RPSBLAST alignment for GI: 254780390 and conserved domain: smart00562

>gnl|CDD|128834 smart00562, NDK, These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates. These enzymes play important roles in bacterial growth, signal transduction and pathogenicity. Length = 135
 Score =  186 bits (475), Expect = 2e-48
 Identities = 65/135 (48%), Positives = 92/135 (68%)

Query: 4   EKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPEL 63
           E+T ++IKPDAV+R LIG I+   E  G  +VA K   +  + AE+FY  HK +PFF +L
Sbjct: 1   ERTLAIIKPDAVQRGLIGEIISRFERKGFKIVAMKMLQLTEELAEEFYAEHKGKPFFNDL 60

Query: 64  VQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSLK 123
           V+ M SGPV   VL+GE+A+   R +MG TDP++A  GTIR  +G+ IG N++HGSDS +
Sbjct: 61  VEFMTSGPVVAMVLEGEDAVKTWRTLMGPTDPREAAPGTIRGDFGLDIGRNAVHGSDSPE 120

Query: 124 TALEEISYWFARNEI 138
           +A  EI+ +F  +EI
Sbjct: 121 SAEREIALFFPESEI 135