPDGVKRGLIGEIISRFEKRGLKIVSLKMVKMSRDTAEKLYEEHKGKSFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  + SGPV   V++G++ +   R ++G+TDPK+A  GTIR  Y +S  EN IH SD
Sbjct: 61  EELVNYVTSGPVVCMVIEGDDVVQVIRRMIGNTDPKEAPPGTIRGDYALSKSENVIHASD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A  E+S +F ++++
Sbjct: 121 SIEKAQREMSLFFDKSDL 138


>gi|290508288|ref|ZP_06547659.1| nucleoside diphosphate kinase [Klebsiella sp. 1_1_55]
 gi|289777682|gb|EFD85679.1| nucleoside diphosphate kinase [Klebsiella sp. 1_1_55]
          Length = 143

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 92/139 (66%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IGSI    E  G  +V  K   +  +QA  FY  H+ RPFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGSIFSRFEAAGFKIVGTKMLHLTVEQARGFYAEHEGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S  EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPSNALAGTLRADYADSFTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+++FA  E+ 
Sbjct: 121 SVESAAREIAFFFAEGEVC 139


>gi|170742483|ref|YP_001771138.1| nucleoside diphosphate kinase [Methylobacterium sp. 4-46]
 gi|226729832|sp|B0UIS8|NDK_METS4 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|168196757|gb|ACA18704.1| Nucleoside-diphosphate kinase [Methylobacterium sp. 4-46]
          Length = 140

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 71/140 (50%), Positives = 102/140 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS++KPDA  RNL G+I   +E+ GL +VA +   M+  QA+ FY +H +RPF+
Sbjct: 1   MAIERTFSILKPDATARNLTGAINAVIEEAGLRIVAQRRIRMSEAQAKTFYEVHAERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV  M SGPV +QVL+G+ A++K REVMG T+P +A +GTIR ++ +S+GENS+HGSD
Sbjct: 61  GELVSFMTSGPVVVQVLEGDNAVAKYREVMGATNPAQAAEGTIRKRFAVSVGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+ +F   +I+G
Sbjct: 121 SAENAAIEIAQFFTEADIVG 140


>gi|56554363|pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial
           Nucleoside Diphosphate Kinase: Identification Of
           Residues Involved In Serine Phosphorylation And
           Oligomerization.
 gi|56554364|pdb|1W7W|B Chain B, Structure And Mutational Analysis Of A Plant Mitochondrial
           Nucleoside Diphosphate Kinase: Identification Of
           Residues Involved In Serine Phosphorylation And
           Oligomerization.
 gi|56554365|pdb|1W7W|C Chain C, Structure And Mutational Analysis Of A Plant Mitochondrial
           Nucleoside Diphosphate Kinase: Identification Of
           Residues Involved In Serine Phosphorylation And
           Oligomerization.
 gi|56554366|pdb|1W7W|D Chain D, Structure And Mutational Analysis Of A Plant Mitochondrial
           Nucleoside Diphosphate Kinase: Identification Of
           Residues Involved In Serine Phosphorylation And
           Oligomerization.
 gi|56554367|pdb|1W7W|E Chain E, Structure And Mutational Analysis Of A Plant Mitochondrial
           Nucleoside Diphosphate Kinase: Identification Of
           Residues Involved In Serine Phosphorylation And
           Oligomerization.
 gi|56554368|pdb|1W7W|F Chain F, Structure And Mutational Analysis Of A Plant Mitochondrial
           Nucleoside Diphosphate Kinase: Identification Of
           Residues Involved In Serine Phosphorylation And
           Oligomerization
          Length = 182

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 79/137 (57%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TF  IKPD V+R LI  I+   E  G  +V  K     ++ A+  Y   K+RPFF  
Sbjct: 32  LERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNG 91

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           L   + SGPV   V +GE  I+  R+++G TDP+K+  GTIR    + +G N IHGSD  
Sbjct: 92  LCDFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGP 151

