Query         gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 317
No_of_seqs    145 out of 3262
Neff          10.2
Searched_HMMs 33803
Date          Wed Jun  1 12:57:40 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780396.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2itk_A Peptidyl-prolyl CIS-tr  99.5 7.1E-17 2.1E-21  125.2  -5.1  162  113-274     3-167 (167)
  2 >1j6y_A Peptidyl-prolyl CIS-tr  99.5 3.9E-16 1.2E-20  120.5  -3.2  135  132-274     3-139 (139)
  3 >3gpk_A PPIC-type peptidyl-pro  99.5 1.6E-13 4.6E-18  104.1   6.8  104  174-280     4-108 (112)
  4 >2pv1_A Chaperone SURA; surviV  99.4 1.7E-13   5E-18  103.8   6.7  100  177-276     2-103 (103)
  5 >1m5y_A SurviVal protein, surv  99.4   3E-13 8.7E-18  102.3   7.0  105  175-279     3-109 (110)
  6 >1m5y_A SurviVal protein, surv  99.4 3.1E-13 9.1E-18  102.2   7.0  103  175-279     4-109 (111)
  7 >2jzv_A Foldase protein PRSA;   99.4 4.5E-13 1.3E-17  101.2   5.9  101  174-274     4-111 (111)
  8 >1yw5_A Peptidyl prolyl CIS/tr  99.3 3.6E-12 1.1E-16   95.4   6.9   79  196-274    36-116 (116)
  9 >1jns_A Peptidyl-prolyl CIS-tr  99.3 6.9E-12   2E-16   93.6   6.6   76  201-276    16-92  (92)
 10 >2kgj_A Peptidyl-prolyl CIS-tr  99.2 9.2E-12 2.7E-16   92.8   5.5   94  176-280     4-98  (102)
 11 >1zk6_A Foldase protein PRSA;   99.1 1.1E-10 3.2E-15   86.1   5.5   89  176-275     3-93  (93)
 12 >1eq3_A Peptidyl-prolyl CIS/tr  99.0 3.3E-10 9.8E-15   83.0   5.1   72  204-276    18-96  (96)
 13 >1m5y_A SurviVal protein, surv  98.9 2.4E-09   7E-14   77.6   7.0   62   37-98      3-72  (78)
 14 >1m5y_A SurviVal protein, surv  98.7 4.8E-08 1.4E-12   69.3   7.6   72   97-168     1-72  (93)
 15 >2nsa_A Trigger factor, TF; ch  98.1 4.7E-05 1.4E-09   50.4  11.0  103   47-149    41-161 (170)
 16 >1zxj_A MPN555, hypothetical p  92.8    0.58 1.7E-05   24.5  10.2   93   73-177    82-175 (218)
 17 >1t11_A Trigger factor, TF; he  91.0    0.94 2.8E-05   23.2   8.1  123   48-177    12-158 (166)
 18 >3gbg_A TCP pilus virulence re  42.2      19 0.00055   14.9   6.5   43  107-149   189-231 (276)
 19 >2voz_A FUTA2, periplasmic iro  32.4      27 0.00079   14.0   2.2   32   83-114    48-79  (346)
 20 >1tq4_A IIGP1, interferon-indu  31.4      24  0.0007   14.3   1.6   45   99-143    10-54  (117)
 21 >2qac_A Myosin A tail domain i  24.5      32 0.00095   13.4   1.3   39   86-124    27-65  (67)

No 1  
>>2itk_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} (A:)
Probab=99.53  E-value=7.1e-17  Score=125.20  Aligned_cols=162  Identities=9%  Similarity=-0.006  Sum_probs=112.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             13430356777765311245546999999899999999843203555899986443211100110023332210246754
Q gi|254780396|r  113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL  192 (317)
Q Consensus       113 ~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  192 (317)
                      +++..+.+...+...+++...+++.++..+.+..+........+..+...+...+..........+...+..+..+....
T Consensus         3 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (167)
T 2itk_A            3 HGMADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKI   82 (167)
T ss_dssp             --------CCTTEEEEECTTTCCEEEEETTTCCEESSCCC------------CCSCEEEEEEEECCTTSSSCCCSSCSSC
T ss_pred             CCCCCCCCCCCCCEEEECCCCCCEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
T ss_conf             88888889998848988288895788726776377663256653334543333554443321476326567744233332


Q ss_pred             CC-HHHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEE
Q ss_conf             44-799998643578865223324899-998520132256874675275561367665-112457880123763894899
Q gi|254780396|r  193 QN-QGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEY  269 (317)
Q Consensus       193 ~~-~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hi  269 (317)
                      .. .......+............+... +..++.+++...||++||+..++++|.|.+ ++++++|++|+||+|++||||
T Consensus        83 ~~~~~~~~~~a~~~~~~l~~g~~f~~~aa~~~s~~~sa~~gG~lg~~~~~~l~~~~~~~~~~l~~Geis~pi~t~~G~~i  162 (167)
T 2itk_A           83 TRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHI  162 (167)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHCSSGGGGGTTEEEEECTTSSCHHHHHHHHHSCTTCBCCCEEETTEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHCCCCCCCCCCEECCCCEEE
T ss_conf             00299999999999998750212499999870778543322011135434346999999981899983787886991799


