HHsearch alignment for GI: 254780396 and conserved domain: PRK03002

>PRK03002 prsA peptidylprolyl isomerase; Reviewed.
Probab=100.00  E-value=6.7e-35  Score=239.73  Aligned_cols=242  Identities=16%  Similarity=0.219  Sum_probs=195.6

Q ss_pred             CCCCCCCEEEEECCEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             21134826999886786889999999998730350359999999999999998642001223444566899999997313
Q gi|254780396|r   35 SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG  114 (317)
Q Consensus        35 ~~~~~~~vvA~Vng~~It~~e~~~~~~~~~~~~~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~~~~~~  114 (317)
T Consensus        22 ~~~~~~~~VAtv~g~~IT~~df~~~lk--------~~~g~~~l~~mi~~kvl~~~y-----kvs~~ev~~e~~~~k~qyg   88 (285)
T PRK03002         22 GQKNSSATVATATDSTITKSDFEKQLK--------DRYGKDMLYEMMAQDVITKKY-----KVSDDDVDKEVQKAKSQYG   88 (285)
T ss_pred             CCCCCCCEEEEECCCEECHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHH-----CCCHHHHHHHHHHHHHHHH
T ss_conf             579999779986897873999999999--------887899999999999999861-----2689999999999999987


Q ss_pred             CCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCC
Q ss_conf             4303567777653112-455469999998999999998432035558999864432111001100233322102467544
Q gi|254780396|r  115 LSAEDFSSFLDKQGIG-DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ  193 (317)
Q Consensus       115 ~~~~~~~~~l~~~g~t-~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  193 (317)
T Consensus        89 ---~~f~~~L~q~glt~e~~~k~qi~~~l~~~~~~k~------~vtd~d~k~~Y~-------pev~~~hIlv~~------  146 (285)
T PRK03002         89 ---DQFKNVLENNGLKDEADFKNQIKFKLAMNEAIKK------SVTEKDVKDHYK-------PEIKASHILVSD------  146 (285)
T ss_pred             ---HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHC------CCCHHHHHHHCC-------CCEEEEEEEECC------
T ss_conf             ---8999999986997589999999999999999863------288999998618-------763888877789------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEEEE
Q ss_conf             479999864357886522332489999852013-2256874675275561367665-11245788012376389489999
Q gi|254780396|r  194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIA  271 (317)
Q Consensus       194 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hiik  271 (317)
T Consensus       147 -e~~A~----~v~~~l~~G~dF~~lAk~~S~D~~s~~~GG~lg~~~~~~~~~ef~~aaf~L~~GeiS~pv~t~~GyhIIk  221 (285)
T PRK03002        147 -ENEAK----EIKKKLDAGASFEELAKQESQDLLSKEKGGDLGYFNSGRMAPEFETAAYKLKVGQISNPVKSPNGYHIIK  221 (285)
T ss_pred             -HHHHH----HHHHHHHCCCCHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCEEECCEEEEEE
T ss_conf             -99999----9999988799999999996899301004861663589876679999998289988687877478169999


Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHCCCCC
Q ss_conf             8223578844578999999999999999--99999999997547750
Q gi|254780396|r  272 ICDKRDLGGEIALKAYLSAQNTPTKIEK--HEAEYVKKLRSNAIIHY  316 (317)
Q Consensus       272 v~~~r~~~~~~~~~~~i~~~l~~~~~~~--~~~~~l~~Lr~~A~I~~  316 (317)
T Consensus       222 ~~dk~~~~~~~~~k~~i~~~i~~~k~~d~~~~~~~i~k~~kkanV~i  268 (285)
T PRK03002        222 LTDKKDLKPYDEVKDSIRKNLEEERIADPIFGKKLLQKELKKANIKI  268 (285)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCC
T ss_conf             84168899989999999999999986677999999999998789843