Query: 123 KTALEEISYWFARNEII 139
           +TA +EI  WF   E++
Sbjct: 152 ETAKDEIKLWFKPEELV 168


>gi|240850240|ref|YP_002971633.1| nucleoside diphosphate kinase [Bartonella grahamii as4aup]
 gi|240267363|gb|ACS50951.1| nucleoside diphosphate kinase [Bartonella grahamii as4aup]
          Length = 140

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 86/140 (61%), Positives = 114/140 (81%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFSMIKPDA +RNL G+I+K LED GLCV+A+K  WM++++AE+FY +HK+RPFF
Sbjct: 1   MALERTFSMIKPDATRRNLTGAIIKMLEDAGLCVIASKRVWMSKREAENFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            ELV+ M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR  + +SIGENS+HGSD
Sbjct: 61  SELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPSDAEEGTIRKVHALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S +TA  EI++WF+  EI+G
Sbjct: 121 SAETAKTEIAFWFSEVEIVG 140


>gi|320583470|gb|EFW97683.1| Nucleoside diphosphate kinase [Pichia angusta DL-1]
          Length = 151

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 82/138 (59%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+TF  +KPD V+R +   I++  ++ G  +V  K    N     + Y   + +PFF
Sbjct: 1   MSTERTFIAVKPDGVQRGIFPEILRRFQNKGFKLVGIKLTLANESLLREHYADLQSKPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
           P L+  M+SGP+   V +G++ + + R ++G T+P ++  GTIR  + + +G N IHGSD
Sbjct: 61  PSLLSYMMSGPILATVWEGKDVVKQGRALLGATNPLQSAPGTIRGDFALDMGRNIIHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S++ A +EI+ WF + E+
Sbjct: 121 SVENAEKEINLWFKKEEL 138


>gi|282163708|ref|YP_003356093.1| nucleoside diphosphate kinase [Methanocella paludicola SANAE]
 gi|282156022|dbj|BAI61110.1| nucleoside diphosphate kinase [Methanocella paludicola SANAE]
          Length = 152

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 56/134 (41%), Positives = 81/134 (60%)

Query: 5   KTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPELV 64
           +TF MIKPD V+R L+G IV   E  GL + A K   ++   A+  Y  H  +PFFP LV
Sbjct: 6   RTFVMIKPDGVQRGLVGDIVARFEHRGLKIAAMKMLLVSEDLAKKHYEEHAAKPFFPNLV 65

Query: 65  QAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLKT 124
             + SGPV   V++G++ +   R ++G T+PK +  GTIR  + + +G N IH SDS ++
Sbjct: 66  SFIRSGPVVAMVVEGKDVVPMVRSMVGATNPKNSNPGTIRGDFAVDMGRNVIHASDSPES 125

Query: 125 ALEEISYWFARNEI 138
           A  EIS +F  +EI
Sbjct: 126 AKREISLYFNTSEI 139


>gi|154686521|ref|YP_001421682.1| nucleoside diphosphate kinase [Bacillus amyloliquefaciens FZB42]
 gi|154352372|gb|ABS74451.1| Ndk [Bacillus amyloliquefaciens FZB42]
          Length = 148

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 91/137 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LIG I+   E  GL +  AK   ++ + AE  Y  HK +PFF E
Sbjct: 1   MEKTFIMVKPDGVQRQLIGEILSRFERKGLQLAGAKLMQVSEQMAETHYAEHKGKPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ + SGPVF  V +GE  +   R+++G T+PK AL GTIR  YG+ +G+N IHGSDSL
Sbjct: 61  LVEFITSGPVFAMVWEGENVVEITRQLIGKTNPKDALPGTIRGDYGMFVGKNIIHGSDSL 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI  +F + E++
Sbjct: 121 ESAEREIHIFFKQEELV 137


>gi|296532432|ref|ZP_06895158.1| nucleoside-diphosphate kinase [Roseomonas cervicalis ATCC 49957]
 gi|296267242|gb|EFH13141.1| nucleoside-diphosphate kinase [Roseomonas cervicalis ATCC 49957]
          Length = 140