Q ss_pred             EEEEC
Q ss_conf             99822
Q gi|254780396|r  270 IAICD  274 (317)
Q Consensus       270 ikv~~  274 (317)
                      |+|+|
T Consensus       163 ikv~d  167 (167)
T 2itk_A          163 ILRTE  167 (167)
T ss_dssp             EEECC
T ss_pred             EEEEC
T ss_conf             99949


No 2  
>>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} (A:)
Probab=99.50  E-value=3.9e-16  Score=120.52  Aligned_cols=135  Identities=9%  Similarity=-0.021  Sum_probs=105.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH-HHH
Q ss_conf             5546999999899999999843203555899986443211100110023332210246754447999986435788-652
Q gi|254780396|r  132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE-SRL  210 (317)
Q Consensus       132 ~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  210 (317)
                      +.|++.++.++++++++...+.+.+.+|+.++..+|+.+...+. .+..+++++...       ........+... ...
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~i~vtd~ei~~~y~~~~~~~~-~~~~~~I~~~~~-------~~a~~~~~~~~~~~~~   74 (139)
T 1j6y_A            3 SSHHHHHHSSGLVPRGSHMASRDQVKASHILIKHQGSRRKASWK-DPEGKIILTTTR-------EAAVEQLKSIREDIVS   74 (139)
T ss_dssp             -----------------CCSSCCSCEEECCEECSCTTSSSSSCS-CCCSCCCSCCCH-------HHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCHHCC-CCCCCCCCCCCH-------HHHHHHHHHHHHHHHC
T ss_conf             65443321257677765547801289998998157755520002-432111120229-------9999999999999874


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEEEEEEC
Q ss_conf             23324899998520132256874675275561367665-11245788012376389489999822
Q gi|254780396|r  211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICD  274 (317)
Q Consensus       211 ~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hiikv~~  274 (317)
                      ....+.+.+..++..+....||++||+..+.+++.+.+ ++++++|++|+||++++|||||+|+.
T Consensus        75 ~~~~F~~~a~~~s~~~~~~~~g~~~~~~~~~l~~~~~~~~~~l~~Geis~pi~~~~g~~Iikv~a  139 (139)
T 1j6y_A           75 GKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRTA  139 (139)
T ss_dssp             SCCCCHHHHHHSSCHHHHHTCSEEEECSSSSSCTHHHHHHHHCCSSSCCSCEEETTEEECCCSCC
T ss_pred             CCCCHHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCEEEEEEEEC
T ss_conf             84279999999584100256861204612416789999998488998476579599079999939


No 3  
>>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} (A:)
Probab=99.45  E-value=1.6e-13  Score=104.06  Aligned_cols=104  Identities=12%  Similarity=0.137  Sum_probs=85.3

Q ss_pred             CCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCC
Q ss_conf             011002333221024675444799998643578865223324899998520132256874675275561367665-1124
Q gi|254780396|r  174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKK  252 (317)
Q Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~  252 (317)
                      .+..+.++||++..+...   .......+.........+..|...+..++...+...+|++||+..+.+++.|.+ ++++
T Consensus         4 ~p~~v~~~~I~i~~~~~~---~~~~~~~a~~i~~~l~~g~~F~~lA~~yS~~~~~~~~g~~g~~~~~~l~~~~~~~~~~l   80 (112)
T 3gpk_A            4 GTEEYRIGEIFLAATEEN---KPQVFANAEKIVEQLKQGGSFVAYARQYSEASTAAVGGDLGWIRLAQLPTELATTAASX   80 (112)
T ss_dssp             -CCEEEEEEEEEECCGGG---HHHHHHHHHHHHHHHHTTCCHHHHHHHHCCSTTGGGTTEEEEECGGGSCHHHHHHHHHC
T ss_pred             CCCEEEEEEEEEECCCCC---HHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             863787999998189425---79999999999999986999899999856353323332100003441046999999818


Q ss_pred             CCCCCCCCEEECCEEEEEEEECCCCCCC
Q ss_conf             5788012376389489999822357884
Q gi|254780396|r  253 SQNNTTNPYVTQKGVEYIAICDKRDLGG  280 (317)
Q Consensus       253 ~~G~is~pv~t~~G~hiikv~~~r~~~~  280 (317)
                      ++|++|+||++++||||++|.++++...
T Consensus        81 ~~Gevs~pi~~~~G~~Iikv~~~~~~~~  108 (112)
T 3gpk_A           81 GPGQLAGPVEIRGGFSILYLIDKREGHH  108 (112)
T ss_dssp             CTTCEEEEEEETTEEEEEEEEEEECCSC
T ss_pred             CCCCCCCCEEECCEEEEEEEEEEECCCC
T ss_conf             9998186589899999999964876736


