BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans
isomerase protein [Candidatus Liberibacter asiaticus str. psy62]
         (317 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040073|gb|ACT56869.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 317

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/317 (100%), Positives = 317/317 (100%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI
Sbjct: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60

Query: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
           ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF
Sbjct: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
           SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI
Sbjct: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES
Sbjct: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH 300
           DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH
Sbjct: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH 300

Query: 301 EAEYVKKLRSNAIIHYY 317
           EAEYVKKLRSNAIIHYY
Sbjct: 301 EAEYVKKLRSNAIIHYY 317


>gi|315122192|ref|YP_004062681.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495594|gb|ADR52193.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 315

 Score =  351 bits (900), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 184/312 (58%), Positives = 241/312 (77%), Gaps = 5/312 (1%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           +S + F KLL    VLI  C  P   Y+S A+SS+I  T+NGE ITDGDISKRIA LKL+
Sbjct: 7   SSFNGFSKLLAVCVVLIA-CFYP---YESSAISSQISITVNGEAITDGDISKRIAFLKLR 62

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
           KING+L+KIA QELI E LKKQE E  GI  + N++NYFF Q+ARNTG+SAE+FS  L+ 
Sbjct: 63  KINGDLKKIAKQELIAEALKKQESEGFGIILNPNSMNYFFAQYARNTGISAEEFSDMLEH 122

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLF 185
            GIG+NHFKQYLAIQ  W ++V+N F++KY  L ME+P + K + KN+TVREYL++ ++F
Sbjct: 123 LGIGENHFKQYLAIQLAWDEIVRNTFIMKYRGLGMEMPPSIKGRGKNLTVREYLVKKIIF 182

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           S+P NK +N+ F+QKRI +AE+SR   P +CN++E+FAS +HDVS+   QY LESDL PQ
Sbjct: 183 SVPYNKHKNEDFIQKRIDEAEKSRFHFPTNCNRVEEFASAMHDVSVSNPQYFLESDLQPQ 242

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV 305
            + LLKK++NNTTN YVT+KGVEYIAIC+ RD+GGE+ALKAY + Q  P K++K++ EY+
Sbjct: 243 LKILLKKTKNNTTNTYVTEKGVEYIAICNIRDIGGELALKAYFNTQEIPKKMKKYDEEYM 302

Query: 306 KKLRSNAIIHYY 317
           K LR+NAII +Y
Sbjct: 303 KTLRANAIIQFY 314


>gi|222085450|ref|YP_002543980.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium
           radiobacter K84]
 gi|221722898|gb|ACM26054.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium
           radiobacter K84]
          Length = 316

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 161/286 (56%), Gaps = 12/286 (4%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +N  VIT GDI+KRI  LKLQ   G+L K+A ++L+ ETLK+ EI +  ++  
Sbjct: 34  ASEVKVVVNNSVITSGDIAKRINFLKLQHQKGDLNKLAQEQLVDETLKRAEISRVRMSVS 93

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
           ++ V+  F + A +  +S +     LDK G+G +HFK Y+A+   WP VV   F    GN
Sbjct: 94  TSDVDSAFGRFAASNKMSPQQLGQILDKMGVGVDHFKSYIAVSMSWPRVVNARFGSSGGN 153

Query: 159 L----EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
                ++     + K K +T  EY ++ ++F +P  K      + +R  +AE SR + P 
Sbjct: 154 KLSNDDLVTRMTENKTKPVTT-EYFLKQIVFVVPQAK--RNAILNQRKSEAEASRAKFP- 209

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICD 274
            C++ + FA+ + DVS+     +L  DL   ++ LL++++ NTT P VT +GVEY+AIC 
Sbjct: 210 GCDQAKVFAATMRDVSVQDLGRVLAPDLPEIWKPLLEQAKGNTTTPVVTDRGVEYVAICS 269

Query: 275 KRDLGGEIALKAYLSAQN----TPTKIEKHEAEYVKKLRSNAIIHY 316
           +R +  ++A  A   A++        I  ++ +Y+ +LRS A I Y
Sbjct: 270 QRQVNDDVAAAAVFRAEDIGKAGAQGISANDKKYMDELRSKAQILY 315


>gi|86357089|ref|YP_468981.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CFN 42]
 gi|86281191|gb|ABC90254.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CFN 42]
          Length = 314

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 98/320 (30%), Positives = 169/320 (52%), Gaps = 23/320 (7%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           D  K +T +       ++  ++  + A S  ++  +NG  IT GD++KR A L+LQ    
Sbjct: 3   DAKKAITAFLAGAAIALLTGLAGPALAASG-VQAVVNGTAITSGDVAKRQAFLRLQHTKA 61

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
           +  K A ++LI ETLK+QE+ +  ++     V+  F + +    LS E  S  LD+ G+G
Sbjct: 62  DA-KTATEQLIDETLKRQEVARVHMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVG 120

Query: 131 DNHFKQYLAIQSIWPDVVKNDF-----MLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
            +HFK ++A+Q  WP VV   +     +  Y  +   +  NKQK       EY+++ ++F
Sbjct: 121 VDHFKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQK---PVTTEYMLQQIIF 177

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            IP+ K        KR  +AE SR + P  C++ + FA+ + DVS+     +L  ++ P 
Sbjct: 178 VIPEAK--RGAITGKRKGEAEASRSKFP-GCDQAKTFAATMRDVSVRDLGRMLAPEIPPD 234

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA---------LKAYLSAQNTPTK 296
           +++L+++++ NTT   VT+KGVEY+AIC +R +  + A         L    + +N P +
Sbjct: 235 WKSLVEQAKGNTTGTRVTEKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPE 294

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            E  + +Y+ +LR  A I Y
Sbjct: 295 NENSK-KYLDELRKKAQIAY 313


>gi|218671035|ref|ZP_03520706.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli GR56]
          Length = 314

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 159/292 (54%), Gaps = 22/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 30  ASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVRMSVS 88

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 89  QQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRL 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQ  K +T  EY+++ ++F IP  K        KR  +AE SR + P
Sbjct: 149 SNYDLVSRMMQNNKQ--KPVTT-EYMLQQIIFVIPQAK--RAAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 -GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKRDLGGEIA---------LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R +  + A         L    +A+N P + E  + +Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLDKSKAAKNGPPENENSK-KYLDELRKKAQIAY 313


>gi|218461597|ref|ZP_03501688.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli Kim 5]
          Length = 313

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 158/292 (54%), Gaps = 22/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 29  ASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVRMSVS 87

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 88  QQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRL 147

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQ  K +T  EY+++ ++F IP  K        KR  +AE SR + P
Sbjct: 148 SNYDLVSRMMQNNKQ--KPVTT-EYMLQQIIFVIPQAK--RAAITGKRKGEAEASRSKFP 202

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 203 -GCDQSKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 261

Query: 274 DKRDLGGEIA---------LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R +  + A         L    + +N P + E  + +Y+ +LR  A I Y
Sbjct: 262 SQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSK-KYLDELRKKAQIAY 312


>gi|218661101|ref|ZP_03517031.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli IE4771]
          Length = 295

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 158/292 (54%), Gaps = 22/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 11  ASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVRMSVS 69

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 70  QQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRL 129

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQ  K +T  EY+++ ++F IP  K        KR  +AE SR + P
Sbjct: 130 SNYDLVSRMMQNNKQ--KPVTT-EYMLQQIIFVIPQAK--RAAITGKRKGEAEASRSKFP 184

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 185 -GCDQSKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 243

Query: 274 DKRDLGGEIA---------LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R +  + A         L    + +N P + E  + +Y+ +LR  A I Y
Sbjct: 244 SQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSK-KYLDELRKKAQIAY 294


>gi|327188010|gb|EGE55240.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CNPAF512]
          Length = 314

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/292 (31%), Positives = 156/292 (53%), Gaps = 22/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 30  ASEVQAVVNGTAITSGDVAKRQAFLRLQHTAADA-KTAKEQLIDETLKRQEVARVHMSVS 88

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS    S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 89  QQDVDASFARFSAGNKLSVAQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTTRL 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQK       EY+++ ++F IP+ K        KR  +AE SR + P
Sbjct: 149 SNYDLVSRMMQNNKQK---PVTTEYMLQQIIFVIPEAK--RGAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 -GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKRDLGGEIA---------LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R +  + A         L    + +N P + E  + +Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSK-KYLDELRKKAQIAY 313


>gi|150395986|ref|YP_001326453.1| SurA domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150027501|gb|ABR59618.1| SurA domain [Sinorhizobium medicae WSM419]
          Length = 315

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 153/287 (53%), Gaps = 21/287 (7%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           S +   +NG VIT GD++KR+A L+LQ+ +G   + A Q+L+ E LK+ EI +   +  +
Sbjct: 35  SSVEVVVNGTVITSGDVAKRVAFLRLQRQSGGAAE-AKQQLVDEVLKRAEIARVQQSVST 93

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK----NDFMLK 155
           + V+  F + A    LS E     L++ G+G +HFKQY+A+Q  WP VV     N   L 
Sbjct: 94  DEVDAAFARFASGNKLSPEQLGKILEQAGVGIDHFKQYIAVQMSWPRVVNFRYGNASRLS 153

Query: 156 YGNL---EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
            G+L    M+   NK         EY ++ V+F IP++K        KR  +A  SR + 
Sbjct: 154 GGDLVKRMMQGGGNKP-----VTTEYFLQQVIFVIPESK--RGAITAKRQAEANASRSKF 206

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNN-TTNPYVTQKGVEYIA 271
           P  C+  + FA+   DVSI     +L   L   ++ L++K+ ++ TT   VT+KGVEY+A
Sbjct: 207 P-GCDTSKAFAANYRDVSIRSLGRILAQQLPEDWKPLVEKAGDSMTTGTRVTEKGVEYLA 265

Query: 272 ICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           IC KR    D   EI  +A    +      + + A+Y+++LRS A I
Sbjct: 266 ICKKRQVNDDAAAEIVFRAEDLGKKKSGGEDPNSAKYLEELRSKAQI 312


>gi|209548668|ref|YP_002280585.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534424|gb|ACI54359.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 154/291 (52%), Gaps = 20/291 (6%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A ++LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 30  ASEVKAVVNGTAITSGDVAKRQAFMRLQHTKADA-KAAEEQLIDETLKRQEVSRVHMSVS 88

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 89  QQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRL 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQ  K +T  EY+++ ++F IP  K        KR  +AE SR + P
Sbjct: 149 SNYDLVSRMMQNNKQ--KPVTT-EYMLQQIIFVIPQAK--RNAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DVS+     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 -GCDQAKVFAATMRDVSVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKR----DLGGEIALKAYLSAQNTPTKIEKHEAE----YVKKLRSNAIIHY 316
            +R    D   E+  +     +    K    E E    Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLGKAKGGKDASPENENSKKYLDELRKKAQIAY 313


>gi|190891133|ref|YP_001977675.1| peptidyl-prolyl cis-trans isomerase [Rhizobium etli CIAT 652]
 gi|218517103|ref|ZP_03513943.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli 8C-3]
 gi|190696412|gb|ACE90497.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CIAT 652]
          Length = 314

 Score =  148 bits (374), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 92/292 (31%), Positives = 158/292 (54%), Gaps = 22/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  ++  
Sbjct: 30  ASEVQAVVNGTAITSGDVAKRQAFLRLQHTAADA-KTAKEQLIDETLKRQEVARVHMSVS 88

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS    S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 89  QQDVDASFARFSAGNKLSVAQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRL 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQ  K +T  EY+++ ++F IP+ K        KR  +AE SR + P
Sbjct: 149 SNYDLVSRMMQNNKQ--KPVTT-EYMLQQIIFVIPEAK--RGAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 -GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKRDLGGEIA---------LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +R +  + A         L    + +N P + +  + +Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENDNSK-KYLDELRKKAQIAY 313


>gi|222148150|ref|YP_002549107.1| hypothetical protein Avi_1539 [Agrobacterium vitis S4]
 gi|221735138|gb|ACM36101.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 315

 Score =  148 bits (374), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 150/279 (53%), Gaps = 10/279 (3%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           +   +N   IT+ D+++RIA LKL+   G++ K A QELI E LK+QEI + G++  +  
Sbjct: 38  VAVVVNKTAITNTDLARRIAFLKLRHETGDVAKKARQELIDEQLKRQEIARVGMSVSTMD 97