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 71/140 (50%), Positives = 100/140 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+T S++KPDA +RNL G I  + E+ GL +VA K   ++  QA  FY +HK+RPF+
Sbjct: 1   MAIERTLSILKPDATRRNLTGKINAKFEEQGLRIVAQKRLHLSEAQAGAFYAVHKERPFY 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV  QVL+GE+A++KNRE+MG T+P  A +GTIR ++  SI  NS+HGSD
Sbjct: 61  KDLVSFMTSGPVVAQVLEGEDAVAKNREIMGATNPANAAEGTIRKEFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           S + A  EI+++F+  EI+G
Sbjct: 121 SAENAAIEIAFFFSGIEIVG 140


>gi|291416246|ref|XP_002724357.1| PREDICTED: nucleoside diphosphate kinase 4, partial [Oryctolagus
           cuniculus]
          Length = 156

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 75/136 (55%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G +++  E  G  +V  K   +      + Y   + +PF+P L
Sbjct: 7   ERTLVAVKPDGVQRRLVGEVIQRFERRGFRLVGMKMLQVPESVLAEHYQDLQGKPFYPAL 66

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++G+TD  +A  GTIR  + I I  N IH SDS++
Sbjct: 67  IRYMSSGPVVAMVWEGHNVVRASRVMIGNTDSCEAAPGTIRGDFSIHISRNVIHASDSVE 126

Query: 124 TALEEISYWFARNEII 139
            A  EI  WF   E++
Sbjct: 127 GAQREIRLWFRSGELL 142


>gi|307946758|ref|ZP_07662093.1| nucleoside diphosphate kinase [Roseibium sp. TrichSKD4]
 gi|307770422|gb|EFO29648.1| nucleoside diphosphate kinase [Roseibium sp. TrichSKD4]
          Length = 140

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 85/140 (60%), Positives = 111/140 (79%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFSMIKPDA KRNL G+I K+ ED GL VVA+K  WM+ ++AE FY +HK+RPFF
Sbjct: 1   MAIERTFSMIKPDATKRNLTGAITKKFEDAGLRVVASKRVWMSIREAEAFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            EL + M SGP  +QVL+GE AI+KNREVMG T+P  A +GTIR ++ +SIGENS+HGSD
Sbjct: 61  GELTEFMSSGPTVVQVLEGENAIAKNREVMGATNPADADEGTIRKEFALSIGENSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI++WF+  E++G
Sbjct: 121 APETAAEEIAFWFSGTELVG 140


>gi|269125782|ref|YP_003299152.1| Nucleoside-diphosphate kinase [Thermomonospora curvata DSM 43183]
 gi|268310740|gb|ACY97114.1| Nucleoside-diphosphate kinase [Thermomonospora curvata DSM 43183]
          Length = 136

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 55/134 (41%), Positives = 84/134 (62%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+T  ++KPD V+R ++G ++  +E  GL ++A +   ++R+ AED Y  H++RPFF 
Sbjct: 1   MSERTLVLVKPDGVRRGVVGDVISRIERKGLKIIAMEMRTLSRETAEDHYGEHRERPFFG 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
           ELV  +  GP+   V++G  AI   R + G TDP KA  GTIR  + + IGEN +HGSDS
Sbjct: 61  ELVDFITGGPLVAMVVEGPRAIEAFRALAGATDPVKAAPGTIRGDHALEIGENIVHGSDS 120

Query: 122 LKTALEEISYWFAR 135
            ++A  EI  +F  
Sbjct: 121 PESAAREIKLFFPE 134


>gi|113931578|ref|NP_001039239.1| nucleoside diphosphate kinase 4 [Xenopus (Silurana) tropicalis]
 gi|89273428|emb|CAJ82999.1| non-metastatic cells 4, protein expressed in [Xenopus (Silurana)
           tropicalis]
 gi|165971548|gb|AAI58418.1| LOC734101 protein [Xenopus (Silurana) tropicalis]
          Length = 186

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 76/136 (55%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G I+K  E  G  +V  K    +     + Y   + +PF+P L
Sbjct: 38  ERTLIAVKPDGVQRKLVGEIIKRFEQRGFTLVGLKLLQASEGILAEHYHDLRRKPFYPAL 97

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M SGPV   V +G   +  +R ++GDTD  +A  GTIR  + + I  N IH SDS++
Sbjct: 98  LRYMASGPVVAMVWEGHNVVRTSRAMVGDTDSSQAKPGTIRGDFSVHISRNVIHASDSVE 157