No 4  
>>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} (A:)
Probab=99.45  E-value=1.7e-13  Score=103.84  Aligned_cols=100  Identities=13%  Similarity=0.177  Sum_probs=81.5

Q ss_pred             CHHHHHHHHHCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCC
Q ss_conf             0023332210246754447-99998643578865223324899998520132256874675275561367665-112457
Q gi|254780396|r  177 EYLIRTVLFSIPDNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQ  254 (317)
Q Consensus       177 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~  254 (317)
                      ++.++||++..+....... ....+.+.+.......+..|...+..+|..++...+|++||+..+.+|+.+.+ ++.+++
T Consensus         2 ~v~~~hI~i~~~~~~~~~~~~~~~~~a~~i~~~l~~g~~F~~la~~~S~d~~~~~~g~~g~~~~~~l~~~~~~~i~~l~~   81 (103)
T 2pv1_A            2 ELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKK   81 (103)
T ss_dssp             CEEEEEEEEECCSSCCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHCCSTTGGGTTEEEEECGGGSCHHHHHHTTTCCT
T ss_pred             CEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             16899999958989998999999999999999988699989996443136653322321213322353256666632689


Q ss_pred             CCCCCCEEECCEEEEEEEECCC
Q ss_conf             8801237638948999982235
Q gi|254780396|r  255 NNTTNPYVTQKGVEYIAICDKR  276 (317)
Q Consensus       255 G~is~pv~t~~G~hiikv~~~r  276 (317)
                      |++|+||++++||||++|+++|
T Consensus        82 G~vs~pi~~~~g~~Iikv~~rr  103 (103)
T 2pv1_A           82 GDIVGPIRSGVGFHILKVNDLR  103 (103)
T ss_dssp             TCEEEEEEETTEEEEEEEEEEC
T ss_pred             CCCCCCEEECCEEEEEEEEEEC
T ss_conf             9888748989999999996679


No 5  
>>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} (A:149-258)
Probab=99.43  E-value=3e-13  Score=102.31  Aligned_cols=105  Identities=12%  Similarity=0.158  Sum_probs=85.6

Q ss_pred             CCCHHHHHHHHHCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCC
Q ss_conf             110023332210246754447-99998643578865223324899998520132256874675275561367665-1124
Q gi|254780396|r  175 VREYLIRTVLFSIPDNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKK  252 (317)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~  252 (317)
                      +..+.++|+++..+....... ......+............|...+..++...+...+|++||+..+.+|+.+.+ ++++
T Consensus         3 ~~~v~~~~Ili~~~~~~~~~~~~~~~~~A~~i~~~l~~g~~F~~la~~ys~d~~~~~~g~~g~~~~~~l~~~~~~~~~~L   82 (110)
T 1m5y_A            3 STELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTA   82 (110)
T ss_dssp             -CCEEEEEEEEECCSSCCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHCCSTTGGGTTEEEEECGGGSCHHHHTGGGTC
T ss_pred             CHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCCCCHHHHHCHHHHHHHHHH
T ss_conf             01232221101100110125688898888889998740126899988703472655167421000443010567777762


Q ss_pred             CCCCCCCCEEECCEEEEEEEECCCCCC
Q ss_conf             578801237638948999982235788
Q gi|254780396|r  253 SQNNTTNPYVTQKGVEYIAICDKRDLG  279 (317)
Q Consensus       253 ~~G~is~pv~t~~G~hiikv~~~r~~~  279 (317)
                      ++|++|+||++++||||++|+++++..
T Consensus        83 ~~GevS~pi~~~~g~~Iikl~~~~~~~  109 (110)
T 1m5y_A           83 KKGDIVGPIRSGVGFHILKVNDLRGES  109 (110)
T ss_dssp             CTTCEEEEEEETTEEEEEEEEEECCCC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             357645620155358999999876010


No 6  
>>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} (A:259-369)
Probab=99.43  E-value=3.1e-13  Score=102.21  Aligned_cols=103  Identities=14%  Similarity=0.192  Sum_probs=80.5