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM--LKYGNL 159
           V+  F + A +  LS +     LDK G+G  HFK Y+A+Q  WP +V   +    K  N 
Sbjct: 98  VDQAFGRFAASNKLSTQQMGQILDKAGVGVEHFKAYIAVQMSWPRLVNARYASRSKMSNQ 157

Query: 160 EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
           +M     + K K +T  EY ++ V+F +P  K        KR  +AE SR + P  C++ 
Sbjct: 158 DMVTRLLENKQKPVTT-EYTLKQVIFVVPVAKRAT--LTAKRKAEAEASRAKFP-GCDQA 213

Query: 220 EKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKR--- 276
             FA    DVSI     +++ +L   ++ L++ +   TT   VT++G+EY+AIC+++   
Sbjct: 214 MDFAKNYLDVSIRDLGRVMKPELPDDWKPLIEGANGTTTGTRVTERGIEYLAICNQKQVS 273

Query: 277 -DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            DL  E   KA    +   +K + +  +Y+ +LRS A I
Sbjct: 274 DDLAAEAVFKAEDIGKEDKSKGDPNSEKYLTELRSKAQI 312


>gi|116251332|ref|YP_767170.1| hypothetical protein RL1566 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255980|emb|CAK07061.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 314

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 153/290 (52%), Gaps = 20/290 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI E LK+QE+ +  ++   
Sbjct: 31  SEVKAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAEEQLIDEALKRQEVARVRMSVSQ 89

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----ML 154
             V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     + 
Sbjct: 90  QDVDASFARFSSGNKLSPEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRLS 149

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
            Y  +   +  NKQ  K +T  EY+++ ++F IP  K        KR  +AE SR + P 
Sbjct: 150 NYDLVSRMMQNNKQ--KPVTT-EYMLQQIIFVIPQAK--RGAITGKRKGEAEASRSKFP- 203

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICD 274
            C++ + FA+ + DVS+     LL  ++ P ++ L+++++ NTT   VT KGVEY+AIC 
Sbjct: 204 GCDQAKVFAATMRDVSVRDLGRLLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICS 263

Query: 275 KR----DLGGEIALKAYLSAQNTPTKIEKHEAE----YVKKLRSNAIIHY 316
           +R    D   E+  +     ++   K    E E    Y+ +LR  A I Y
Sbjct: 264 QRQVSDDQAAEMVFRQEDLDKSKAGKDASPENENSKKYLDELRKKAQIAY 313


>gi|241203946|ref|YP_002975042.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857836|gb|ACS55503.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 154/291 (52%), Gaps = 20/291 (6%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI E LK+QE+ +  ++  
Sbjct: 30  ASEVKAVVNGTAITSGDVAKRQAFLRLQHTKADA-KAAEEQLIDEALKRQEVTRVHMSVS 88

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-----M 153
              V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +     +
Sbjct: 89  QQDVDASFARFSSGNKLSPEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRL 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
             Y  +   +  NKQ  K +T  EY+++ V+F IP  K        KR  +AE SR + P
Sbjct: 149 SNYDLVSRMMQNNKQ--KPVTT-EYMLQQVIFVIPQAK--RGAITGKRKGEAEASRSKFP 203

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAIC 273
             C++ + FA+ + DVS+     +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC
Sbjct: 204 -GCDQAKVFAATMRDVSVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAIC 262

Query: 274 DKR----DLGGEIALKAYLSAQNTPTKIEKHEAE----YVKKLRSNAIIHY 316
            +R    D   E+  +     ++   K    E E    Y+ +LR  A I Y
Sbjct: 263 SQRQVSDDQAAEMVFRQEDLDKSKGGKDASPENENSKKYLDELRKKAQIAY 313


>gi|307300974|ref|ZP_07580743.1| SurA domain protein [Sinorhizobium meliloti BL225C]
 gi|307317709|ref|ZP_07597147.1| SurA domain protein [Sinorhizobium meliloti AK83]
 gi|306896471|gb|EFN27219.1| SurA domain protein [Sinorhizobium meliloti AK83]
 gi|306903929|gb|EFN34515.1| SurA domain protein [Sinorhizobium meliloti BL225C]
          Length = 315

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 163/315 (51%), Gaps = 22/315 (6%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
            ++LL+   +     +       + A S+ +   +N  VIT GD++KR+A LKLQ+ +G 
Sbjct: 8   IVRLLSAVALAGALSVAAGTVTTAMAAST-VEVVVNSTVITSGDVAKRVAFLKLQRQSGG 66

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     LD+ G+G 
Sbjct: 67  AAE-AKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFAAGNKLSPEQLGKILDQAGVGV 125

Query: 132 NHFKQYLAIQSIWPDVVKNDF----MLKYGNL---EMEIPANKQKMKNITVREYLIRTVL 184
           +HFKQY+A+Q  WP VV   +     L  G+L    M+   NK         EY ++ V+
Sbjct: 126 DHFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMQGGGNKP-----VTTEYFLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F IP++K        KR  +A  SR + P  C+  + FA+   DVSI     +L   L  
Sbjct: 181 FVIPESK--RGAITAKRQAEANASRSQFP-GCDTSKAFAANYRDVSIRSLGRILAQQLPE 237

Query: 245 QFQNLLKKSQNN-TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHE-- 301
            ++ L++K+ +  TT   VT+KGVEY+AIC KR +  + A +    A++   K  + E  
Sbjct: 238 DWKPLVEKAGDGMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSEGEDP 297

Query: 302 --AEYVKKLRSNAII 314
             A+Y+++LRS A I
Sbjct: 298 NSAKYLEELRSKAQI 312


>gi|15964904|ref|NP_385257.1| hypothetical protein SMc00581 [Sinorhizobium meliloti 1021]
 gi|15074083|emb|CAC45730.1| Hypothetical protein SMc00581 [Sinorhizobium meliloti 1021]
          Length = 316

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/315 (32%), Positives = 163/315 (51%), Gaps = 22/315 (6%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
            ++LL+   +     +       + A S+ +   +N  VIT GD++KR+A LKLQ+ +G 
Sbjct: 9   IVRLLSAVALAGALSVAAGTVTTAMAAST-VEVVVNSTVITSGDVAKRVAFLKLQRQSGG 67

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             + A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     LD+ G+G 
Sbjct: 68  AAE-AKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFAAGNKLSPEQLGKILDQAGVGV 126

Query: 132 NHFKQYLAIQSIWPDVVKNDF----MLKYGNL---EMEIPANKQKMKNITVREYLIRTVL 184
           +HFKQY+A+Q  WP VV   +     L  G+L    M+   NK         EY ++ V+
Sbjct: 127 DHFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMQGGGNKP-----VTTEYFLQQVI 181

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F IP++K        KR  +A  SR + P  C+  + FA+   DVSI     +L   L  
Sbjct: 182 FVIPESK--RGAITAKRQAEANASRSQFP-GCDTSKAFAANYRDVSIRSLGRILAQQLPE 238

Query: 245 QFQNLLKKSQNN-TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHE-- 301
            ++ L++K+ +  TT   VT+KGVEY+AIC KR +  + A +    A++   K  + E  
Sbjct: 239 DWKPLVEKAGDGMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSEGEDP 298

Query: 302 --AEYVKKLRSNAII 314
             A+Y+++LRS A I
Sbjct: 299 NSAKYLEELRSKAQI 313


>gi|227821473|ref|YP_002825443.1| putative survival protein SurA, probable peptidyl-prolyl cis-trans
           isomerase protein [Sinorhizobium fredii NGR234]
 gi|227340472|gb|ACP24690.1| putative survival protein SurA, probable peptidyl-prolyl cis-trans
           isomerase protein [Sinorhizobium fredii NGR234]
          Length = 312

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 159/314 (50%), Gaps = 21/314 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           I ++     L +  ++ I S  +   +S ++  +N  VIT GDI+KR+A L+LQ+  G  
Sbjct: 5   ISIVRALSALAVAGVLSIASGAAVQAASGVKVIVNSTVITSGDIAKRVAFLRLQRQGGGA 64

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A ++L+ E LK+ EI +   +  +  V+  + + A    LS E     LD+ G+G  
Sbjct: 65  AE-AEKQLVDEVLKRAEIARVQQSVSTQEVDAAYARFAAGNKLSTEQLGKILDQSGVGIE 123

Query: 133 HFKQYLAIQSIWPDVVKNDF----MLKYGNL---EMEIPANKQKMKNITVREYLIRTVLF 185
           HFKQY+A+Q  WP VV   +     L  G+L    ME   NK         EY ++ V+F
Sbjct: 124 HFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMEGGGNKP-----VTTEYFLQQVIF 178

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            IP++K        KR  +A  SR + P  C   + FA+   DVSI     +L   L   
Sbjct: 179 VIPESK--RGAITAKRQAEANASRSQFP-GCETSKAFAANYRDVSIRSLGRVLAQQLPED 235

Query: 246 FQNLLKKSQNN-TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHE--- 301
           ++ L++K+ +  TT   VT+KGVEY+AIC KR +  + A +    A++   K    E   
Sbjct: 236 WKPLVEKAGDGTTTGTRVTEKGVEYLAICKKRQVNDDAAAEVVFRAEDIGKKKAGGEDPN 295

Query: 302 -AEYVKKLRSNAII 314
             +Y+++LRS A I
Sbjct: 296 SEKYLEELRSKAQI 309


>gi|15888445|ref|NP_354126.1| hypothetical protein Atu1105 [Agrobacterium tumefaciens str. C58]
 gi|15156137|gb|AAK86911.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 315

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 160/295 (54%), Gaps = 17/295 (5%)

Query: 30  IVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQ 88
           +V Y   A + S ++  +N   IT+ DI++R+A LKLQ+ +G L + A ++L+ E LK++
Sbjct: 25  VVPYAGQAFADSTVKIVVNKTPITNDDIARRVAFLKLQRQSGNLNEKAREQLVDEALKRE 84

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           EI +  ++  +  V+  F + A N  +  E  +  L + G+G  HFK ++A+Q  WP +V
Sbjct: 85  EIARVKMSVSTQDVDAAFARFAGNNKMKPEQLTKVLAQAGVGAEHFKAFIAVQMSWPRLV 144

Query: 149 KNDFML--KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
              +    K  N ++     ++  K +T  EY ++ V+F IP+ K        KR  +AE
Sbjct: 145 NARYGARGKMSNQDLVTRLKERGEKPVTT-EYFLQQVIFVIPEAK--RNAITGKRKAEAE 201

Query: 207 ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQK 265
            SR R P  C++   FA+ + DV+I     +L  +L   ++ L++K+ +  TT   VT+K
Sbjct: 202 ASRKRYP-GCDQAMSFAATMRDVAIKDLGRILAPELPEDWKALVEKTKEGGTTGTRVTEK 260

Query: 266 GVEYIAICDKR----DLGGEIALKA--YLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           GVEY+AIC +R    D   E+  K+   + A++     EK   +Y+++LR  A I
Sbjct: 261 GVEYLAICKQRQVSDDYAAEMVFKSEDLMKAKDGENPNEK---KYIEELRKKAQI 312


>gi|325292484|ref|YP_004278348.1| survival protein surA precursor / peptidyl-prolyl cis-trans
           isomerase SurA [Agrobacterium sp. H13-3]
 gi|325060337|gb|ADY64028.1| putative survival protein surA precursor / peptidyl-prolyl
           cis-trans isomerase SurA [Agrobacterium sp. H13-3]
          Length = 315

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 165/298 (55%), Gaps = 12/298 (4%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           +   + P  S +++A S+ ++  +N   IT+ DI++R+A LKLQ+ +G L + A ++L+ 
Sbjct: 21  VPMAVAPFAS-QAFADST-VKIVVNKTPITNDDIARRVAFLKLQRQSGNLAEKAREQLVD 78

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           E LK++EI +  ++  +  V+  F + A N  ++ +  +  L K G+G +HFK ++A+Q 
Sbjct: 79  EALKREEIGRVKMSVSTQEVDAAFARFAANNKMNPQQLTQILSKAGVGADHFKAFIAVQM 138

Query: 143 IWPDVVKNDFML--KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
            WP +V   +    K  N ++     ++  K +T  EY ++ V+F IP++K        K
Sbjct: 139 SWPRLVNARYGARGKMSNQDLVTRLRERGDKPVTT-EYFLQQVIFVIPESK--RNAITGK 195

