HHsearch alignment for GI: 254780396 and conserved domain: COG0760

>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones].
Probab=99.79  E-value=8.2e-17  Score=125.24  Aligned_cols=272  Identities=20%  Similarity=0.109  Sum_probs=157.6

Q ss_pred             CCCCEEEEECCEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             34826999886786889999999998730350359999999999999998642001223444566899999997313430
Q gi|254780396|r   38 MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA  117 (317)
Q Consensus        38 ~~~~vvA~Vng~~It~~e~~~~~~~~~~~~~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~~~~~~~~~  117 (317)
T Consensus        24 ~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  102 (320)
T COG0760          24 SASLVAGVVNAGAVAKVGAQEISAKEKLNAQQKE-RNIALEQLGEQLLLLQAAAELGIKISQQVVAQLIAEIAVLDKLAK  102 (320)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0024554300578987547766326899987311-666999999999877767777777779999987766899889899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHCCCCHHHHHH--HHHHHHHH--CCCCHHHHHHHHHCCCCC
Q ss_conf             35677776531124554699999989999999984--3203555899986--44321110--011002333221024675
Q gi|254780396|r  118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF--MLKYGNLEMEIPA--NKQKMKNI--TVREYLIRTVLFSIPDNK  191 (317)
Q Consensus       118 ~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~--~~~i~~~~~e~~~--~~~~~~~~--~~~~~~~~~~~~~~~~~~  191 (317)
T Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~--~  180 (320)
T COG0760         103 ELLLGLSDEQGKQLIAEKPAFQDVEGKFDARAYLKRLRIKGLTEEQEAEALRDKLQNKQQGKKVTEVQARHILVKAE--A  180 (320)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH--H
T ss_conf             99998887652214547899999999899999999987603765469999999998876310034554543103324--6


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEE
Q ss_conf             444799998643578865223324899998520132256-874675275561367665-112457880123763894899
Q gi|254780396|r  192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEY  269 (317)
Q Consensus       192 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hi  269 (317)
T Consensus       181 ~a~~-~~~~~~~~~~~---~~~~f~~~a~~~s~~~~~~~~g~~~~~~~~~~~~p~f~~a~~~~~~g~~~~pv~t~~g~~i  256 (320)
T COG0760         181 KAKE-ALALLKKGVRE---AKADFAELAKKQSEDPSSKNGGGLLGWNKKGQLVPEFRKAAFILKVGEVSAPVKTSFGYHI  256 (320)
T ss_pred             HHHH-HHHHHHHHHHH---CCCCHHHHHHHHCCCHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCEEECCEEEE
T ss_conf             5699-99998732422---0034799999836682542057633324567667889999975667871675567665899


Q ss_pred             EEEECCCCCCC-CHHHHHHHH----HH----HHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99822357884-457899999----99----9999999999999999997547750
Q gi|254780396|r  270 IAICDKRDLGG-EIALKAYLS----AQ----NTPTKIEKHEAEYVKKLRSNAIIHY  316 (317)
Q Consensus       270 ikv~~~r~~~~-~~~~~~~i~----~~----l~~~~~~~~~~~~l~~Lr~~A~I~~  316 (317)
T Consensus       257 i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  312 (320)
T COG0760         257 IKVEKKRDAKLDFPEVKAVKEISLKQELLQKAALEKLLKGEQKSFDKLLKEAAIDI  312 (320)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             83103455334534889999998999999999999998766666889888651567