BLAST/PSIBLAST alignment of GI: 254780396 and GI: 327188010 at iteration 1
>gi|327188010|gb|EGE55240.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CNPAF512] Length = 314
 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/292 (31%), Positives = 156/292 (53%), Gaps = 22/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 30  ASEVQAVVNGTAITSGDVAKRQAFLRLQHTAADA-KTAKEQLIDETLKRQEVARVHMSVS 88

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS    S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 89  QQDVDASFARFSAGNKLSVAQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTTRL 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQK       EY+++ ++F IP+ K        KR  +AE SR + P
Sbjct: 149 SNYDLVSRMMQNNKQK---PVTTEYMLQQIIFVIPEAK--RGAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 -GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKRDLGGEIA---------LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R +  + A         L    + +N P + E  + +Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSK-KYLDELRKKAQIAY 313