Query: 124 TALEEISYWFARNEII 139
            A  EIS WF   E+I
Sbjct: 158 VAEREISLWFHSGELI 173


>gi|145632249|ref|ZP_01787984.1| nucleoside diphosphate kinase [Haemophilus influenzae 3655]
 gi|144987156|gb|EDJ93686.1| nucleoside diphosphate kinase [Haemophilus influenzae 3655]
          Length = 140

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 94/137 (68%)

Query: 2   VIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFP 61
           + E+TFS+IKPDAVKRNLIG+I+   E  G  ++A+K   + R+QAE FY  H+ + FF 
Sbjct: 1   MTERTFSIIKPDAVKRNLIGTILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFFV 60

Query: 62  ELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDS 121
            LV+ M+S P+ + VL+ E A+   R ++G T+P+ A +GTIR  + +S  ENS+HGSDS
Sbjct: 61  PLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRKDFALSQRENSVHGSDS 120

Query: 122 LKTALEEISYWFARNEI 138
           ++ A  EI+Y+F   EI
Sbjct: 121 IENANREIAYFFTDCEI 137


>gi|261340822|ref|ZP_05968680.1| nucleoside diphosphate kinase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317248|gb|EFC56186.1| nucleoside diphosphate kinase [Enterobacter cancerogenus ATCC
           35316]
          Length = 143

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 93/139 (66%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M IE+TFS+IKP+AV +N+IGSI    E  G  +V  K   +  +QA  FY  H+ RPFF
Sbjct: 1   MAIERTFSIIKPNAVAKNVIGSIFSRFESAGFKIVGTKMLHLTVEQARGFYAEHEGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ + VL+GE A+ ++R+++G T+P+ AL GT+R  Y  S  EN  HGSD
Sbjct: 61  DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPENALAGTLRADYADSFTENGTHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S+++A  EI+++FA  E+ 
Sbjct: 121 SVESAAREIAFFFAEGEVC 139


>gi|121998571|ref|YP_001003358.1| nucleoside diphosphate kinase [Halorhodospira halophila SL1]
 gi|166232974|sp|A1WXZ4|NDK_HALHL RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|121589976|gb|ABM62556.1| nucleoside diphosphate kinase [Halorhodospira halophila SL1]
          Length = 141

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 101/139 (72%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+T S+IKPDAV +N IG I+   E  GL VVAA+   ++ +QAE FY +HK+RPFF
Sbjct: 1   MAVERTLSIIKPDAVAQNAIGEILARFERSGLRVVAARMVRLSTEQAESFYAVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  M SGPV +QVL+GE+AI KNRE+MG T+PK+A  GT+R+ +  SI  N++HGSD
Sbjct: 61  NDLVGFMTSGPVMVQVLEGEDAIRKNREIMGATNPKEAAAGTLRHDFAESIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEII 139
           S +TA  EI ++F  +EI 
Sbjct: 121 SPETAENEIEFFFKADEIC 139


>gi|147907096|ref|NP_001088687.1| nucleoside diphosphate kinase 4 [Xenopus laevis]
 gi|56269110|gb|AAH87320.1| LOC495951 protein [Xenopus laevis]
          Length = 180

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 75/136 (55%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T   +KPD V+R L+G I+K  E  G  +V  K    +     + Y   + +PF+P L
Sbjct: 32  ERTLVAVKPDGVQRRLVGEIIKRFEQRGFTLVGLKLLQASEGILAEHYHDLRRKPFYPAL 91

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           ++ M +GPV   V +G   +  +R ++GDTD  +A  GTIR    + I  N IH SDS++
Sbjct: 92  LRYMAAGPVVAMVWEGHNVVQTSRAMVGDTDSSQAKPGTIRGDLSVHISRNVIHASDSVE 151

Query: 124 TALEEISYWFARNEII 139
            A  EIS WF   E+I
Sbjct: 152 GAEREISLWFHSGELI 167


>gi|329115638|ref|ZP_08244360.1| Nucleoside diphosphate kinase [Acetobacter pomorum DM001]
 gi|326695066|gb|EGE46785.1| Nucleoside diphosphate kinase [Acetobacter pomorum DM001]
          Length = 148