Q ss_pred             CCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCCC-CCCCCCCCCCCCHHHCCHHHHH-HCC
Q ss_conf             11002333221024675444799998643578865223-32489999852013-2256874675275561367665-112
Q gi|254780396|r  175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL-PKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQN-LLK  251 (317)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~-~~~~~g~lg~~~~~~l~~~~~~-~~~  251 (317)
                      +..+.++|+++..+..  ..++...+.+.+........ ..|...+..+|..+ +...+|++||+..+++|+.+.+ ++.
T Consensus         4 ~~~~~~~~Ili~~~~~--~~~~~a~~~a~~~~~~l~~g~~~F~~lA~~~S~d~~s~~~~g~lg~~~~~~l~~~~~~~~~~   81 (111)
T 1m5y_A            4 VTEVHARHILLKPSPI--MTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTR   81 (111)
T ss_dssp             CEEEEEEEEEECCCSS--SCHHHHHHHHHHHHHHHHTTSSCHHHHHHHHCCCTTTGGGTTEEEEECGGGSCHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCH--HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHC
T ss_conf             0367888765113200--23379999999999988606344999998728996520126756777745378899999980


Q ss_pred             CCCCCCCCCEEECCEEEEEEEECCCCCC
Q ss_conf             4578801237638948999982235788
Q gi|254780396|r  252 KSQNNTTNPYVTQKGVEYIAICDKRDLG  279 (317)
Q Consensus       252 ~~~G~is~pv~t~~G~hiikv~~~r~~~  279 (317)
                      +++|++|+||++++|||||+|+++++..
T Consensus        82 l~~Gevs~pi~~~~G~~Iikv~~~~~~~  109 (111)
T 1m5y_A           82 LNKGQMSAPVHSSFGWHLIELLDTRNVD  109 (111)
T ss_dssp             CCTTCBCCCEECSSCEEEEEEEEEEECC
T ss_pred             CCCCCCCCCEECCCEEEEEEEEEEECCC
T ss_conf             8999908747748838999998750688


No 7  
>>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} (A:)
Probab=99.39  E-value=4.5e-13  Score=101.18  Aligned_cols=101  Identities=11%  Similarity=0.114  Sum_probs=76.5

Q ss_pred             CCCCHHHHHHHHHCCCC----CCCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCCC-CCCCCCCCCCCCHHHCCHHHH
Q ss_conf             01100233322102467----5444799998643578865223-32489999852013-225687467527556136766
Q gi|254780396|r  174 TVREYLIRTVLFSIPDN----KLQNQGFVQKRIKDAEESRLRL-PKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQ  247 (317)
Q Consensus       174 ~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~-~~~~~g~lg~~~~~~l~~~~~  247 (317)
                      .+..+.++|+++..+..    ...........+.......... ..|...+..+|... +...||++||+..+.+++.|+
T Consensus         4 ~~~~v~~~hIli~~~~~~~~~~~~~~~~a~~~a~~~~~~i~~g~~~F~~lA~~yS~d~~s~~~gG~lg~~~~~~~~~~~~   83 (111)
T 2jzv_A            4 GSDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFE   83 (111)
T ss_dssp             CCSEEEEEEEEEEBCSCSSCSSSBCHHHHHHHHHHHHHHHHSCTTSHHHHHHHHCSCHHHHTTTTEEEEEETTSSCHHHH
T ss_pred             CCCEEEEEEEEEECCCCCCCHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             74502688999806887770100479999999999999998295239999999786941013486457767663269999


Q ss_pred             H-HCCCCCCCCCCCEEECCEEEEEEEEC
Q ss_conf             5-11245788012376389489999822
Q gi|254780396|r  248 N-LLKKSQNNTTNPYVTQKGVEYIAICD  274 (317)
Q Consensus       248 ~-~~~~~~G~is~pv~t~~G~hiikv~~  274 (317)
                      + ++++++|++|+||+|++||||++|++
T Consensus        84 ~a~~~L~~Geis~pi~t~~G~hIikv~e  111 (111)
T 2jzv_A           84 KALFKLKDGEVSEVVKSSFGYHIIKADK  111 (111)
T ss_dssp             HHHHTCCTTCBCCCEEETTEEEEEEECC
T ss_pred             HHHHHCCCCCCCCCEEECCEEEEEEEEC
T ss_conf             9998489998288788599889999849


No 8  
>>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} (A:62-177)
Probab=99.32  E-value=3.6e-12  Score=95.41  Aligned_cols=79  Identities=14%  Similarity=0.104  Sum_probs=61.6

Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEEEEEE
Q ss_conf             999986435788652233-24899998520132256874675275561367665-1124578801237638948999982
Q gi|254780396|r  196 GFVQKRIKDAEESRLRLP-KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAIC  273 (317)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hiikv~  273 (317)
                      ......+.+......... .+...+..+++.++...||++||+..+.+++.|.+ ++++++|++|+||+|++|||||+|+
T Consensus        36 ~~~~~~a~~~~~~l~~g~~~f~~~a~~~sd~~s~~~gG~lg~~~~~~l~~~~~~~~~~l~~Geis~pi~t~~GyhIikv~  115 (116)
T 1yw5_A           36 DESIQILKKHLERILSGEVKLSELANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRT  115 (116)
T ss_dssp             HHHHHHHHHHHHHHHHTSSCHHHHHHHHCCSGGGGGTTEEEEECTTSSCHHHHHHHHTSCTTCBCCCEEETTEEEEEEEC
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHHCCHHHHHHHHCCCCCCCCCCEEECCEEEEEEEE
T ss_conf             99999999999998647340899988717555124465322233433589999999828989857757828908999984