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTN 259
           R  +AE SR R P  C++   FA+ + DV+I     +L  +L  +++ L++K+ +  TT 
Sbjct: 196 RKAEAEASRKRYP-GCDQAMTFAATMRDVAIKDLGRILAPELPEEWKPLVEKTKEGGTTG 254

Query: 260 PYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN---TPTKIEKHEAEYVKKLRSNAII 314
             VT+KGVEY+AIC +R +  + A +    +++          +E +Y+ +LR  A I
Sbjct: 255 TRVTEKGVEYLAICKQRQVSDDYAAEMVFKSEDLMKAKGGENPNEKKYMDELRKKAQI 312


>gi|90419499|ref|ZP_01227409.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336436|gb|EAS50177.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 346

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 137/281 (48%), Gaps = 8/281 (2%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S I+  +NG  IT   I +R A L+L+++ G   + A  ELI E LKKQEI + GI   
Sbjct: 66  ASEIKAVVNGMPITSYQIRQRAAFLQLRRVGGNATQKATDELIDEALKKQEIGRRGIAIP 125

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
              V+  F + A    L+ E     L + G   + FK Y+ +Q  W   V+ +       
Sbjct: 126 DEAVDEAFGRFAAENKLTREQLGQVLSRAGFSSDGFKDYIRVQMGWGQAVQANMRSTERL 185

Query: 159 LEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
            E ++      Q  +  +  EY ++ V+F IPD   Q    + +R ++AE  R R  + C
Sbjct: 186 SEQDVVQRMLAQGGEKPSTTEYTLQQVIFVIPD--AQRSALMAQRKREAESMRSRF-QSC 242

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPY-VTQKGVEYIAICDK 275
               +FA  + DV++     + + +L P+++  ++ +    T P   T++GVE+IA+C+ 
Sbjct: 243 ESTYEFAKGLRDVTVRDLGRVAQPELPPRWKKDIQATSVGRTTPAQATERGVEFIAVCNT 302

Query: 276 RDLGGEIALKAYLSAQNTPTKIEKHE--AEYVKKLRSNAII 314
           R++  + A      A+      E+ E  A Y+KKLR  A I
Sbjct: 303 RNISDDKAAALVFQAREMEKLGEQAEPDAAYLKKLRDRAQI 343


>gi|163759133|ref|ZP_02166219.1| hypothetical protein HPDFL43_05195 [Hoeflea phototrophica DFL-43]
 gi|162283537|gb|EDQ33822.1| hypothetical protein HPDFL43_05195 [Hoeflea phototrophica DFL-43]
          Length = 283

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 145/280 (51%), Gaps = 6/280 (2%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           +S I+  +N + IT  DI++R+A L+LQ+  G L+  A ++LI E+LK QE  +      
Sbjct: 3   ASEIKIVVNKQAITSVDIARRVAFLRLQRTGGNLQAKAREQLIEESLKYQEALRIRAVVS 62

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
              ++  + +  ++  LS +  +  L++ G+   HFK ++ +Q  WP VV+       G 
Sbjct: 63  QAQIDASYARFGKSNNLSVKQLNQVLNQAGVTPQHFKDFIRVQMSWPRVVQALEGTSGGG 122

Query: 159 LEMEIPANKQKMKN---ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
           +  +   +K   +     +  EY+++ V+F +P NK  N   +  R ++AE+ R R  + 
Sbjct: 123 MSTQDLVSKMLERGDDKPSTTEYILQQVIFVVPSNKRSN-ATLNARKREAEQLRGRY-QG 180

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNP-YVTQKGVEYIAICD 274
           C       + + DV++     +++  L P ++ L++K++   T P  +T +GVE+I IC 
Sbjct: 181 CENAAAAVTGLRDVTLRNLGRIMQPQLPPDWKPLIEKTEAGATTPTRITDRGVEFIVICS 240

Query: 275 KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            + +  + A +    A+N+     +   +++ KLR +A+I
Sbjct: 241 SKTVSDDRAAELVFRAENSDAGDSETAKKHLAKLRESAVI 280


>gi|153009931|ref|YP_001371146.1| SurA domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561819|gb|ABS15317.1| SurA domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 319

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/312 (27%), Positives = 150/312 (48%), Gaps = 12/312 (3%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           F  +L+    L     V + ++ + A  S ++  ++G  IT+ DI  R+A LKLQ+  G 
Sbjct: 8   FASMLSAAVCLTTLGTVAVPAFAAGA-GSEVKVIVSGNAITNSDIQHRVAFLKLQRKGGN 66

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L ++A +EL  E LK+ E++   I      V+  +   A    +S    +  +++ G+  
Sbjct: 67  LSQVAKEELTDEMLKRIEMKSRSINITDQQVDEAYAGFASRNKMSLAQLNQLMNQSGVTP 126

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPD 189
           +HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F IP 
Sbjct: 127 DHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKDGGKKPVATEYRLQQVIFVIPA 186

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +K ++   + KR ++A   R R  + C+   + A  I DV++     ++E  L  ++   
Sbjct: 187 SK-RSPALLSKRKQEANALRSRF-QSCDATRQQAKGILDVTVRDLGRIIEQQLPNEWAKA 244

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPT----KIEKHEA 302
           +K  S   TT P  T+KGVE++A+C  R +  +   +   S +  ++P     K E+   
Sbjct: 245 VKATSVGGTTPPQETEKGVEFLAVCSTRQISDDRVAQLVFSMEGADSPAGQEKKAEQLSE 304

Query: 303 EYVKKLRSNAII 314
           +Y+K+LR  A I
Sbjct: 305 KYLKELREKATI 316


>gi|256044377|ref|ZP_05447281.1| survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase surA) [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563729|ref|ZP_05834215.1| SurA domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153745|gb|EEW88837.1| SurA domain-containing protein [Brucella melitensis bv. 1 str. 16M]
          Length = 318

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      VN  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSLGINISDKEVNDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|17987548|ref|NP_540182.1| survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase surA) [Brucella melitensis bv. 1 str. 16M]
 gi|265990795|ref|ZP_06103352.1| SurA domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17983251|gb|AAL52446.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Brucella melitensis bv. 1 str. 16M]
 gi|263001579|gb|EEZ14154.1| SurA domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 317

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 2   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 61

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      VN  +   A    ++    +  +++ G
Sbjct: 62  SGNLNQLARNELTEEMLKRIEMKSLGINISDKEVNDAYAGFASRNKMTLAQLNQVMNQSG 121

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 122 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 179

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 180 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 237

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 238 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 297

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 298 EELSKKYVQELREKATI 314


>gi|225627181|ref|ZP_03785219.1| Chaperone surA precursor [Brucella ceti str. Cudo]
 gi|260168435|ref|ZP_05755246.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella sp. F5/99]
 gi|261757897|ref|ZP_06001606.1| SurA domain-containing protein [Brucella sp. F5/99]
 gi|225618016|gb|EEH15060.1| Chaperone surA precursor [Brucella ceti str. Cudo]
 gi|261737881|gb|EEY25877.1| SurA domain-containing protein [Brucella sp. F5/99]
          Length = 318

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSVEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|254718820|ref|ZP_05180631.1| Chaperone surA precursor [Brucella sp. 83/13]
 gi|265983805|ref|ZP_06096540.1| SurA domain-containing protein [Brucella sp. 83/13]
 gi|264662397|gb|EEZ32658.1| SurA domain-containing protein [Brucella sp. 83/13]
          Length = 318

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASLLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|306845285|ref|ZP_07477861.1| Chaperone surA precursor [Brucella sp. BO1]
 gi|306274444|gb|EFM56251.1| Chaperone surA precursor [Brucella sp. BO1]
 gi|326538427|gb|ADZ86642.1| chaperone surA precursor [Brucella melitensis M5-90]
          Length = 317

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 2   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 61

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 62  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 121

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 122 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 179

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 180 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 237

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 238 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 297

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 298 EELSKKYVQELREKATI 314


>gi|23501571|ref|NP_697698.1| peptidyl-prolyl cis-trans isomerase [Brucella suis 1330]
 gi|62289646|ref|YP_221439.1| peptidyl-prolyl cis-trans isomerase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699574|ref|YP_414148.1| peptidyl-prolyl cis-trans isomerase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023896|ref|YP_001934664.1| peptidyl-prolyl cis-trans isomerase [Brucella abortus S19]
 gi|225852204|ref|YP_002732437.1| chaperone SurA [Brucella melitensis ATCC 23457]
 gi|237815137|ref|ZP_04594135.1| Chaperone surA precursor [Brucella abortus str. 2308 A]
 gi|254697090|ref|ZP_05158918.1| Chaperone surA precursor [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701467|ref|ZP_05163295.1| Chaperone surA precursor [Brucella suis bv. 5 str. 513]
 gi|254704014|ref|ZP_05165842.1| Chaperone surA precursor [Brucella suis bv. 3 str. 686]
 gi|254707612|ref|ZP_05169440.1| Chaperone surA precursor [Brucella pinnipedialis M163/99/10]
 gi|254709805|ref|ZP_05171616.1| Chaperone surA precursor [Brucella pinnipedialis B2/94]
 gi|254713809|ref|ZP_05175620.1| Chaperone surA precursor [Brucella ceti M644/93/1]
 gi|254717133|ref|ZP_05178944.1| Chaperone surA precursor [Brucella ceti M13/05/1]
 gi|254729986|ref|ZP_05188564.1| Chaperone surA precursor [Brucella abortus bv. 4 str. 292]
 gi|256031296|ref|ZP_05444910.1| Chaperone surA precursor [Brucella pinnipedialis M292/94/1]
 gi|256060809|ref|ZP_05450969.1| Chaperone surA precursor [Brucella neotomae 5K33]
 gi|256113220|ref|ZP_05454088.1| Chaperone surA precursor [Brucella melitensis bv. 3 str. Ether]
 gi|256159410|ref|ZP_05457188.1| Chaperone surA precursor [Brucella ceti M490/95/1]
 gi|256254704|ref|ZP_05460240.1| Chaperone surA precursor [Brucella ceti B1/94]
 gi|256257204|ref|ZP_05462740.1| Chaperone surA precursor [Brucella abortus bv. 9 str. C68]
 gi|256264288|ref|ZP_05466820.1| SurA domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369119|ref|YP_003106627.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella microti CCM
           4915]
 gi|260545602|ref|ZP_05821343.1| SurA domain-containing protein [Brucella abortus NCTC 8038]
 gi|260757664|ref|ZP_05870012.1| SurA domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260761491|ref|ZP_05873834.1| SurA domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883474|ref|ZP_05895088.1| SurA domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261218948|ref|ZP_05933229.1| SurA domain-containing protein [Brucella ceti M13/05/1]
 gi|261221884|ref|ZP_05936165.1| SurA domain-containing protein [Brucella ceti B1/94]
 gi|261315102|ref|ZP_05954299.1| SurA domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261317343|ref|ZP_05956540.1| SurA domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261321553|ref|ZP_05960750.1| SurA domain-containing protein [Brucella ceti M644/93/1]
 gi|261324801|ref|ZP_05963998.1| SurA domain-containing protein [Brucella neotomae 5K33]
 gi|261752010|ref|ZP_05995719.1| SurA domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261754669|ref|ZP_05998378.1| SurA domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|265988381|ref|ZP_06100938.1| SurA domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|265994631|ref|ZP_06107188.1| SurA domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997847|ref|ZP_06110404.1| SurA domain-containing protein [Brucella ceti M490/95/1]
 gi|294852046|ref|ZP_06792719.1| peptidyl-prolyl cis-trans isomerase [Brucella sp. NVSL 07-0026]
 gi|297248054|ref|ZP_06931772.1| peptidyl-prolyl cis-trans isomerase SurA [Brucella abortus bv. 5
           str. B3196]
 gi|306842051|ref|ZP_07474724.1| Chaperone surA precursor [Brucella sp. BO2]
 gi|23347483|gb|AAN29613.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella suis 1330]
 gi|62195778|gb|AAX74078.1| peptidyl-prolyl cis-trans isomerase, hypothetical [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615675|emb|CAJ10662.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella melitensis
           biovar Abortus 2308]
 gi|189019468|gb|ACD72190.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella abortus
           S19]
 gi|225640569|gb|ACO00483.1| Chaperone surA precursor [Brucella melitensis ATCC 23457]
 gi|237789974|gb|EEP64184.1| Chaperone surA precursor [Brucella abortus str. 2308 A]
 gi|255999279|gb|ACU47678.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella microti CCM
           4915]
 gi|260097009|gb|EEW80884.1| SurA domain-containing protein [Brucella abortus NCTC 8038]
 gi|260667982|gb|EEX54922.1| SurA domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260671923|gb|EEX58744.1| SurA domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260873002|gb|EEX80071.1| SurA domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|260920468|gb|EEX87121.1| SurA domain-containing protein [Brucella ceti B1/94]
 gi|260924037|gb|EEX90605.1| SurA domain-containing protein [Brucella ceti M13/05/1]
 gi|261294243|gb|EEX97739.1| SurA domain-containing protein [Brucella ceti M644/93/1]
 gi|261296566|gb|EEY00063.1| SurA domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261300781|gb|EEY04278.1| SurA domain-containing protein [Brucella neotomae 5K33]
 gi|261304128|gb|EEY07625.1| SurA domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261741763|gb|EEY29689.1| SurA domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261744422|gb|EEY32348.1| SurA domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|262552315|gb|EEZ08305.1| SurA domain-containing protein [Brucella ceti M490/95/1]
 gi|262765744|gb|EEZ11533.1| SurA domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094548|gb|EEZ18357.1| SurA domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660578|gb|EEZ30839.1| SurA domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294820635|gb|EFG37634.1| peptidyl-prolyl cis-trans isomerase [Brucella sp. NVSL 07-0026]
 gi|297175223|gb|EFH34570.1| peptidyl-prolyl cis-trans isomerase SurA [Brucella abortus bv. 5
           str. B3196]
 gi|306287892|gb|EFM59312.1| Chaperone surA precursor [Brucella sp. BO2]
 gi|326408703|gb|ADZ65768.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella melitensis
           M28]
          Length = 318

