HHsearch results for GI: 254780396 and protein with PDBid: 2jzv_A

>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus}
Probab=99.45  E-value=5.9e-14  Score=105.79  Aligned_cols=100  Identities=12%  Similarity=0.137  Sum_probs=74.3

Q ss_pred             CCCHHHHHHHHHCCCCCCC----CHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCC-CCCCCCCCCCCCHHHCCHHHHH
Q ss_conf             1100233322102467544----47999986435788652-2332489999852013-2256874675275561367665
Q gi|254780396|r  175 VREYLIRTVLFSIPDNKLQ----NQGFVQKRIKDAEESRL-RLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQN  248 (317)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-~~~~~g~lg~~~~~~l~~~~~~  248 (317)
                      ...+.++||++.+......    ..+.+...+.+...... ....|...+..+|... +...||++||+..+++++.|..
T Consensus         5 ~d~~~~sHILi~~~~~~~~~~~~~~~~a~~~a~~i~~~l~~~~~~F~~lA~~~S~d~~s~~~gG~lG~~~~~~l~~~f~~   84 (111)
T 2jzv_A            5 SDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEK   84 (111)
T ss_dssp             CSEEEEEEEEEEBCSCSSCSSSBCHHHHHHHHHHHHHHHHSCTTSHHHHHHHHCSCHHHHTTTTEEEEEETTSSCHHHHH
T ss_pred             CCEEEEEEEEEECCCCCCCHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             45026889998068877701004799999999999999982952399999997869410134864577676632699999


Q ss_pred             -HCCCCCCCCCCCEEECCEEEEEEEEC
Q ss_conf             -11245788012376389489999822
Q gi|254780396|r  249 -LLKKSQNNTTNPYVTQKGVEYIAICD  274 (317)
Q Consensus       249 -~~~~~~G~is~pv~t~~G~hiikv~~  274 (317)
                       ++++++|++|+||+|++|||||+|.+
T Consensus        85 ~~~~l~~GeiS~pi~t~~G~hIikvee  111 (111)
T 2jzv_A           85 ALFKLKDGEVSEVVKSSFGYHIIKADK  111 (111)
T ss_dssp             HHHTCCTTCBCCCEEETTEEEEEEECC
T ss_pred             HHHHCCCCCCCCCEEECCEEEEEEEEC
T ss_conf             998489998288788599889999849