Q ss_pred             C
Q ss_conf             2
Q gi|254780396|r  274 D  274 (317)
Q Consensus       274 ~  274 (317)
                      .
T Consensus       116 g  116 (116)
T 1yw5_A          116 G  116 (116)
T ss_dssp             C
T ss_pred             C
T ss_conf             9


No 9  
>>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} (A:)
Probab=99.28  E-value=6.9e-12  Score=93.65  Aligned_cols=76  Identities=16%  Similarity=0.069  Sum_probs=65.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEEEEEECCC
Q ss_conf             643578865223324899998520132256874675275561367665-1124578801237638948999982235
Q gi|254780396|r  201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKR  276 (317)
Q Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hiikv~~~r  276 (317)
                      .+.+.......+..|...+..++...+...+|++||+..+.+|+.+.+ ++++++|++|+||++++||||++|+++|
T Consensus        16 ~A~~i~~~l~~g~~F~~la~~yS~~~~~~~~G~lg~~~~~~l~~~~~~~~~~l~~geis~pi~~~~g~~Iikv~~~r   92 (92)
T 1jns_A           16 LALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN   92 (92)
T ss_dssp             HHHHHHHHHHHTCCHHHHHHHHHCSTTTTTGGGCCEEETTSSCHHHHHHHHHSCTTCCEEEEEETTEEEEEEEECCC
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCEECCCCCCHHHHHHHHHCCCCCCCCCEEECCEEEEEEEEECC
T ss_conf             99999999887998999999848996424688031462220358999999848999967767809848999997369


No 10 
>>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} (A:)
Probab=99.24  E-value=9.2e-12  Score=92.84  Aligned_cols=94  Identities=9%  Similarity=0.032  Sum_probs=72.0

Q ss_pred             CCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHCCHHHHHHCCCCC
Q ss_conf             100233322102467544479999864357886522332489999852013-2256874675275561367665112457
Q gi|254780396|r  176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ  254 (317)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~g~lg~~~~~~l~~~~~~~~~~~~  254 (317)
                      ..+.++||++..       .    ..+.........+..|...+..++... +...||++||+..+.+|+.+++++.+++
T Consensus         4 ~~v~~~~I~~~~-------~----~~A~~~~~~l~~g~~F~~lA~~~S~d~~~~~~gG~lg~~~~~~l~~~~~~~~~l~~   72 (102)
T 2kgj_A            4 QRTRYSIIQTKT-------E----DEAKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEK   72 (102)
T ss_dssp             CEEEEEEEEESS-------H----HHHHHHHHHHHHTSCHHHHHHHTCTTHHHHTTTSEEEEEETTCCCHHHHTTCCCST
T ss_pred             CEEEEEEEEECC-------H----HHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHCC
T ss_conf             168752164089-------9----99999999988799999999986789652344775523558888979999998289


Q ss_pred             CCCCCCEEECCEEEEEEEECCCCCCC
Q ss_conf             88012376389489999822357884
Q gi|254780396|r  255 NNTTNPYVTQKGVEYIAICDKRDLGG  280 (317)
Q Consensus       255 G~is~pv~t~~G~hiikv~~~r~~~~  280 (317)
                      |++|+||++++||||++|.++++...
T Consensus        73 G~vs~pi~~~~G~~I~~v~~~~~~~~   98 (102)
T 2kgj_A           73 GQLSGVIKSSVGFLIVRLDDIQAAHH   98 (102)
T ss_dssp             TCEEEEEEETTEEEEEEEEEEECSST
T ss_pred             CCCCCCEEECCEEEEEEEEEEECCCC
T ss_conf             98343579799999999936865554


No 11 
>>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} (A:)
Probab=99.10  E-value=1.1e-10  Score=86.11  Aligned_cols=89  Identities=13%  Similarity=0.181  Sum_probs=66.6

Q ss_pred             CCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCCCCCHHHCCHHHHH-HCCCC
Q ss_conf             10023332210246754447999986435788652233248999985201322-56874675275561367665-11245
Q gi|254780396|r  176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD-VSIGKAQYLLESDLHPQFQN-LLKKS  253 (317)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~g~lg~~~~~~l~~~~~~-~~~~~  253 (317)
                      ..+.++|+++.       .+    ..+............|...+..++.+... ..||++||+..+.++|.+.+ +++++
T Consensus         3 ~~v~~~~I~~~-------~~----~~A~~~~~~l~~g~~F~~lA~~yS~d~~~~~~gg~~g~~~~~~l~~~~~~~~~~l~   71 (93)
T 1zk6_A            3 GKIRASHILVA-------DK----KTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLK   71 (93)
T ss_dssp             CCEEEEEEEES-------SH----HHHHHHHHHHHHTCCHHHHHHHHCCSGGGGGTTEEEEECTTTSSCTTHHHHHHHSC
T ss_pred             CEEEEEEEEEC-------CH----HHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCEECCCCCCCHHHHHHHHCCC
T ss_conf             72899999988-------98----99999999998699999999773438743458622211027834468999985189