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 75/139 (53%), Positives = 97/139 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M  E+T S+IKPDA +RNL G I    ED GL +VA K   ++  QA  FY +HK+RPF+
Sbjct: 9   MAKERTLSIIKPDATRRNLTGKINAVFEDAGLSIVAQKRIQLSPAQAGAFYEVHKERPFY 68

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+G+ A++KNREVMG TDPKKA   TIR ++  SI  NS+HGSD
Sbjct: 69  NDLVSFMISGPVVVQVLEGDNAVAKNREVMGATDPKKADPNTIRAQFAESIEANSVHGSD 128

Query: 121 SLKTALEEISYWFARNEII 139
           S + A  EI ++FA  EI+
Sbjct: 129 SAENAANEIRFFFAETEIL 147


>gi|23099242|ref|NP_692708.1| nucleoside diphosphate kinase [Oceanobacillus iheyensis HTE831]
 gi|38372281|sp|Q8EQB4|NDK_OCEIH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|22777471|dbj|BAC13743.1| nucleoside-diphosphate kinase [Oceanobacillus iheyensis HTE831]
          Length = 148

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 91/137 (66%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +EKTF M+KPD V+R LIG IVK  E  G  +  AK   ++ + AE  Y  HK+RPFF E
Sbjct: 1   MEKTFLMVKPDGVQRELIGEIVKRFETKGYKLAGAKLMQVSNQLAETHYSEHKERPFFGE 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV  + SGPVF  V +GE  I+  R++MG T+P +A   TIR  +GIS+G+N IHGSDS 
Sbjct: 61  LVDFITSGPVFAMVWEGENVIATARKMMGKTNPLEADPSTIRGDFGISVGKNIIHGSDSA 120

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+ +F  NEI+
Sbjct: 121 ESAEREITLFFTENEIV 137


>gi|153947813|ref|YP_001400163.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis IP
           31758]
 gi|167016281|sp|A7FFY5|NDK_YERP3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|152959308|gb|ABS46769.1| nucleoside diphosphate kinase [Yersinia pseudotuberculosis IP
           31758]
          Length = 142

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MALERTFSIIKPNAVANNNIGAIYARFESAGFNIIAAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  +  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           ++++A  EI+Y+FA +EI
Sbjct: 121 AVESAQREIAYFFAADEI 138


>gi|14488646|pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside
           Diphosphate Kinase
          Length = 155

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 79/136 (58%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+TF  + PD V R L+G I+   E  G  +V  K     +  AE  Y  HK+RPFF  L
Sbjct: 9   ERTFLAVAPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGL 68

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V  + SGPV   V +G+  ++  R ++G T+P  +  G+IR  +G+ +G N IHGSDS++
Sbjct: 69  VSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVE 128

Query: 124 TALEEISYWFARNEII 139
           +A  EI+ WF   E++
Sbjct: 129 SANREIALWFKPEELL 144


>gi|330872883|gb|EGH07032.1| mulitfunctional nucleoside diphosphate kinase/apyrimidinic
           endonuclease/3'-phosphodiesterase [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 141

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 74/138 (53%), Positives = 96/138 (69%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +++TFS+IKPDAV +NLIG I    E  GL VVA+K   +++ +AE FY  H  R FF
Sbjct: 1   MAVQRTFSIIKPDAVAKNLIGEITTRFEKAGLRVVASKLKQLSKAEAEGFYAEHSARGFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE AI+ NRE+MG T+PK+A  GTIR  +  SI  N++HGSD
Sbjct: 61  GDLVAFMISGPVVVQVLEGENAIALNRELMGATNPKEAAAGTIRADFADSIDANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           S   A  EISY+FA  E+
Sbjct: 121 SEAAAAREISYFFAATEV 138


>gi|114569785|ref|YP_756465.1| nucleoside-diphosphate kinase [Maricaulis maris MCS10]
 gi|119372037|sp|Q0AQB0|NDK_MARMM RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|114340247|gb|ABI65527.1| Nucleoside-diphosphate kinase [Maricaulis maris MCS10]
          Length = 140

