BLAST/PSIBLAST alignment of GI: 254780396 and GI: 86357089 at iteration 1
>gi|86357089|ref|YP_468981.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CFN 42] Length = 314
>gi|86281191|gb|ABC90254.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CFN 42] Length = 314
 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 98/320 (30%), Positives = 169/320 (52%), Gaps = 23/320 (7%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           D  K +T +       ++  ++  + A S  ++  +NG  IT GD++KR A L+LQ    
Sbjct: 3   DAKKAITAFLAGAAIALLTGLAGPALAASG-VQAVVNGTAITSGDVAKRQAFLRLQHTKA 61

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
           +  K A ++LI ETLK+QE+ +  ++     V+  F + +    LS E  S  LD+ G+G
Sbjct: 62  DA-KTATEQLIDETLKRQEVARVHMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVG 120

Query: 131 DNHFKQYLAIQSIWPDVVKNDF-----MLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
            +HFK ++A+Q  WP VV   +     +  Y  +   +  NKQK       EY+++ ++F
Sbjct: 121 VDHFKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQK---PVTTEYMLQQIIF 177

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            IP+ K        KR  +AE SR + P  C++ + FA+ + DVS+     +L  ++ P 
Sbjct: 178 VIPEAK--RGAITGKRKGEAEASRSKFP-GCDQAKTFAATMRDVSVRDLGRMLAPEIPPD 234

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA---------LKAYLSAQNTPTK 296
           +++L+++++ NTT   VT+KGVEY+AIC +R +  + A         L    + +N P +
Sbjct: 235 WKSLVEQAKGNTTGTRVTEKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPE 294

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            E  + +Y+ +LR  A I Y
Sbjct: 295 NENSK-KYLDELRKKAQIAY 313