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|306838742|ref|ZP_07471576.1| Chaperone surA precursor [Brucella sp. NF 2653]
 gi|306406144|gb|EFM62389.1| Chaperone surA precursor [Brucella sp. NF 2653]
          Length = 317

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 2   FARPLIASLLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 61

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 62  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 121

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 122 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 179

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 180 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 237

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 238 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 297

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 298 EELSKKYVQELREKATI 314


>gi|161618653|ref|YP_001592540.1| chaperone surA precursor [Brucella canis ATCC 23365]
 gi|260566737|ref|ZP_05837207.1| SurA domain-containing protein [Brucella suis bv. 4 str. 40]
 gi|161335464|gb|ABX61769.1| Chaperone surA precursor [Brucella canis ATCC 23365]
 gi|260156255|gb|EEW91335.1| SurA domain-containing protein [Brucella suis bv. 4 str. 40]
          Length = 318

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVTAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|254688956|ref|ZP_05152210.1| Chaperone surA precursor [Brucella abortus bv. 6 str. 870]
 gi|260754445|ref|ZP_05866793.1| SurA domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260674553|gb|EEX61374.1| SurA domain-containing protein [Brucella abortus bv. 6 str. 870]
          Length = 318

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSKRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|163842954|ref|YP_001627358.1| chaperone surA precursor [Brucella suis ATCC 23445]
 gi|163673677|gb|ABY37788.1| Chaperone surA precursor [Brucella suis ATCC 23445]
          Length = 318

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 157/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVLPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|254693438|ref|ZP_05155266.1| Chaperone surA precursor [Brucella abortus bv. 3 str. Tulya]
 gi|261213691|ref|ZP_05927972.1| SurA domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915298|gb|EEX82159.1| SurA domain-containing protein [Brucella abortus bv. 3 str. Tulya]
          Length = 318

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 147/289 (50%), Gaps = 15/289 (5%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
           A  S ++  ++G  IT+ DI  R+A LKLQ+ +G L ++A  EL  E LK+ E++  GI 
Sbjct: 31  AGESEVKVIVSGNAITNSDIKHRMAFLKLQRKSGNLNQLARNELTEEMLKRIEMKSRGIN 90

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
                V+  +   A    ++    +  +++ G+   HFK+Y+ +Q  W  +V   F  + 
Sbjct: 91  ISDKEVDDAYAGFASRNKMTLAQLNQVMNQSGVTPEHFKKYIMVQMGWGRLVSARF--RA 148

Query: 157 GNLEMEIPANKQKMKN----ITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
             +  E  A ++ +KN        EY ++ V+F +P +K ++   + KR ++A   R R 
Sbjct: 149 TGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFVVPASK-RSPALLAKRRQEANALRARF 207

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIA 271
            ++C+   + A  I DV++     ++E  L  ++   +K +  N TT P+ T+KGVE++A
Sbjct: 208 -QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEWSKDVKAAGVNRTTKPHDTEKGVEFLA 266

Query: 272 ICDKRDLGGEIALKAYLSAQ--NTPTKIEKHEAE----YVKKLRSNAII 314
           +C  R +  +   +   S +  ++P   EK   E    YV++LR  A I
Sbjct: 267 VCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEELSKKYVQELREKATI 315


>gi|148559269|ref|YP_001258666.1| putative peptidyl-prolyl cis-trans isomerase [Brucella ovis ATCC
           25840]
 gi|148370526|gb|ABQ60505.1| putative peptidyl-prolyl cis-trans isomerase [Brucella ovis ATCC
           25840]
          Length = 318

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 156/317 (49%), Gaps = 18/317 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++   I      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRSINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN----ITVREYLIRTVL 184
           +   HFK+Y+ +Q  W  +V   F  +   +  E  A ++ +KN        EY ++ V+
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARF--RATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVI 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  
Sbjct: 181 FVVPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPG 238

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHE 301
           ++   +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +  ++P   EK  
Sbjct: 239 EWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKA 298

Query: 302 AE----YVKKLRSNAII 314
            E    YV++LR  A I
Sbjct: 299 EELSKKYVQELREKATI 315


>gi|110634111|ref|YP_674319.1| putative survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Mesorhizobium sp. BNC1]
 gi|110285095|gb|ABG63154.1| putative survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Chelativorans sp. BNC1]
          Length = 312

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 143/282 (50%), Gaps = 11/282 (3%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
           ++ IR  +N   IT  DI +R ALL+L +  G + ++A +E+I +TL++QE+ +SG+   
Sbjct: 33  ATEIRYVVNDRPITSFDIERRAALLRLMQRKGNVNELAAEEMIDQTLRQQEMARSGVNIT 92

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGN 158
              V+  +   A +  ++       L + G+G  HFK+++  Q  W  V+++    + G 
Sbjct: 93  QAMVDESYRNFAGSNNMTVAQLDQILGQAGVGKEHFKEFIRTQIGWGRVMQSRS--RSGT 150

Query: 159 L--EMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
           +  E ++     +Q  +  T  EY+++ V+F +P    Q    + KR ++A+  R R   
Sbjct: 151 ILSEQDVVQKMLQQGGQKPTATEYMLQQVIFVVP--AAQRGQLLAKRKREAQAMRDRF-N 207

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYV-TQKGVEYIAIC 273
            C    +FA  + DV++     +L  +L P++++ +  ++     P   T++GVE+I IC
Sbjct: 208 GCANTVQFAKGLIDVTVRDMGRVLAPELPPEWKDQISNTRPGNATPIRETERGVEFIGIC 267

Query: 274 DKRDLGGE-IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             R++  + +A   + S Q      E    EY+ +LR  A I
Sbjct: 268 SAREVSDDHVARMVFQSQQAGDGSFEDAAKEYMAELRKKARI 309


>gi|239831518|ref|ZP_04679847.1| Chaperone surA precursor [Ochrobactrum intermedium LMG 3301]
 gi|239823785|gb|EEQ95353.1| Chaperone surA precursor [Ochrobactrum intermedium LMG 3301]
          Length = 336

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 140/284 (49%), Gaps = 11/284 (3%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           S ++  ++G  IT+ DI  R+A LKLQ+  G L ++A QEL  E LK+ E++  GI    
Sbjct: 52  SEVKVIVSGNAITNSDIQHRVAFLKLQRKGGNLAQVAKQELTDEMLKRIEMKSRGIDISD 111

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             V+  +   A    +S    +  +++ G+  +HFK+Y+ +Q  W  +V   F       
Sbjct: 112 RQVDEAYAGFATRNKMSLAQLNQLMNQSGVTPDHFKKYIMVQMGWGRLVSARFRATGMVS 171

Query: 160 EMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
           E E      K   K     EY ++ V+F +P +K ++   + KR ++A   R R  ++C+
Sbjct: 172 EQEAVQRMLKDGGKKPVATEYRLQQVIFVVPASK-RSPALLAKRKQEANALRSRF-QNCD 229

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR 276
              + A  I DV++     ++E  L  ++   +K  S   TT P  T+KGVE++A+C  R
Sbjct: 230 ATRQQAKGILDVTVRDLGRIIEQQLPNEWSKAIKSTSVGGTTPPQETEKGVEFLAVCSTR 289

Query: 277 DLGGEIALKAYLSAQ--NTPT----KIEKHEAEYVKKLRSNAII 314
            +  +   +   S +  ++P     K E+   +Y+ +LR  A I
Sbjct: 290 QVSDDRVAQLVFSMEGADSPAGQEKKAEQLSEKYLGELREKAKI 333


>gi|319405490|emb|CBI79109.1| Peptidyl-prolyl cis-trans isomerase [Bartonella sp. AR 15-3]
          Length = 318

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 90/313 (28%), Positives = 147/313 (46%), Gaps = 15/313 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           + L    F+ +   I    + +++A +S +  T+NG  IT  DI +RIA LKLQ+  G L
Sbjct: 9   LALFCITFLSVSISISIFFTSQAFAQTSVV-VTVNGSAITSYDIQRRIAFLKLQQRQGNL 67

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
              A  ELI ETLK  EI++  I    + +   F   A    ++ E  S  L +  +   
Sbjct: 68  AVQAKNELIDETLKNNEIKRRNIEVSKDELESAFENFATQNNMTVEQLSQMLTQTDVTVE 127

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFSIP 188
           HFK Y+  Q  W  +V   +  + G L  E  A  + +KN  V+    EY ++ ++F IP
Sbjct: 128 HFKAYILGQMGWGRLVNARYQAEGGIL-TEQEAVHRILKNGGVKPSTNEYTLQQIIFVIP 186

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
           +++      ++KRIK+A + R    + CN  +     I D++I      LE  L   ++ 
Sbjct: 187 EHR--RSAILEKRIKEANQFRANF-RGCNSAKHQVKGILDITIRHLGKFLEPQLPRNWEK 243

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKHEA 302
            +L       TN   TQ+G+E IA+C  + +  +   +   S Q     + P  +E    
Sbjct: 244 AILATPAGKMTNLQETQRGIEAIAVCQIKRVSDDRVARLIFSIQDHQKKDIPQLLEAISE 303

Query: 303 EYVKKLRSNAIIH 315
           +Y+K+LR  A I 
Sbjct: 304 KYLKELRQTARIQ 316


>gi|319408317|emb|CBI81970.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 308

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 137/282 (48%), Gaps = 13/282 (4%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+NG  IT+ DI +RIA LKLQ+  G+L   A  ELI E LK  EI++  I    N +N 
Sbjct: 25  TVNGNPITNYDIQRRIAFLKLQQKQGDLSAQARNELIDEMLKNIEIQRLNIDVSDNEINS 84

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
            F   A    ++ +  S  L++  + + HFK Y++ Q  W  +V   +  + G L  E  
Sbjct: 85  AFANFAEQNNMTVDQLSEMLNQTEVTEEHFKAYISGQMGWGRLVNARYQSEDGYLS-EQE 143

Query: 165 ANKQKMKNITVR----EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE 220
           A  + +KN  ++    EY ++ ++F IP ++      + KR ++    R    + C+  +
Sbjct: 144 AAHRILKNGGIKPSTNEYTLQQIIFVIPAHRRAE--LLTKRTQEINNFRAHF-RGCDNTK 200

Query: 221 KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLG 279
           K    I DV++      LE  L   ++  ++ +     T P+ T  G+E +A+C  + + 
Sbjct: 201 KQTRGILDVTVRNLGKFLEPQLPTDWEQAIRATPAGKMTQPHETPYGIEALAVCQIKKVS 260