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 106/140 (75%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M I++TFS+IKPDA  RNL G+I  ++E  GL ++A K   ++R+QAE FY +HK+RPFF
Sbjct: 1   MAIQRTFSIIKPDATARNLTGAINAKIEAAGLRIIAQKRIRLSREQAEGFYGVHKERPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
            +LV  MISGPV +QVL+GE+AI+K R VMG T+P++A  GTIR  +  SI  NS+HGSD
Sbjct: 61  NDLVTFMISGPVVVQVLEGEDAIAKYRTVMGATNPEQADAGTIRKDFAESIEANSVHGSD 120

Query: 121 SLKTALEEISYWFARNEIIG 140
           + +TA EEI ++F+ +EI+G
Sbjct: 121 APETAAEEIPFFFSDDEIVG 140


>gi|22125248|ref|NP_668671.1| nucleoside diphosphate kinase [Yersinia pestis KIM 10]
 gi|45442521|ref|NP_994060.1| nucleoside diphosphate kinase [Yersinia pestis biovar Microtus str.
           91001]
 gi|108808317|ref|YP_652233.1| nucleoside diphosphate kinase [Yersinia pestis Antiqua]
 gi|108811418|ref|YP_647185.1| nucleoside diphosphate kinase [Yersinia pestis Nepal516]
 gi|145599500|ref|YP_001163576.1| nucleoside diphosphate kinase [Yersinia pestis Pestoides F]
 gi|149365343|ref|ZP_01887378.1| nucleoside diphosphate kinase [Yersinia pestis CA88-4125]
 gi|162419780|ref|YP_001605028.1| nucleoside diphosphate kinase [Yersinia pestis Angola]
 gi|165925894|ref|ZP_02221726.1| nucleoside diphosphate kinase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937060|ref|ZP_02225625.1| nucleoside diphosphate kinase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008382|ref|ZP_02229280.1| nucleoside diphosphate kinase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212616|ref|ZP_02238651.1| nucleoside diphosphate kinase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399036|ref|ZP_02304560.1| nucleoside diphosphate kinase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421330|ref|ZP_02313083.1| nucleoside diphosphate kinase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423509|ref|ZP_02315262.1| nucleoside diphosphate kinase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167468094|ref|ZP_02332798.1| nucleoside diphosphate kinase [Yersinia pestis FV-1]
 gi|218929943|ref|YP_002347818.1| nucleoside diphosphate kinase [Yersinia pestis CO92]
 gi|229838463|ref|ZP_04458622.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229895164|ref|ZP_04510340.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           Pestoides A]
 gi|229899030|ref|ZP_04514174.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229901675|ref|ZP_04516797.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           Nepal516]
 gi|270489870|ref|ZP_06206944.1| nucleoside diphosphate kinase [Yersinia pestis KIM D27]
 gi|294504555|ref|YP_003568617.1| nucleoside diphosphate kinase [Yersinia pestis Z176003]
 gi|20138836|sp|Q8ZCT2|NDK_YERPE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119372158|sp|Q1C5I4|NDK_YERPA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|119372159|sp|Q1CK95|NDK_YERPN RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|166233034|sp|A4TMU1|NDK_YERPP RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|226729878|sp|A9R806|NDK_YERPG RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|21958118|gb|AAM84922.1|AE013737_4 nucleoside diphosphate kinase [Yersinia pestis KIM 10]
 gi|45437386|gb|AAS62937.1| nucleoside diphosphate kinase [Yersinia pestis biovar Microtus str.
           91001]
 gi|108775066|gb|ABG17585.1| nucleoside diphosphate kinase [Yersinia pestis Nepal516]
 gi|108780230|gb|ABG14288.1| nucleoside diphosphate kinase [Yersinia pestis Antiqua]
 gi|115348554|emb|CAL21494.1| nucleoside diphosphate kinase [Yersinia pestis CO92]
 gi|145211196|gb|ABP40603.1| nucleoside diphosphate kinase [Yersinia pestis Pestoides F]
 gi|149291756|gb|EDM41830.1| nucleoside diphosphate kinase [Yersinia pestis CA88-4125]
 gi|162352595|gb|ABX86543.1| nucleoside diphosphate kinase [Yersinia pestis Angola]
 gi|165914923|gb|EDR33535.1| nucleoside diphosphate kinase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922098|gb|EDR39275.1| nucleoside diphosphate kinase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992764|gb|EDR45065.1| nucleoside diphosphate kinase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206547|gb|EDR51027.1| nucleoside diphosphate kinase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960819|gb|EDR56840.1| nucleoside diphosphate kinase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051540|gb|EDR62948.1| nucleoside diphosphate kinase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057679|gb|EDR67425.1| nucleoside diphosphate kinase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229681604|gb|EEO77698.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           Nepal516]
 gi|229687975|gb|EEO80047.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229694829|gb|EEO84876.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229701926|gb|EEO89949.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           Pestoides A]
 gi|262362450|gb|ACY59171.1| nucleoside diphosphate kinase [Yersinia pestis D106004]
 gi|262366543|gb|ACY63100.1| nucleoside diphosphate kinase [Yersinia pestis D182038]
 gi|270338374|gb|EFA49151.1| nucleoside diphosphate kinase [Yersinia pestis KIM D27]
 gi|294355014|gb|ADE65355.1| nucleoside diphosphate kinase [Yersinia pestis Z176003]
 gi|320016020|gb|ADV99591.1| multifunctional nucleoside diphosphate kinase and apyrimidinic
           endonuclease and 3'-phosphodiesterase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 142