Q ss_pred             CCCCCCCEEECCEEEEEEEECC
Q ss_conf             7880123763894899998223
Q gi|254780396|r  254 QNNTTNPYVTQKGVEYIAICDK  275 (317)
Q Consensus       254 ~G~is~pv~t~~G~hiikv~~~  275 (317)
                      +|++|+||++++||||++|.+|
T Consensus        72 ~G~vs~pi~~~~g~~Ii~v~~r   93 (93)
T 1zk6_A           72 TGEVSDPVKTQYGYHIIKKTEE   93 (93)
T ss_dssp             TTCBCCCEECSSCEEEEEEEEC
T ss_pred             CCCCCCCEEECCEEEEEEEECC
T ss_conf             9983776896998999999478


No 12 
>>1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} (A:)
Probab=99.02  E-value=3.3e-10  Score=83.01  Aligned_cols=72  Identities=13%  Similarity=0.143  Sum_probs=58.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCC------CEEECCEEEEEEEECCC
Q ss_conf             578865223324899998520132256874675275561367665-11245788012------37638948999982235
Q gi|254780396|r  204 DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTN------PYVTQKGVEYIAICDKR  276 (317)
Q Consensus       204 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~------pv~t~~G~hiikv~~~r  276 (317)
                      +.......+.+|...+..++.+... ..|.+||+..+.+++.|.+ ++++++|++|.      |+++++||||++|+++|
T Consensus        18 ~i~~~l~~G~~F~~lA~~~S~d~~~-~~gg~g~~~~~~l~~~~~~~~~~l~~g~vS~~~~~~~pv~s~~G~hIikv~~~r   96 (96)
T 1eq3_A           18 EAMEKLKSGMRFNEVAAQYSEDKAR-QGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK   96 (96)
T ss_dssp             HHHHHHTTTTSHHHHHHHHCCCTTT-CCSEEEEESSCCSSSHHHHHHHHCCSCCSSTTTBCSSCEEETTEEEEEEEEECC
T ss_pred             HHHHHHHCCCCHHHHHHHHCCCHHH-CCCCCCEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCEEECCEEEEEEEEEEC
T ss_conf             9999988799999999985754043-189744067552567999999847887524666668976708878999996689


No 13 
>>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} (A:1-70,A:401-408)
Probab=98.94  E-value=2.4e-09  Score=77.58  Aligned_cols=62  Identities=18%  Similarity=0.303  Sum_probs=53.3

Q ss_pred             CCCCCEEEEECCEECCHHHHHHHHHHHHHHC--------CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             1348269998867868899999999987303--------5035999999999999999864200122344
Q gi|254780396|r   37 AMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLKKQEIEKSGITFD   98 (317)
Q Consensus        37 ~~~~~vvA~Vng~~It~~e~~~~~~~~~~~~--------~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~   98 (317)
                      ...++|||+|||++||.+|+++++.....+.        ....+++++|++||+++|+.|+|++.|+..-
T Consensus         3 ~~~d~IvAvVNge~It~sel~~~~~~~~~~~~~~~~~~~~~~~lr~qvLd~LI~~~Ll~Q~A~k~gI~~~   72 (78)
T 1m5y_A            3 QVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKAY   72 (78)
T ss_dssp             --CCCEEEEESSSEEEHHHHHHHHHHHHHHHHTTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCSC
T ss_pred             CCCCEEEEEECCEEECHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             5346389999999738999999999999987633568984599999999999999999999998499983


No 14 
>>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} (A:71-132,A:370-400)
Probab=98.72  E-value=4.8e-08  Score=69.33  Aligned_cols=72  Identities=11%  Similarity=0.176  Sum_probs=67.0

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             444566899999997313430356777765311245546999999899999999843203555899986443
Q gi|254780396|r   97 FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ  168 (317)
Q Consensus        97 v~~~~i~~~i~~~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~  168 (317)
                      |++.+|++++..+++++++|.++|.+.|.+.|++++.|++.|+.+++|+++++..+.+++.|........|.
T Consensus         1 VsD~EVD~aI~~IAqqN~lT~eql~~~L~~qGis~e~fR~qIR~eIl~~rL~q~~V~skI~V~~~~~~~~~~   72 (93)
T 1m5y_A            1 ISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITIDAAQKDRAYR   72 (93)
T ss_dssp             CCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHTCCC------HHHH
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
T ss_conf             699999999999998705247999999997499878888888999999998743000001344657999999