Query: 280 GEIALKAYLSAQN----TPTKIEKHEAEYVKKLRSNAIIHYY 317
            +   +   S Q+    TP K+E    +Y+K+LR  A I  +
Sbjct: 261 DDRVAQLMFSIQDSQKRTPQKLEALSEKYLKELRQRAHIQNH 302


>gi|13476523|ref|NP_108093.1| hypothetical protein mll7863 [Mesorhizobium loti MAFF303099]
 gi|14027284|dbj|BAB54238.1| mll7863 [Mesorhizobium loti MAFF303099]
          Length = 310

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 143/307 (46%), Gaps = 14/307 (4%)

Query: 15  LLTTYFVLIIFCI-VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           L +  F L++    V +      A +S I+  +N   IT GDI+ R A LKLQ+  G+  
Sbjct: 8   LFSAGFALLVAATSVSMTVMTPPAFASEIKYVVNDIPITTGDIAHRAAFLKLQRKKGD-- 65

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A QE+I +TL+  E  + GI      V   + + A N  +        ++K G+G +H
Sbjct: 66  --AAQEMIDQTLRLAEARRLGIRISDAQVEAAYQRFATNNKMQLGQLDGVMEKSGVGKDH 123

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----KNITVREYLIRTVLFSIPD 189
           FK+++  Q  W   +   +    G    E  A ++ +       +  EY+++ V+F +P 
Sbjct: 124 FKEFIRAQMAWNQALSARYRSGEGGSVTEQDAVRRMLDKGGAKPSATEYMLQQVIFVVPA 183

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +  +    + KR ++A+  R R    CN   +FA  + DV++     +L   L P +   
Sbjct: 184 S--ERSATLAKRKREADAMRARF-NGCNTTREFAKGLIDVTVRDLGRVLAPQLPPDWAEQ 240

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK-IEKHEAEYVKK 307
           +K ++    T    T++GVE+I IC  R++  +   +    ++ +  K  +    +YV +
Sbjct: 241 IKATKVGGATVTRETERGVEFIGICSSREVSDDKTAQMVFQSEGSNDKAADDLSKKYVDE 300

Query: 308 LRSNAII 314
           L++ A I
Sbjct: 301 LKAKARI 307


>gi|319404053|emb|CBI77641.1| Peptidyl-prolyl cis-trans isomerase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 319

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 148/315 (46%), Gaps = 25/315 (7%)

Query: 21  VLIIFCIVP----------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
            L +FCI              + +++A +S +  T+NG  IT+ DI +RIA LKLQ+  G
Sbjct: 8   ALALFCITSLSVSSLSVSTFFTSQAFAQTSVV-VTVNGSAITNYDIQRRIAFLKLQQKQG 66

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A  +LI E LK  EI++  I   ++ V   F   A    ++ +  +  L +  + 
Sbjct: 67  NLATQAKNDLIDEVLKNNEIKRRNIEVSTDEVENAFENFAAQNNMTVDQLNQMLTQTDVT 126

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFS 186
             HFK Y+  Q  W  +V   +  + G +  E  A+++ +KN  V+    EY ++ ++F 
Sbjct: 127 VEHFKAYILGQMGWARLVNARYQAE-GGVITEQEASQRILKNGGVKPSTNEYTLQQIIFV 185

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KR K+A + R    + CN  +  A  I D++I      LE  L   +
Sbjct: 186 IPEHR--RSAILEKRKKEANKFRANF-QGCNSAKNQAKGILDITIRHLGKFLEPQLPQNW 242

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKH 300
           +  +L       TN   TQ G+E +A+C  + +  +   +   S Q     N P  +E  
Sbjct: 243 EKAILATPAGKMTNFQETQNGIEAVAVCQIKRVSDDRVARLIFSIQDHQKKNIPQLLEAL 302

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 303 SEKYLKELRQTARIQ 317


>gi|260466949|ref|ZP_05813131.1| SurA domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259029246|gb|EEW30540.1| SurA domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 307

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 145/307 (47%), Gaps = 14/307 (4%)

Query: 15  LLTTYFVLIIFCI-VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           L +  F L++    V +      A +S I+  +N   IT GDI+ R A LKLQ+  G+  
Sbjct: 5   LFSAGFALLVAATSVSMTVMTPPAFASEIKYVVNNVPITTGDIAHRAAFLKLQRKKGD-- 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A QE+I +TL+  E  + GI      V   + + A +  +     +  ++K G+G +H
Sbjct: 63  --AAQEMIDQTLRLAEARRLGIRISDAQVEAAYQRFATSNKMQLSQLNGVMEKSGVGKDH 120

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----KNITVREYLIRTVLFSIPD 189
           FK+++  Q  W   +   +    G    E  A ++ +       +  EY+++ V+F +P 
Sbjct: 121 FKEFIRAQMAWNQALGARYRSGEGGSVTEQDAVRRMLDKGGAKPSATEYMLQQVIFVVPA 180

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +  +    + KR ++A+  R R    C    +FA  + DV++     +L   L P +   
Sbjct: 181 S--ERSATLAKRKREADAMRARF-NGCTTTREFAKGLIDVTVRDLGRVLAPQLPPDWAEQ 237

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK-IEKHEAEYVKK 307
           +K ++    T    T++GVE+I IC  R++  +   +    ++ +  K  ++   +YV++
Sbjct: 238 IKATKVGGATVTRETERGVEFIGICSSREVSDDKTAQMVFQSEGSSDKNADELSKKYVEE 297

Query: 308 LRSNAII 314
           L++ A I
Sbjct: 298 LKAKAHI 304


>gi|319407065|emb|CBI80702.1| Peptidyl-prolyl cis-trans isomerase [Bartonella sp. 1-1C]
          Length = 319

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 147/315 (46%), Gaps = 25/315 (7%)

Query: 21  VLIIFCIVP----------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
            L +FCI              + +++A +S +  T+NG  IT+ DI +RIA LKLQ+  G
Sbjct: 8   ALALFCITSLSVSSLSVSTFFTSQAFAQTSVV-VTVNGNAITNYDIQRRIAFLKLQQKQG 66

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A  +LI E LK  EI++  I    + V   F   A    ++ +  +  L +  + 
Sbjct: 67  NLATQAKNDLIDEVLKNNEIKRRNIEVSKDEVENAFENFAAQNNMTVDQLNQMLTQTDVT 126

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFS 186
             HFK Y+  Q  W  +V   +  + G +  E  A+++ +KN  V+    EY ++ ++F 
Sbjct: 127 VEHFKAYIWGQMGWGRLVNARYQAE-GGVITEQEASQRILKNGGVKPSTNEYTLQQIIFV 185

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KR K+A + R    + CN  +  A  I D++I      LE  L   +
Sbjct: 186 IPEHRW--SAILEKRKKEANKFRANF-QGCNSAKNQAKGILDITIRHLGKFLEPQLPQNW 242

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKH 300
           +  +L       TN   TQ G+E +A+C  + +  +   +   S Q     + P  +E  
Sbjct: 243 EKAILATPAGKMTNFQETQNGIEAVAVCQIKRVSDDRVARLIFSIQDHQKKDIPQLLEAL 302

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 303 SEKYLKELRQTARIQ 317


>gi|209885477|ref|YP_002289334.1| SurA N- domain family [Oligotropha carboxidovorans OM5]
 gi|209873673|gb|ACI93469.1| SurA N- domain family [Oligotropha carboxidovorans OM5]
          Length = 330

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 144/316 (45%), Gaps = 20/316 (6%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           LS F+  +   F   I   V   S ++      I   +NGE IT  DI +R  L+ L   
Sbjct: 24  LSVFVSRIALAFAAFIILAVTAPSVQAQG----IVVMVNGEPITTYDIEQRTKLITLTTR 79

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
                + A+QELI + LK +E +K G+   ++ V+  F   A+   +S++  +  L  QG
Sbjct: 80  KAPTRQQALQELIDDRLKIKEAKKFGVDLSASDVDSAFAGMAQRMRISSDQLAQVLQAQG 139

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDF--MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLF 185
           +  +  K  L   + W  +V+  F   L  G  +++    +      T   EY +R ++ 
Sbjct: 140 VRPDTMKFRLKADTAWGALVRGRFKQSLLVGERDVQAAVGENPSGERTESYEYHMRPIVL 199

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            +P     + G V++R K+AE  R R+ + C +  +    +   SI        +DL P 
Sbjct: 200 FVPRG---SSGAVEQRKKEAEALRERI-QSCEEATRVFKSLRQASIRDTIVKTSADLPPN 255

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKH 300
            + LL K+     T P VT++G+E +A+C+++    D   + A +  L AQ    K E  
Sbjct: 256 LRELLDKTPVGRMTAPEVTRQGIEMVALCNRQVTTADTPAKRAARDKLFAQ----KYEAK 311

Query: 301 EAEYVKKLRSNAIIHY 316
              Y++ LR  A+I Y
Sbjct: 312 SKSYLEDLRKRAMIEY 327


>gi|319898728|ref|YP_004158821.1| Peptidyl-prolyl cis-trans isomerase [Bartonella clarridgeiae 73]
 gi|319402692|emb|CBI76238.1| Peptidyl-prolyl cis-trans isomerase [Bartonella clarridgeiae 73]
          Length = 319

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 144/315 (45%), Gaps = 25/315 (7%)

Query: 21  VLIIFCIVP----------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           VL +FCI              + + +A +S +  T+NG  IT  DI +RIA LKLQ+  G
Sbjct: 8   VLALFCITSLSVSSLSVSTFFTSQVFAQTSVV-VTVNGNPITSYDIQRRIAFLKLQQKQG 66

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A  ELI E LK  EI++  I    + V   F   A    ++ +  +  L +  + 
Sbjct: 67  NLAAQAKNELIDEALKNNEIKRRNIEVSKDEVESAFKNFALQNNMTVDQLNQMLAQTDVT 126

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFS 186
             HFK Y+  Q  W  +V   +  + G L  +  A++  +KN  V+    EY ++ ++F 
Sbjct: 127 VEHFKTYILGQMGWGRLVNARYQAEGGVLTEQETAHR-ILKNGGVKPSTNEYTLQRIIFV 185

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KR K+A + R      C+  +  A  I DV+I      LE  L   +
Sbjct: 186 IPEHR--RSAILEKRKKEANKFRANF-HGCHNAQNQAKSILDVTIRHLGKFLEPQLPQNW 242

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKH 300
           +  +L       TN   TQ G+E +AIC  + +  +   +   S Q     + P  +E  
Sbjct: 243 EKAILATPAGKMTNFQETQYGIEALAICQIKRVSDDRVARLIFSIQDHQKKDIPQLLEAL 302

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 303 SEKYLKELRQTAHIQ 317


>gi|319784426|ref|YP_004143902.1| SurA domain [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170314|gb|ADV13852.1| SurA domain [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 309

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 141/309 (45%), Gaps = 16/309 (5%)

Query: 15  LLTTYFVLIIFCI-VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           L +  F L++    V I      A +S I+  +N   +T GDI+ R A LKLQ+  G+  
Sbjct: 5   LFSAGFALLVAATSVSITVMAPPAFASEIKYVVNDIPVTTGDIAHRAAFLKLQRKKGD-- 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A QE+I +TL+  E ++ GI      V+  + + A +  +        ++K G+  +H
Sbjct: 63  --AGQEMIDQTLRMAEAKRLGIRISDAQVDAAYQRFASSNKMQLSQLDGVMEKSGVTKSH 120

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM-----KNITVREYLIRTVLFSIP 188
           FK+++  Q  W   +   +    G   +      +KM        +  EY+++ V+F +P
Sbjct: 121 FKEFIRAQMAWNQALSARYRSGDGTGAVSEQDLVRKMLEKGGAKPSATEYMLQQVIFVVP 180

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
               +    + KR ++A+  R R    CN   +FA  + DV++     +L   L P +  
Sbjct: 181 --AAERSATLGKRKREADAMRARF-NGCNTTREFAKGLIDVTVRDLGRVLAPQLPPDWAE 237

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT--KIEKHEAEYV 305
            +K ++    T    T++GVE+I IC  R++  +   +    A+ +      +    +YV
Sbjct: 238 QIKATKVGGATVTRETERGVEFIGICSSREVSDDKVAQMAFQAEGSGGDKDADALSKKYV 297

Query: 306 KKLRSNAII 314
            +L++ A I
Sbjct: 298 DELKAKARI 306


>gi|49474098|ref|YP_032140.1| hypothetical protein BQ04600 [Bartonella quintana str. Toulouse]
 gi|49239602|emb|CAF25959.1| hypothetical protein BQ04600 [Bartonella quintana str. Toulouse]
          Length = 324