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 97/138 (70%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MALERTFSIIKPNAVANNDIGAIYARFERAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P  AL GT+R  +  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFSDSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           ++++A  EI+Y+FA +EI
Sbjct: 121 AVESAQREIAYFFAADEI 138


>gi|238785317|ref|ZP_04629306.1| Nucleoside diphosphate kinase [Yersinia bercovieri ATCC 43970]
 gi|238713770|gb|EEQ05793.1| Nucleoside diphosphate kinase [Yersinia bercovieri ATCC 43970]
          Length = 142

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 66/138 (47%), Positives = 98/138 (71%)

Query: 1   MVIEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFF 60
           M +E+TFS+IKP+AV  N IG+I    E  G  ++AAK   + ++QAE FY  HK RPFF
Sbjct: 1   MALERTFSIIKPNAVANNDIGAIYARFESAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF 60

Query: 61  PELVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSD 120
             LV+ M SGP+ +QVL+GE A+ ++R++MG T+P+ AL GT+R  +  S   N++HGSD
Sbjct: 61  DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPENALAGTLRADFADSFTANAVHGSD 120

Query: 121 SLKTALEEISYWFARNEI 138
           ++++A  EI+Y+FA +EI
Sbjct: 121 AVESAQREIAYFFAADEI 138


>gi|256830653|ref|YP_003159381.1| nucleoside-diphosphate kinase [Desulfomicrobium baculatum DSM 4028]
 gi|256579829|gb|ACU90965.1| Nucleoside-diphosphate kinase [Desulfomicrobium baculatum DSM 4028]
          Length = 138

 Score =  170 bits (430), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 89/138 (64%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           +E+TFS+IKPDAV RNL G I+  ++  GL +   K   + + QAE FY +H  RPFF  
Sbjct: 1   MERTFSIIKPDAVARNLQGEIMAMIQSAGLRIKGMKMIQLTKAQAEGFYAVHSARPFFGS 60

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGP  +  L+G+ A+ K R++MG T+   A +GTIR KY + I +NS HGSD  
Sbjct: 61  LVEYMCSGPCVVMCLEGDNAVQKYRDLMGATNKDNAAEGTIRKKYALDIEKNSCHGSDGQ 120

Query: 123 KTALEEISYWFARNEIIG 140
            TA  EI+Y+F   E++G
Sbjct: 121 DTAAVEIAYFFNALELVG 138


>gi|302348891|ref|YP_003816529.1| Nucleoside diphosphate kinase [Acidilobus saccharovorans 345-15]
 gi|302329303|gb|ADL19498.1| Nucle