HHsearch results for GI: 254780396 and protein with PDBid: 1zk6_A

>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis}
Probab=99.13  E-value=5.2e-11  Score=87.15  Aligned_cols=89  Identities=13%  Similarity=0.204  Sum_probs=65.7

Q ss_pred             CCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-HHHCCHHHHH-HCCCC
Q ss_conf             100233322102467544479999864357886522332489999852013225687467527-5561367665-11245
Q gi|254780396|r  176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL-ESDLHPQFQN-LLKKS  253 (317)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lg~~~-~~~l~~~~~~-~~~~~  253 (317)
                      .++.++||++.       .++.+.+    ..........|...+..+|..++...+|.+||+. .+.+|+.+.+ +++++
T Consensus         3 ~~v~v~hIl~~-------~~~~A~~----i~~~l~~g~~F~~lA~~~S~d~~~~~~G~l~~~~~~~~~~~~~~~~~~~l~   71 (93)
T 1zk6_A            3 GKIRASHILVA-------DKKTAEE----VEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLK   71 (93)
T ss_dssp             CCEEEEEEEES-------SHHHHHH----HHHHHHHTCCHHHHHHHHCCSGGGGGTTEEEEECTTTSSCTTHHHHHHHSC
T ss_pred             CEEEEEEEEEC-------CHHHHHH----HHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCC
T ss_conf             75999999978-------9999999----999988799999999996779532216775654457861989999998579


Q ss_pred             CCCCCCCEEECCEEEEEEEECC
Q ss_conf             7880123763894899998223
Q gi|254780396|r  254 QNNTTNPYVTQKGVEYIAICDK  275 (317)
Q Consensus       254 ~G~is~pv~t~~G~hiikv~~~  275 (317)
                      +|++|+||+|++||||++|.|+
T Consensus        72 ~G~vs~Pi~s~~G~hIlkv~dk   93 (93)
T 1zk6_A           72 TGEVSDPVKTQYGYHIIKKTEE   93 (93)
T ss_dssp             TTCBCCCEECSSCEEEEEEEEC
T ss_pred             CCCCCCCEEECCEEEEEEEECC
T ss_conf             9982776896998899999478