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 147/313 (46%), Gaps = 24/313 (7%)

Query: 21  VLIIFCIVPIVSYKSWAMS----------SRIRTTINGEVITDGDISKRIALLKLQKING 70
           +L +FCI P+ S  +  +S          + I  T+NG  IT+ DI +R A LKLQ+  G
Sbjct: 14  ILALFCIAPL-SVSNLLVSGFLISPVFAQTVIVVTVNGNPITNYDIQRRTAFLKLQQKQG 72

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A  ELI E +K  EI++  I    N V   F   A    ++ +  +  L +  I 
Sbjct: 73  NLAAQAKNELINEIVKNTEIKRRNIEVSDNEVESAFENFAMQNNMTVDQLNQILMQNDIT 132

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFS 186
             HFK Y+  Q  W  +V   +  + G +  E  A ++ +KN  V+    EY ++ ++F 
Sbjct: 133 VQHFKDYIRGQIGWGRLVNARYQAEIGMVS-EQEAVRRILKNGGVKPSTNEYTLQQIIFV 191

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      +++R ++A+  R    + C   +K A  I DV+I      LE  L  ++
Sbjct: 192 IPEHR--RSEILERRQREAKSFRAHF-QGCANAQKQARGILDVTIRHLGKFLEPQLPREW 248

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN----TPTKIEKHE 301
              ++ +     T    T  G+E +A+C  + +  +   +   S Q+    +P K+E   
Sbjct: 249 GQAVRATPVGKMTQLRETTDGIEALAVCKIKRVSDDYVARLIFSLQDNKEKSPQKLEILS 308

Query: 302 AEYVKKLRSNAII 314
            +Y+K+LR  A I
Sbjct: 309 EKYLKELRQAAHI 321


>gi|49475336|ref|YP_033377.1| hypothetical protein BH05420 [Bartonella henselae str. Houston-1]
 gi|49238142|emb|CAF27350.1| hypothetical protein BH05420 [Bartonella henselae str. Houston-1]
          Length = 322

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 143/310 (46%), Gaps = 20/310 (6%)

Query: 21  VLIIFCIVP-------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L +FCIVP       +    S    + I  T+NG+ IT+ DI +R A L+LQ+  G L 
Sbjct: 14  ILTLFCIVPLSISNLLVSEIPSTFAQTVIVVTVNGKPITNYDIQRRAAFLRLQQKQGNLS 73

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A  ELI E LK  EI++  I   +N V   F   A    ++ +  +  L    I   H
Sbjct: 74  EQAKNELINEVLKNIEIKRRNIEVSNNEVESAFKNFAAQNNMTVDQLNQILIDNDITVQH 133

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFSIPD 189
           FK Y+  Q  W  +V   +  + G +  E  A ++ +KN  V+    EY ++ ++F IP 
Sbjct: 134 FKDYIRGQLGWGRLVNARYQAETGMIS-EQEAVRRILKNGGVKPSTNEYTLQRIIFVIPA 192

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           ++       ++R ++A   R    + C    K A  I DV++      LE  L  +++  
Sbjct: 193 HR--RSEIFERRQREANNFRAHF-QGCANTSKQAKGILDVTVRNLGKFLEPQLPREWEQA 249

Query: 250 LK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN----TPTKIEKHEAEY 304
           ++       T    T  G+E IA+C  + +  +   +   S Q+    +P ++E    +Y
Sbjct: 250 IRITPAGKMTQLQETADGIEAIAVCKIKRVSDDYVARLIFSLQDNKQKSPQELEILSEKY 309

Query: 305 VKKLRSNAII 314
           +K+LR  A I
Sbjct: 310 LKELRQVARI 319


>gi|328544014|ref|YP_004304123.1| SurA N-terminal domain family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413758|gb|ADZ70821.1| SurA N-terminal domain family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 307

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 142/282 (50%), Gaps = 11/282 (3%)

Query: 42  IRTTINGEVITDGDISKRIALLKL-QKINGE-LEKIAVQELIVETLKKQEIEKSGITFDS 99
           I+  +N + IT  DI++R  L+ L Q+ +GE   ++A +EL+ + LK +E ++ GI+   
Sbjct: 29  IKVVVNEQAITSYDIAQRARLITLTQRKSGETARRMAQEELVDDVLKLKEAQRIGISVSK 88

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             V+  F   A+   +S  + ++ L + G+  +  +  L  +  W   V   F  +    
Sbjct: 89  GDVDDAFASIAQRVKMSPANLAAALRQSGVDPDTLRARLRAEVAWSRAVGQRFRAQVKVS 148

Query: 160 EMEIPANKQKM----KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
           + ++ A  QK     KN+++ E+ +R V+F +P     + G   +R ++A++ R      
Sbjct: 149 DSDVIAALQKSEDKNKNLSI-EFELRQVIFVVPQKA--SSGLKAQRKREADQFRKEFT-S 204

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICD 274
           C      A  +++V +    + LE++L P  ++ + K++    T P  T +G+E IA+C 
Sbjct: 205 CETGAAQARTLNEVVVRAIGHRLETELPPALRDTIVKTEVGRLTPPEQTSRGLEMIAVCG 264

Query: 275 KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           KR++  +IA +  +  +    + E+    Y+++LR  A I Y
Sbjct: 265 KREIQSDIAARTAIEDELRQKEGEQMSRRYLQELRRRATIEY 306


>gi|114704782|ref|ZP_01437690.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Fulvimarina pelagi HTCC2506]
 gi|114539567|gb|EAU42687.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Fulvimarina pelagi HTCC2506]
          Length = 308

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 124/274 (45%), Gaps = 9/274 (3%)

Query: 47  NGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFF 106
           NG  +T   I +R A LKL+++ G   + A  ELI E LK+QEI++ G+      VN  +
Sbjct: 35  NGMPVTTYQIRQRAAFLKLRRVGGNTTQKATDELIDEALKRQEIQRQGVNIPDEEVNAAY 94

Query: 107 VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN 166
           +  A+   LS    +  L   G     FK Y+ +Q  W          +    E +    
Sbjct: 95  LNFAKGNNLSEAQLAEVLGSAGFSPQAFKDYIRVQMGWGQAASRRIQREERLTEQDAVQR 154

Query: 167 --KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
              Q  +  +  EY ++ V+F IP+   Q    +  R ++A+  R R  + C+    FA 
Sbjct: 155 MLAQGGEKPSTTEYTLQQVIFVIPNG--QRGAMLANRKREAQAMRQRF-QSCDSTLAFAQ 211

Query: 225 KIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
            + DV++     + + +L   + +++++ S    T    T +GVE+I +C+ R +  + A
Sbjct: 212 GLRDVTVRDLGRVAQPELPSLWKEDVMQTSPGRATPTKETDRGVEFIGVCNARQISDDRA 271

Query: 284 LKAYLSAQNTPT---KIEKHEAEYVKKLRSNAII 314
            +    A++  +        +A  +KKLR  A I
Sbjct: 272 AQMVFQARDMESLNGDGSGADAALLKKLRDEAQI 305


>gi|163868025|ref|YP_001609229.1| peptidyl-prolyl cis-trans isomerase [Bartonella tribocorum CIP
           105476]
 gi|161017676|emb|CAK01234.1| Peptidyl-prolyl cis-trans isomerase [Bartonella tribocorum CIP
           105476]
          Length = 322

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/313 (27%), Positives = 144/313 (46%), Gaps = 22/313 (7%)

Query: 21  VLIIFCIVPI-VS--------YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +L +FCI  + VS          S    + I  T+NG  IT+ DI +R+A L+LQ+  G 
Sbjct: 14  LLALFCIASLGVSSLLINEFLISSAFAQTAIVVTVNGNPITNYDIQRRVAFLRLQQKQGS 73

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L   A +ELI E LK  EI++  I   ++ VN  F   A    ++ +  +  L +  I  
Sbjct: 74  LAAQAKKELIDEELKNIEIKRRNIEVSNDEVNRAFENFATQNNMTVDQLNQILIQNDITV 133

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFSI 187
            HFK Y+  Q  W  +V   +  + G +  E  A ++ +KN  V+    EY ++ ++F I
Sbjct: 134 QHFKDYIRGQIGWGRLVSARYQAQTGMVS-EQEAVRRILKNGGVKPSTNEYTLQRIVFVI 192

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF- 246
           P ++      +++R ++A   R    + C      A  I DV+I      LE  L   + 
Sbjct: 193 PAHR--RSEILERRQREASNFRAHF-RGCANAHNQARGILDVTIRPLGKFLEPQLPSAWE 249

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT----PTKIEKHEA 302
           Q +L       T    T  G+E IA+C  + +  +   +   S Q+     P K+E+   
Sbjct: 250 QAILATPAGKMTKLQETSDGIEAIAVCKIKRISDDYVARLIFSLQDNKKRDPKKLEELSE 309

Query: 303 EYVKKLRSNAIIH 315
           +Y+++LR  A I 
Sbjct: 310 KYLEELRRVARIQ 322


>gi|86749597|ref|YP_486093.1| hypothetical protein RPB_2477 [Rhodopseudomonas palustris HaA2]
 gi|86572625|gb|ABD07182.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 309

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 144/312 (46%), Gaps = 15/312 (4%)

Query: 16  LTTYFVLIIFCIVPIVSYKSW-----AMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           +TT F   IF      +  SW     A +  +   +NGE IT+ DI +R  L KL   + 
Sbjct: 1   MTTKFSFRIFAAALCCAVASWSGIGLARAQSVAVMVNGEPITNFDIEQRSKLDKLSNQSR 60

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
             +++ + ELI E +K +E +K G+    + ++  F   +    +S +     L  QGI 
Sbjct: 61  TRQQV-LDELIDEKVKIREGKKFGVNPSDSDIDSSFASMSSRMRMSPDQMVKMLAAQGIR 119

Query: 131 DNHFKQYLAIQSIWPDVVKNDF----MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLF 185
               K  +  + +W  +V+  F    ++   +++ ++ A     K+ T   EY +R V+ 
Sbjct: 120 PGTLKSKIKAEMVWTSLVRGRFKDSLLVGEKDIQAQLAAKGGDDKSTTESFEYQMRPVVL 179

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            +  ++    G V+ R K+AE  R R+ + C   ++    + + +I        +DL P 
Sbjct: 180 IV--SRGSGAGAVEARRKEAEALRSRV-QSCADADRIFKALPNAAIRATVVKTSADLPPA 236

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEY 304
            + +L K+     T P  T++GVE +A+C ++    +  +K  +  +    K +    +Y
Sbjct: 237 LREILDKTPVGQMTAPEATKQGVEMVALCSRKPTTADTPMKREIREKMYAEKFQAKSKDY 296

Query: 305 VKKLRSNAIIHY 316
           +++ R+ A+I Y
Sbjct: 297 LRESRNAAMIEY 308


>gi|85716332|ref|ZP_01047305.1| hypothetical protein NB311A_19130 [Nitrobacter sp. Nb-311A]
 gi|85696848|gb|EAQ34733.1| hypothetical protein NB311A_19130 [Nitrobacter sp. Nb-311A]
          Length = 319

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 138/307 (44%), Gaps = 8/307 (2%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           L   +  L +F  +  VS+ S   +  +   +NGE IT  DI +R  L+K+        +
Sbjct: 6   LFRPFSRLAVFAFLSFVSFNSPLSAQSVAVMVNGEPITTFDIEQRSRLIKISTHKSASRQ 65

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             + ELI E +K +E +K G+   S  ++  +       G+S E  +  L  QG+  +  
Sbjct: 66  EVIDELIGEKVKIKEAKKFGVNPTSADIDRAYANMGARMGMSPEQLTKSLASQGVRPDTI 125

Query: 135 KQYLAIQSIWPDVVKNDF----MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
           K  L    +W  +V+  F    ++   ++   +  + +    I   EY +R V+  +P  
Sbjct: 126 KARLRADLVWGSLVRGRFKESLLVSDRDVNEALKNSGEDQSKIEGVEYQMRPVVLIVPRG 185

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
              +   ++ R  +A   R R+ + C    +    + + ++        +DL P  ++LL
Sbjct: 186 AAAS--VMEARRNEANSLRERV-QSCADAIRIVKAMRNATLRDRVTKTSADLPPPLRDLL 242

