RPSBLAST alignment of GI: 254780390 and MMDB domain: 2hur_A_

>2hur_A (A:) NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli}Length = 142
 Score =  151 bits (383), Expect = 3e-38
 Identities = 61/137 (44%), Positives = 90/137 (65%)

Query: 3   IEKTFSMIKPDAVKRNLIGSIVKELEDYGLCVVAAKFCWMNRKQAEDFYLIHKDRPFFPE 62
           IE+TFS+IKP+AV +N+IG+I    E  G  +V  K   +  +QA  FY  H  +PFF  
Sbjct: 2   IERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDG 61

Query: 63  LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPKKALKGTIRNKYGISIGENSIHGSDSL 122
           LV+ M SGP+ + VL+GE A+ ++R+++G T+P  AL GT+R  Y  S+ EN  HGSDS+
Sbjct: 62  LVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSV 121

Query: 123 KTALEEISYWFARNEII 139
           ++A  EI+Y+F   E+ 
Sbjct: 122 ESAAREIAYFFGEGEVC 138