HHsearch alignment for GI: 254780396 and conserved domain: PRK04405

>PRK04405 prsA peptidylprolyl isomerase; Provisional.
Probab=100.00  E-value=3.2e-33  Score=229.10  Aligned_cols=271  Identities=15%  Similarity=0.147  Sum_probs=207.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCEECCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999840232113482699988678688999999999873035035999999999999999864
Q gi|254780396|r   10 SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQE   89 (317)
Q Consensus        10 ~~fi~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvA~Vng~~It~~e~~~~~~~~~~~~~~~~~~~~~l~~LI~~~l~~~~   89 (317)
T Consensus         2 ~~~MKK~~l~~~~~~~~l~-La---aCss~~~~Vat~kg~~IT~~e~y~~~k~-------~~~g~~~l~~mi~~kvl~~~   70 (298)
T PRK04405          2 KKKMKKWALAAASAGLLLS-LA---GCSSNNKTVATYKGGKITESQYYKEMKQ-------SSAGKQTLANMIIYRALEKQ   70 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HH---HCCCCCCEEEEECCCCCCHHHHHHHHHC-------CHHHHHHHHHHHHHHHHHHH
T ss_conf             0678999999999999999-98---7179997699863987259999999864-------42367999999999999998


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             20012234445668999999973134303567777653112455469999998999999998432035558999864432
Q gi|254780396|r   90 IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK  169 (317)
Q Consensus        90 a~~~~i~v~~~~i~~~i~~~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~  169 (317)
T Consensus        71 ---yg~kVsdkeV~~~~~~~k~qyg---~~f~~~L~q~g~te~~~K~~ik~~~l~~~a~k----~~~kvTd~~~k~~y~~  140 (298)
T PRK04405         71 ---YGKKVSTKKVNKQYNSYKKQYG---SSFDSVLSQNGMTTSSFKQNLRTNLLSEAALK----DLKKITTAQLKKAWKS  140 (298)
T ss_pred             ---HCCCCCHHHHHHHHHHHHHHHH---HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH----HCCCCCHHHHHHHHHH
T ss_conf             ---7460679999999999999971---88999999859987999999999999999998----5489888999999985


Q ss_pred             HHHHCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCCCCCC--HHHCCHHH
Q ss_conf             11100110023332210246754447999986435788652233248999985201-3225687467527--55613676
Q gi|254780396|r  170 MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK-IHDVSIGKAQYLL--ESDLHPQF  246 (317)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~g~lg~~~--~~~l~~~~  246 (317)
T Consensus       141 ~~----p~v~~~hIlv~~-------e~~A~----~v~~~l~~G~dF~~lAk~~S~D~~sk~~GG~Lg~f~~~~~~m~~~f  205 (298)
T PRK04405        141 YQ----PKVTVQHILVSK-------KSTAE----TVIKKLKDGKDFAKLAKKYSTDTATKNKGGKLPAFDSTDTTLDSTF  205 (298)
T ss_pred             CC----CCEEEEEEEECC-------HHHHH----HHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCHHH
T ss_conf             49----865889988678-------99999----9999987899789999983889865556862540407998617699


Q ss_pred             HH-HCCCCCCCCC-CCEEECCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHCCCCC
Q ss_conf             65-1124578801-23763894899998223578844578999999999999999--99999999997547750
Q gi|254780396|r  247 QN-LLKKSQNNTT-NPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK--HEAEYVKKLRSNAIIHY  316 (317)
Q Consensus       247 ~~-~~~~~~G~is-~pv~t~~G~hiikv~~~r~~~~~~~~~~~i~~~l~~~~~~~--~~~~~l~~Lr~~A~I~~  316 (317)
T Consensus       206 ~~aaf~Lk~geis~~PvkT~~GYhIIK~~~~~~k~~~~~~K~~l~~~i~~~k~~D~~~~~~vi~k~lk~anVki  279 (298)
T PRK04405        206 KTAAFKLKNGEYTTTPVKTTYGYEVIKMIKHPAKGKFTDHKKELTKQIYAKWASDSTVMQNVISKVLKKANVSI  279 (298)
T ss_pred             HHHHHCCCCCCCCCCCEECCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCC
T ss_conf             99997488998168845216733999983457779889999999999999873087999999999999779871