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
            K+   + T P +T++G+E +A+C+K+    +   K  +  +    K EK    Y++ +R
Sbjct: 243 DKTPVGHLTPPEITRQGIEMVAVCEKKVTSVDTPKKREIREKMFADKYEKRSKSYLENIR 302

Query: 310 SNAIIHY 316
            +A+I Y
Sbjct: 303 RSAMIEY 309


>gi|121602042|ref|YP_988820.1| SurA domain-containing protein [Bartonella bacilliformis KC583]
 gi|120614219|gb|ABM44820.1| SurA domain protein [Bartonella bacilliformis KC583]
          Length = 325

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 143/312 (45%), Gaps = 12/312 (3%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKS-WAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           F+ L  T F+ +    + ++S    +A  +++  T+NG  IT+ DI +RIA LKLQ+   
Sbjct: 14  FLTLFFTAFLGVSSLFINVLSISPVFAQQTKVALTVNGNAITNYDIQRRIAFLKLQQKKE 73

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A  ELI E LKK EI++  I    + V+  F   A    ++    S  L +  + 
Sbjct: 74  NLSVQAKNELIDEMLKKIEIKQRNIDVSDSEVDAAFENFAVQNHMTINQLSEMLTQTNVT 133

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNL-EMEIPAN--KQKMKNITVREYLIRTVLFSI 187
             HFK Y+  Q  W  +V   +  + G L E E+     K   +  +  EY ++ ++F I
Sbjct: 134 VKHFKDYIRGQIGWGRLVNARYQAEGGLLTEQEVAHKILKNGGQKPSTDEYTLQRIIFVI 193

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           P ++      +QKR ++A   R      CN        I DV+I  +  +LE  L   ++
Sbjct: 194 PAHR--RSEILQKRTQEANSFREHF-NGCNNTRAQVKGILDVTIRSSVKILEPQLPQDWK 250

Query: 248 N-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT----PTKIEKHEA 302
             +L+      T    T  G+E  A+C  + +  +   +   S Q++    P ++E    
Sbjct: 251 KFILETPAGKMTQVQETPNGIEAFAVCQIKRVSDDRVAQLLFSIQHSQEDIPQELETLSE 310

Query: 303 EYVKKLRSNAII 314
           +Y+K+L+  A I
Sbjct: 311 KYLKELQQAAHI 322


>gi|254473455|ref|ZP_05086852.1| SurA N-terminal domain family protein [Pseudovibrio sp. JE062]
 gi|211957571|gb|EEA92774.1| SurA N-terminal domain family protein [Pseudovibrio sp. JE062]
          Length = 313

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 139/311 (44%), Gaps = 16/311 (5%)

Query: 18  TYFVLIIFCIVPIVS-----YKSWAMSSRIRTTINGEVITDGDISKRIALLKL--QKING 70
           T F   +F    I++       S   +S+I   +NG  IT  ++ +R  L+ L  +  + 
Sbjct: 4   TRFCASLFVAASILAPVGPMLTSAEAASKIVAVVNGRPITSYELQQRSKLISLTTRAPSS 63

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
             ++ A  ELI E LK  E ++ G++   + V+  F   A+   +S   F   L + G+ 
Sbjct: 64  IAKRKAKDELIDEALKLAEAKRVGVSISDSKVDDAFATIAQRVKMSPSQFKQALSQSGVN 123

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN-----ITVREYLIRTVLF 185
               K  L  +  W +VV   F       E ++ A  Q  +N      T  EY ++ ++F
Sbjct: 124 PRTLKSRLRAEISWSEVVMQRFRATVRINESDVIAALQGRENKDDSGATSVEYDLQRIIF 183

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            IP N   ++ F  KR+ + ++ R R    C +  + AS +++V +      LE+DL P 
Sbjct: 184 VIPKN--SSKTFKNKRVSEMKKLRARF-TSCEEGTRLASGLNEVVVRPIGKRLETDLPPA 240

Query: 246 FQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           F   L + S    T P     G E IA+C K  +  +   ++ +  +    K ++    Y
Sbjct: 241 FVKKLNEISIGRVTAPTPVDSGFEMIALCGKETINSDATARSTIEGELRNKKGQQLSRRY 300

Query: 305 VKKLRSNAIIH 315
           ++ LRSNA+I 
Sbjct: 301 LRDLRSNAVIE 311


>gi|240850229|ref|YP_002971622.1| peptidyl-prolyl cis-trans isomerase [Bartonella grahamii as4aup]
 gi|240267352|gb|ACS50940.1| peptidyl-prolyl cis-trans isomerase [Bartonella grahamii as4aup]
          Length = 324

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 87/313 (27%), Positives = 147/313 (46%), Gaps = 18/313 (5%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           +I  L+   +LI   ++P V    +A +S I  T+NG  IT+ DI +R+A L+LQ+  G 
Sbjct: 19  YITSLSVSSLLINGFLIPTV----FAQTS-IVVTVNGNPITNYDIQRRLAFLRLQQKQGN 73

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L   A +ELI E LK  EI++  I   ++ V+  F   A    ++ +  +  L +  I  
Sbjct: 74  LVAQAKKELIDEKLKNIEIKRRNIEVSNDEVDRAFENFATQNNMTIDQLNQILIQTEITV 133

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR----EYLIRTVLFSI 187
            HFK Y+  Q  W  +V   +  + G +  E  A ++ +KN  V+    EY ++ ++F I
Sbjct: 134 QHFKDYIRGQIGWGRLVSARYQAETGMIS-EQEAVRRILKNGGVKPSTNEYTLQRIVFVI 192

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF- 246
           P ++       ++R ++A   R    + C      A  I DV+I      LE  L   + 
Sbjct: 193 PAHR--RSEIFERRQREASNFRAHF-RGCANAHNQARGILDVTIRHLGKFLEPQLPNAWE 249

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN----TPTKIEKHEA 302
           Q +L       T    T  G+E IA+C  + +  +   +   S Q+    +P K+E+   
Sbjct: 250 QAILATPAGKMTKLQETSDGIEAIAVCKIKRVSDDYVARLIFSLQDSKKRSPQKLEELSD 309

Query: 303 EYVKKLRSNAIIH 315
           +Y+ +LR  A I 
Sbjct: 310 KYLGELRRVARIQ 322


>gi|154246774|ref|YP_001417732.1| putative peptidyl-prolyl cis-trans isomerase SurA [Xanthobacter
           autotrophicus Py2]
 gi|154160859|gb|ABS68075.1| putative peptidyl-prolyl cis-trans isomerase SurA [Xanthobacter
           autotrophicus Py2]
          Length = 303

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 132/282 (46%), Gaps = 7/282 (2%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
           A + +I   +NG+ IT  D+S+R  + ++ +      + A+++LI E +K Q+  +  + 
Sbjct: 24  AQAQQIIVMVNGDPITTFDVSQRQLMHQMIERKSVSAQQALEDLIDERIKIQQAIRLKME 83

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK-NDFMLK 155
            +   V+  +   A  +G + E  +    +QG+ D  FKQ L    +W   V+     + 
Sbjct: 84  VEQKDVDRLYASVAERSGRTPEQLTEGFKQQGLNDRTFKQKLFADYVWGQYVRARSGTVN 143

Query: 156 YGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
             + ++     K+    +   EY +  ++F +P    +N G    R+ +A   R R   D
Sbjct: 144 VRDADVVAALQKRGETQMIATEYTLMPIVFVVP----RNAGNYAARLAEANALRGRF-TD 198

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICD 274
           C+   +    + +V +      L S++ PQ + +L K++    T P V Q GVE  AIC 
Sbjct: 199 CDAGAQTVKSLKEVVVRPKVTRLSSEMPPQLRQILDKTEIGRLTPPEVAQSGVETFAICG 258

Query: 275 KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           KR++ GE A K  +  + +  +      +++ +LR  ++I Y
Sbjct: 259 KREVRGESAQKKEIKDELSNAQFAAESKKFMAELRKQSLIEY 300


>gi|90423813|ref|YP_532183.1| hypothetical protein RPC_2310 [Rhodopseudomonas palustris BisB18]
 gi|90105827|gb|ABD87864.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 320

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 134/304 (44%), Gaps = 12/304 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI 75
           L     ++  C+ P +  +S A+       +NGE IT+ DI +R  L+ L        + 
Sbjct: 25  LCCAVAMLAICLGPDLHAQSVAV------MVNGEPITNYDIEQRSKLMALSTHKSPSRQQ 78

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            + ELI E +K +E +K GI      ++  F        +SAE  +  L+ QGI     K
Sbjct: 79  VIDELINEKVKIREGKKFGIDPSVADIDGSFAGMGSRMRMSAEQLTKSLEGQGIRPETLK 138

Query: 136 QYLAIQSIWPDVVKNDF--MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           Q +  + +W  +V+  F   L  G  E+          +    EY +R ++  +P N   
Sbjct: 139 QRMRAEMVWTSLVRGRFKDSLLVGEKEVRAALGGDDKSSGESFEYQMRPIVLIVPRNAAP 198

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
           +    + R+K+AE  R R+ + C + +     + + +I        +D+    + +L K+
Sbjct: 199 SA--RELRMKEAEALRSRV-QSCAEADDLFKSMQNAAIRDTVTKTSADIPGVLREVLDKT 255

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
              + T P VT++GVE +A+C ++    +   K  +  +    K E     Y++ +R  A
Sbjct: 256 PIGHLTAPEVTKQGVEMVALCSRKPTTADTPKKREIRDKMFADKFEAKSKSYLRDVRKAA 315

Query: 313 IIHY 316
           +I Y
Sbjct: 316 MIEY 319


>gi|75675872|ref|YP_318293.1| hypothetical protein Nwi_1680 [Nitrobacter winogradskyi Nb-255]
 gi|74420742|gb|ABA04941.1| conserved unknown protein [Nitrobacter winogradskyi Nb-255]
          Length = 314

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 139/301 (46%), Gaps = 8/301 (2%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL 80
           +L +F  +  VS  S   +  I   +NGE IT  DI +R  L+K+        +  + EL
Sbjct: 12  LLAVFAFLTFVSMNSPLHAQSIAVMVNGEPITTLDIEQRSRLIKISTHKSPSRQEVIDEL 71

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I E +K +E +K G+   S  ++  +       G+S E  +  L  QGI  +  K  L  
Sbjct: 72  IDEKVKVKEAKKYGVNPTSTDIDRAYANMGARMGMSPEQLTKSLGSQGIRPDTIKSRLKA 131

Query: 141 QSIWPDVVKNDF----MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
             +W  +V+  F    ++   ++   +  + +    I   EY +R V+  +P  +     
Sbjct: 132 DLVWGSLVRGRFKESLLVSDRDVNEALKNSGEDQSKIEGVEYQMRPVVLIVP--RGATAS 189

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-N 255
            V+ R  +A   R R+ + C ++ +    + + ++ +      +DL P  ++LL K+   
Sbjct: 190 MVEARRNEANALRERV-QSCAEIIRTVKVMRNATLRETITKTSTDLPPPLRDLLDKTAVG 248

Query: 256 NTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           + T P +T++GVE +A+C K+    +   K  +  +    K EK    Y++++R +A+I 
Sbjct: 249 HLTPPEMTRQGVEMVAVCGKKVTSVDTPKKKEIREKMFADKYEKRSKSYLERIRKSAMIE 308

Query: 316 Y 316
           Y
Sbjct: 309 Y 309


>gi|115525297|ref|YP_782208.1| hypothetical protein RPE_3295 [Rhodopseudomonas palustris BisA53]
 gi|115519244|gb|ABJ07228.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 305

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 118/274 (43%), Gaps = 6/274 (2%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +NGE IT  DI +R  L +L        +  ++ELI E +K +E +K GI      ++  
Sbjct: 34  VNGEPITSYDIDQRSKLTQLSTRKTPPRQEVIEELINEKVKIKEGKKFGIDPSGADIDSS 93

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF--MLKYGNLEMEI 163
           F        +S E  +  L   GI  +  K  +  + +W  +V+  F   L  G  +++ 
Sbjct: 94  FANMGSRMRMSPEQLTQTLANSGIRPDTLKHRMRAEMVWTSLVRGRFKDSLLVGEKDIQA 153

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
                        EY +R V+  +P N        + R+K+AE  R R+ + C +     
Sbjct: 154 ALGDSDKPAGESFEYQMRPVVLIVPRN--AAPASREARMKEAEALRARV-QTCEEANALF 210

