HHsearch alignment for GI: 254780396 and conserved domain: PRK03095

>PRK03095 prsA peptidylprolyl isomerase; Reviewed.
Probab=100.00  E-value=8.7e-33  Score=226.36  Aligned_cols=239  Identities=14%  Similarity=0.186  Sum_probs=194.3

Q ss_pred             CCCCEEEEECCEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             34826999886786889999999998730350359999999999999998642001223444566899999997313430
Q gi|254780396|r   38 MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA  117 (317)
Q Consensus        38 ~~~~vvA~Vng~~It~~e~~~~~~~~~~~~~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~~~~~~~~~  117 (317)
T Consensus        22 ~~~~~vat~kgg~IT~~e~y~~~k--------~~~g~~~l~~mi~~kvl~~~y-----kVsdkeV~~~~~~~k~qyG---   85 (287)
T PRK03095         22 SSSDKIVTSKAGDITKDEFYEQMK--------TQAGKQVLNNMVMEKVLIKNY-----KVEDKEVDKKYDEMKKQYG---   85 (287)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHC-----CCCHHHHHHHHHHHHHHHH---
T ss_conf             998758984698272999999999--------888999999999999999964-----8789999999999999987---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCHHH
Q ss_conf             35677776531124554699999989999999984320355589998644321110011002333221024675444799
Q gi|254780396|r  118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF  197 (317)
Q Consensus       118 ~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (317)
T Consensus        86 ~~F~~~L~q~glt~e~~K~~ir~~l~~~~a~~~------~itd~e~k~~y~-------p~v~~~hIlv~-------~e~~  145 (287)
T PRK03095         86 DQFDTLLKQQGIKEETLKTGVRAQLAQEKAIEK------TITDKELKENYK-------PEIKASHILVK-------DEAT  145 (287)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHC------CCCHHHHHHHCC-------CCEEEEEEEEC-------CHHH
T ss_conf             999999998799989999999999999999864------288999998649-------86489998889-------9999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEEEEEECC
Q ss_conf             99864357886522332489999852013-2256874675275561367665-112457880123763894899998223
Q gi|254780396|r  198 VQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDK  275 (317)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hiikv~~~  275 (317)
T Consensus       146 Ak----~i~~~l~~G~dF~~lAk~~S~D~~s~~~GG~lg~~~~~~~~~~f~~aaf~Lk~geiS~Pvkt~~GyhIIk~~~k  221 (287)
T PRK03095        146 AK----KVKEELGQGKSFEELAKQYSEDTGSKEKGGDLGFFGPGKMVKEFEDAAYKLKKDEVSEPVKSQFGYHIIKVTDI  221 (287)
T ss_pred             HH----HHHHHHHCCCCHHHHHHHHCCCCCHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCEEECCEEEEEEEEEC
T ss_conf             99----99999987998999999967996502039715657987625999999972899985886760883599998414


Q ss_pred             CCC-CCCHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHCCCCC
Q ss_conf             578-844578999999999999999--99999999997547750
Q gi|254780396|r  276 RDL-GGEIALKAYLSAQNTPTKIEK--HEAEYVKKLRSNAIIHY  316 (317)
Q Consensus       276 r~~-~~~~~~~~~i~~~l~~~~~~~--~~~~~l~~Lr~~A~I~~  316 (317)
T Consensus       222 ~~k~~~~~~~K~~lk~~i~~~k~~D~~~~~~vi~k~lkkanV~i  265 (287)
T PRK03095        222 KEPEKSFEQSKADIKKELVQKKAQDGEFMNDLMMKEIKKADVKV  265 (287)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCC
T ss_conf             78899989999999999999986476999999999999779861