HHsearch alignment of GI: 254780396 and MMDB domain: 3gpk_A_

>3gpk_A (A:) PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444}
Probab=99.45  E-value=1.6e-13  Score=104.06  Aligned_cols=104  Identities=12%  Similarity=0.137  Sum_probs=85.3

Q ss_pred             CCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCC
Q ss_conf             011002333221024675444799998643578865223324899998520132256874675275561367665-1124
Q gi|254780396|r  174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKK  252 (317)
Q Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~  252 (317)
                      .+..+.++||++..+...   .......+.........+..|...+..++...+...+|++||+..+.+++.|.+ ++++
T Consensus         4 ~p~~v~~~~I~i~~~~~~---~~~~~~~a~~i~~~l~~g~~F~~lA~~yS~~~~~~~~g~~g~~~~~~l~~~~~~~~~~l   80 (112)
T 3gpk_A            4 GTEEYRIGEIFLAATEEN---KPQVFANAEKIVEQLKQGGSFVAYARQYSEASTAAVGGDLGWIRLAQLPTELATTAASX   80 (112)
T ss_dssp             -CCEEEEEEEEEECCGGG---HHHHHHHHHHHHHHHHTTCCHHHHHHHHCCSTTGGGTTEEEEECGGGSCHHHHHHHHHC
T ss_pred             CCCEEEEEEEEEECCCCC---HHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             863787999998189425---79999999999999986999899999856353323332100003441046999999818


Q ss_pred             CCCCCCCCEEECCEEEEEEEECCCCCCC
Q ss_conf             5788012376389489999822357884
Q gi|254780396|r  253 SQNNTTNPYVTQKGVEYIAICDKRDLGG  280 (317)
Q Consensus       253 ~~G~is~pv~t~~G~hiikv~~~r~~~~  280 (317)
                      ++|++|+||++++||||++|.++++...
T Consensus        81 ~~Gevs~pi~~~~G~~Iikv~~~~~~~~  108 (112)
T 3gpk_A           81 GPGQLAGPVEIRGGFSILYLIDKREGHH  108 (112)
T ss_dssp             CTTCEEEEEEETTEEEEEEEEEEECCSC
T ss_pred             CCCCCCCCEEECCEEEEEEEEEEECCCC
T ss_conf             9998186589899999999964876736