No 15 
>>2nsa_A Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} (A:)
Probab=98.14  E-value=4.7e-05  Score=50.38  Aligned_cols=103  Identities=10%  Similarity=0.085  Sum_probs=83.5

Q ss_pred             CCEECCHHHHHHHHHHHHH----HC--------------CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             8678688999999999873----03--------------50359999999999999998642001223444566899999
Q gi|254780396|r   47 NGEVITDGDISKRIALLKL----QK--------------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQ  108 (317)
Q Consensus        47 ng~~It~~e~~~~~~~~~~----~~--------------~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~  108 (317)
                      ...+|+.+-+++.+.....    +.              -...++.++++.++...++.+.|++.||.|+++++++.+..
T Consensus        41 ~~~~iP~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~a~~~lk~~lil~~ia~~e~I~Vs~eei~~~i~~  120 (170)
T 2nsa_A           41 VEIEISDRTLEILVNEAINRLKREGRYEQIVSSYESEEKFREELKERILDDIKRDRVIEVLAQEKGISVNDEELEKEAEE  120 (170)
T ss_dssp             CCCCCCHHHHHHHHHHHHHHHHHHTCHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             88899889999999999999999876455554424689888889999999999999999999885788999999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99731343035677776531124554699999989999999
Q gi|254780396|r  109 HARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK  149 (317)
Q Consensus       109 ~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~  149 (317)
                      ++.++|.+.+.+...+..+|.....+++.+..+..+..++.
T Consensus       121 ~a~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~kv~~~l~~  161 (170)
T 2nsa_A          121 LAPFWGISPDRAKSLVKARQDLREELRWAILKRKVLDLLLQ  161 (170)
T ss_dssp             HHHHHTSCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99886999999999998588999999999999999999999


No 16 
>>1zxj_A MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae} (A:)
Probab=92.85  E-value=0.58  Score=24.49  Aligned_cols=93  Identities=9%  Similarity=-0.044  Sum_probs=59.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999864200122344456689999999731343035677776531124554699999989999999984
Q gi|254780396|r   73 EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF  152 (317)
Q Consensus        73 ~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~  152 (317)
                      ..+..+.++.+.++........+.+++..++..+..+..+...+            .....+++.....+.++-++....
T Consensus        82 ~~~~~~~~~~~~i~~~l~~~~~~~lpe~~i~~e~~~~~~~~~~~------------~~~e~~~~~aek~lk~~lil~~ia  149 (218)
T 1zxj_A           82 THIVIKDNLFSCAMNAIVGYFEFNIDEAELKNVMEGLKRDVIQG------------AEDNTVQAIAEKIIKKALVFNHLQ  149 (218)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGEEEECCHHHHHHHHHHHHHC-----------------CCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999874888899999999999988999865------------013678999999999999999999


Q ss_pred             -HHHCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             -3203555899986443211100110
Q gi|254780396|r  153 -MLKYGNLEMEIPANKQKMKNITVRE  177 (317)
Q Consensus       153 -~~~i~~~~~e~~~~~~~~~~~~~~~  177 (317)
                       ..++.+++.++..+...........
T Consensus       150 ~~e~i~vt~eei~~~i~~~a~~~~~~  175 (218)
T 1zxj_A          150 KEWKVEITDEVVKNVISLYYEKTNQS  175 (218)
T ss_dssp             HHHTCCCCHHHHHHHHHHHHHHSCSC
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98089999999999999988337899


No 17 
>>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} (A:121-151,A:258-392)
Probab=90.99  E-value=0.94  Score=23.16  Aligned_cols=123  Identities=11%  Similarity=0.068  Sum_probs=70.5

Q ss_pred             CEECCHHHHHHHHHHHHHHCC-------HHHHHHHH-----------HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             678688999999999873035-------03599999-----------999999999986420012234445668999999
Q gi|254780396|r   48 GEVITDGDISKRIALLKLQKI-------NGELEKIA-----------VQELIVETLKKQEIEKSGITFDSNTVNYFFVQH  109 (317)
Q Consensus        48 g~~It~~e~~~~~~~~~~~~~-------~~~~~~~~-----------l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~  109 (317)
                      .-.+|..|+...+..+..+..       ...++..+           .+......++.+.+....+.+++..+++.+..+
T Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~TleeLk~~ire~le~~~~~~~~~~~~~~ild~L~e~~~~dlPeslv~~e~~~l   91 (166)
T 1t11_A           12 AAEVTDADVAEMLETLRKQQRFGVAEGGVDALKAEVRKNMERELKQAIKARIKEQAIEGLVKENEIQVPSALIDQEINVL   91 (166)
T ss_dssp             CC---CTHHHHHHHHHHHHHGGSTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCTTBCSCCCEEECHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             43432078999999987652708754557899999999999999999998888789999997436679807899999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH-HHHCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             973134303567777653112455-----4699999989999999984-3203555899986443211100110
Q gi|254780396|r  110 ARNTGLSAEDFSSFLDKQGIGDNH-----FKQYLAIQSIWPDVVKNDF-MLKYGNLEMEIPANKQKMKNITVRE  177 (317)
Q Consensus       110 ~~~~~~~~~~~~~~l~~~g~t~~~-----~~~~i~~~l~~~~~~~~~~-~~~i~~~~~e~~~~~~~~~~~~~~~  177 (317)
                      ..+       +.+.+...|++.++     +++.....+.+.-++.... ..++.+++.++..++.......+.+
T Consensus        92 ~~~-------~~~~l~~~g~~~ee~~~ee~~~~Aek~vK~~lil~~IA~~e~I~vseeEi~~~i~~~A~~yg~~  158 (166)
T 1t11_A           92 RQQ-------AAQRFGGNVEAAAQLPRELFEEQAKRRVVVGLLLGEVIRTHELKADEEKVKALITEMATAYEDP  158 (166)
T ss_dssp             HHH-------HHHHSSCSHHHHTTSCGGGTHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHCC---
T ss_pred             HHH-------HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCH
T ss_conf             999-------9988277834444667889999999999999999999999789889999999999999846998


No 18 
>>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, cytoplasm, DNA-binding, transcription; HET: PAM; 1.90A {Vibrio cholerae O395} (A:)
Probab=42.16  E-value=19  Score=14.93  Aligned_cols=43  Identities=7%  Similarity=-0.017  Sum_probs=36.2

Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999731343035677776531124554699999989999999
Q gi|254780396|r  107 VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK  149 (317)
Q Consensus       107 ~~~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~  149 (317)
                      ..++...+++...+...+++.|.|+.+|...+|-+.+...+..
T Consensus       189 ~~lA~~~~~S~~~l~r~fk~~G~s~~~~i~~~Rl~~A~~lL~~  231 (276)
T 3gbg_A          189 ADICGELRTNRMILKKELESRGVKFRELINSIRISYSISLMKT  231 (276)
T ss_dssp             HHHHHHHTCCHHHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             9999997979999999999949989999999999999999876


No 19 
>>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* (A:)
Probab=32.44  E-value=27  Score=13.96  Aligned_cols=32  Identities=13%  Similarity=-0.036  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99998642001223444566899999997313
Q gi|254780396|r   83 ETLKKQEIEKSGITFDSNTVNYFFVQHARNTG  114 (317)
Q Consensus        83 ~~l~~~~a~~~~i~v~~~~i~~~i~~~~~~~~  114 (317)
                      +.++....++.++.|..++....+........
T Consensus        48 ~~~~~~F~~~~~i~v~~~~~~~~l~~~~~~g~   79 (346)
T 2voz_A           48 DALYDAFGEVNLIEASAEELIERIQSEGANSP   79 (346)
T ss_dssp             HHHHHHHSEEEEEECCHHHHHHHHHHTGGGCC
T ss_pred             HHHHHHHCEEEEEECCHHHHHHHHHHHCCCCC
T ss_conf             99997422688898474999999997358999


No 20 
>>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} (A:297-413)
Probab=31.37  E-value=24  Score=14.29  Aligned_cols=45  Identities=7%  Similarity=0.053  Sum_probs=36.8

Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             456689999999731343035677776531124554699999989
Q gi|254780396|r   99 SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI  143 (317)
Q Consensus        99 ~~~i~~~i~~~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~  143 (317)
                      .+.+...++....-+|.+++++++.-+..|.+.++++..++....
T Consensus        10 ~~~l~~~L~~Yr~~FGlDd~SLq~lA~~~~~pv~~lka~iKSp~~   54 (117)
T 1tq4_A           10 LETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAV   54 (117)
T ss_dssp             HHHHHHHHHHHHHHTTCSHHHHHHHHSSSSSCHHHHHHTCSHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHCHHH
T ss_conf             999999999999974998799999999909989999999808677


No 21 
>>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structure initiative; 1.70A {Plasmodium falciparum 3D7} PDB: 2auc_A (A:80-146)
Probab=24.54  E-value=32  Score=13.45  Aligned_cols=39  Identities=8%  Similarity=0.033  Sum_probs=23.3

Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             986420012234445668999999973134303567777
Q gi|254780396|r   86 KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL  124 (317)
Q Consensus        86 ~~~~a~~~~i~v~~~~i~~~i~~~~~~~~~~~~~~~~~l  124 (317)
                      +.......|..++++++...+..+-..+..+-+.|.+.+
T Consensus        27 l~~~l~~lg~~~~~~e~~~~~~d~d~dg~I~~~eF~~~~   65 (67)
T 2qac_A           27 MKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCEDI   65 (67)
T ss_dssp             HHHHHHHSSSCCCHHHHHHHHHHHCSSSEEEHHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             999999808999999999999964989989499999997


Done!