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEI 282
             + + +I        +DL P  + LL K+   + T P  T++GVE +A+C ++    + 
Sbjct: 211 KSMPNAAIRATVSKTSADLPPSLRELLDKTPIGHLTAPEATKQGVEMVALCSRKPTTADT 270

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             K  +  +    K E     Y++ +R  A++ Y
Sbjct: 271 PKKREIREKMFAEKFEAKSKAYLRDVRKAAMVEY 304


>gi|304392008|ref|ZP_07373950.1| survival protein SurA [Ahrensia sp. R2A130]
 gi|303296237|gb|EFL90595.1| survival protein SurA [Ahrensia sp. R2A130]
          Length = 343

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 126/290 (43%), Gaps = 20/290 (6%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFD 98
            +RI   +N   IT  DI++R   ++L+++ G    IA  ELI E +K +E  +      
Sbjct: 59  GTRIAVLVNETPITSTDIARRAKFVRLRRMKGNATTIATNELIDEAIKMKEARRINAVAS 118

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY-- 156
              V+  +   A+N  L+       L + G     FK Y+     W   V +    +   
Sbjct: 119 DAEVSSAYAGFAKNNKLTQPQLGQVLSRSGTTVRGFKDYIRASLSWQRAVGSRMRAEASG 178

Query: 157 -GNL--EMEIP-----ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
            G L  + + P     A  Q  K     EY ++ ++F +P +K   +G +  R   A + 
Sbjct: 179 RGGLGEKAKGPRFLSSAGTQGAKEG---EYTLQQIVFVVPSDK---RGQLSARRAQANQF 232

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
           R R+    N LE  A  + DVS+     LL+S L PQ+   ++  S+   T    T KGV
Sbjct: 233 RTRMNGCTNALE-LAKSLRDVSVRDRGRLLDSQLPPQWAKEIRALSEGGVTRTKDTDKGV 291

Query: 268 EYIAICDKRDLGGEIALKAY--LSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           E +A+C KR++    +  +       N   +  + E +Y+ +L+  A I 
Sbjct: 292 EMLALCRKREVRASTSSTSADLFGGANFAEQQSETEKKYLAELKERATIQ 341


>gi|182677646|ref|YP_001831792.1| hypothetical protein Bind_0653 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633529|gb|ACB94303.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 306

 Score = 85.5 bits (210), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 130/273 (47%), Gaps = 6/273 (2%)

Query: 44  TTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVN 103
            +ING+ IT+ D+ +R+ +L++ +     E  A++ L  + L+  E  + G+      + 
Sbjct: 35  ASINGDPITNIDVDERMKMLRVLRKPATREA-AMESLYTDRLETHEAARYGVKPKDADIG 93

Query: 104 YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN-DFMLKYGNLEME 162
              V+ A+   +  E   + L   G+  +HFK +      +  +V   +  ++    E+ 
Sbjct: 94  QEIVRVAQEMKVQPEALIAALQNAGVSPDHFKAHFGADLAFGALVGALNKGVEASETEVR 153

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
               +Q  K     EY +R V+FS+P+N       +  R ++AE+ R R   DC   EK 
Sbjct: 154 KELARQGGKAAAGTEYTLRQVIFSLPNNVAP--AAINARGQEAEQLRQRF-ADCESGEKM 210

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGE 281
              ++DV+I        +++    +NLL K+   + T P  +  G+E IA+C K     +
Sbjct: 211 VFALNDVTIRDPIRRTSTEISEGLRNLLDKTPVGHLTPPQRSSAGLEMIAVCRKGAALDD 270

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            AL+  +S +   T++    A+ +K++R +A+I
Sbjct: 271 TALRQQISQKILATRLSADRAKRLKEMRDHAVI 303


>gi|91977437|ref|YP_570096.1| hypothetical protein RPD_2969 [Rhodopseudomonas palustris BisB5]
 gi|91683893|gb|ABE40195.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 309

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 144/311 (46%), Gaps = 15/311 (4%)

Query: 16  LTTYFV-----LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           +TT F+     L +FC V +      A +  +   +NGE IT+ DI +R  L +L + + 
Sbjct: 1   MTTKFLFRILGLALFCTVTVGGGLGVATAQSVAVMVNGEPITNFDIEQRSKLDRLSRASR 60

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
             +++ + ELI E +K +E +K G++   + +   F   +    +S +  +  L  QGI 
Sbjct: 61  TRQQV-LDELIDEKVKIREGKKYGVSPSDSDIESSFSTMSSRMRMSPDQMTKMLSAQGIR 119

Query: 131 DNHFKQYLAIQSIWPDVVKNDF----MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLF 185
               K  +  + +W  +V+  F    ++   +++ ++ A        T   EY +R V+ 
Sbjct: 120 PETLKSKIKAEMVWASLVRGRFKDSLLVGEKDIQAQLGAKGGDEPATTESFEYQLRPVVL 179

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            +  ++  +   ++ R K+AE  R R+ + C   ++    + + +I        +DL   
Sbjct: 180 IV--SRGSDSSALEARRKEAESLRSRV-QSCADADRIFKALPNTAIRSTVVKTSADLPQA 236

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEY 304
            + +L K+     T P  T++G+E +A+C ++    +   K  +  +    K +    EY
Sbjct: 237 LREILDKTPVGQMTAPEATKQGIEMVALCSRKPTTADTPKKREIREKLFAEKFQAKSKEY 296

Query: 305 VKKLRSNAIIH 315
           ++++R+ A+I 
Sbjct: 297 LREVRNAAMIE 307


>gi|316933705|ref|YP_004108687.1| SurA domain [Rhodopseudomonas palustris DX-1]
 gi|315601419|gb|ADU43954.1| SurA domain [Rhodopseudomonas palustris DX-1]
          Length = 308

 Score = 82.8 bits (203), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 140/308 (45%), Gaps = 9/308 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSW-AMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           KL      L++ C    +   +  + +  I   +NGE IT+ DI +R  L ++   N   
Sbjct: 4   KLSLRIIGLVLCCAAATLGLGTGPSQAQSIVVMVNGEPITNFDIEQRSKLNRMSHKNESR 63

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           +++ + +LI E +K +E +K G+    + ++  F   A    +S    ++ L  QGI  +
Sbjct: 64  QQV-LDDLIDEKVKIKEGKKYGVNPSDSDIDSSFATMASRMRMSTAQMTNMLAAQGIRPD 122

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA---NKQKMKNITVREYLIRTVLFSIPD 189
             K  +  + +W  +V+  F       E EI A        K +   EY +R ++  +  
Sbjct: 123 TLKSRIKAEMVWGSLVRGRFKDSLQVSEREIQAQLKGNDDSKAVESYEYQLRPIVMIV-- 180

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           ++      +  R K+AE+ R R+   C + ++    + + +I        +DL P  +++
Sbjct: 181 SRGSGSSSLDTRRKEAEQIRGRI-TSCAEADRIFKAMPNAAIRGTVVKTSADLPPALRDV 239

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           L K+   + T P VT++GVE +A+C ++    +   K  +  +    K      +Y++++
Sbjct: 240 LDKTPVGHLTAPEVTKQGVEMVALCGRKQSTADTPRKREIREKLFGEKFLAKSKDYLQEV 299

Query: 309 RSNAIIHY 316
           R  A+I Y
Sbjct: 300 RKAAMIEY 307


>gi|307946740|ref|ZP_07662075.1| SurA N- domain family [Roseibium sp. TrichSKD4]
 gi|307770404|gb|EFO29630.1| SurA N- domain family [Roseibium sp. TrichSKD4]
          Length = 291

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 134/285 (47%), Gaps = 11/285 (3%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKL-QKIN-GELEKIAVQELIVETLKKQEIEKSGIT 96
           S+ I+  +NG+ IT  DI++R  L++L Q+ +     + A +ELI + L+ +E  + G+ 
Sbjct: 10  SAGIKVVVNGKPITTYDINQRAKLIRLIQRSSVAASRREAEKELIDDRLRLEEASRIGVK 69

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
                VN  +   ARN  L+    ++ L + G+     K  L  Q  +   V+  F  + 
Sbjct: 70  ISEAEVNNAYANIARNVKLTPAKLTAGLRQSGVNPQTLKDRLKAQLAFQQSVRRRFNSQV 129

Query: 157 GNLEMEIPANKQKM----KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
              E +I    +K     KNI+V EY ++ V+  +P  K  ++GF  KR+ ++   R + 
Sbjct: 130 DVDESDIINALRKSDDENKNISV-EYNLQRVIVVVP--KKSSKGFRNKRLAESNSIR-KA 185

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDL-HPQFQNLLKKSQNNTTNPYVTQKGVEYIA 271
              C+       K  +V +      LE++L  P  + + K +    T+P  T+ G E IA
Sbjct: 186 VTACDSAGAVFGKYSEVVVQPIGRRLETELPEPMRKEISKTTPGKLTSPRKTEVGFEMIA 245

Query: 272 ICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +C KR++  +IA +  L  +    + E     Y+  LR  A I Y
Sbjct: 246 VCGKREIASDIAARTELENELRAKEGEALTRRYLMDLRRRASIVY 290


>gi|299133711|ref|ZP_07026905.1| SurA domain protein [Afipia sp. 1NLS2]
 gi|298591547|gb|EFI51748.1| SurA domain protein [Afipia sp. 1NLS2]
          Length = 314

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 125/279 (44%), Gaps = 15/279 (5%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +NGE IT  DI +R  L+ L        +  + +LI + LK +E +K GI    + ++  
Sbjct: 40  VNGEPITTYDIEQRAKLIALTTHKSAPRQEVINQLIDDRLKIKEAKKFGINMTPSEIDSS 99

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
           +    +  G+SA+  S  L  QG+     K  ++  + W  +V+  +       E ++ A
Sbjct: 100 YAAMGQRMGMSADQLSKVLMAQGVRPETMKLRMSADTAWGALVRGRYKQSLMVSEHDVRA 159

Query: 166 ---NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                   ++    EY +R V+  +P  +  +   V++R K+AE  R R+ + C +    
Sbjct: 160 ASGGDSSPQDTESYEYHLRPVVIFVP--RGSSSAVVEQRKKEAEIIRDRV-QSCAEAATT 216

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR----D 277
              +   +I        +DL    + LL K+   + T P VT++G+E + +CD++    D
Sbjct: 217 FKSLRQGTIRDTIIKTSADLPANLRELLDKTPVGHMTPPEVTRQGIEMVVLCDRKVTSAD 276

Query: 278 LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              + A +  L AQ    K E     Y+  LR  A+I Y
Sbjct: 277 TPAKRAARDKLFAQ----KYEAKSKSYLDDLRKAAMIEY 311


>gi|254503520|ref|ZP_05115671.1| SurA N-terminal domain family [Labrenzia alexandrii DFL-11]
 gi|222439591|gb|EEE46270.1| SurA N-terminal domain family [Labrenzia alexandrii DFL-11]
          Length = 314

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 118/253 (46%), Gaps = 9/253 (3%)

Query: 42  IRTTINGEVITDGDISKRIAL--LKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           I+  +N   ITD DI++R  L  L L+K      + AVQELI + +K  E  + G++   
Sbjct: 36  IKVIVNDVPITDYDITQRARLITLTLRKSASVARREAVQELIDDQVKVGEATRMGMSVSD 95

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
           + V+  +   ARN  L+    +  L + G+     K+ L  Q IW  +V+  F       
Sbjct: 96  SEVDNAYANIARNVKLTPARLTQALGQGGVRAETLKKRLRAQLIWGKLVRARFSGGVDVD 155

Query: 160 EMEIPANKQKM---KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC 216
           E +I A  +K       T  EY ++ V+  +P N   + GF  +R ++  + R +    C
Sbjct: 156 ESDIIAALRKTDEEDRATSIEYDLQRVIVVVPKN--SSNGFKSQRRREIAQMR-KAVSSC 212

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDK 275
             +     +  +V +      LE+++ P   + +KK      T+P  T  G E IAIC K
Sbjct: 213 EDMGSVLGQYKEVVVQPIGRRLETEIPPNIIDQVKKLGPGKLTDPNPTPVGFEMIAICGK 272

Query: 276 RDLGGEIALKAYL 288
           R++  +IA++  L
Sbjct: 273 REIQSDIAMRTKL 285


>gi|92117866|ref|YP_577595.1| hypothetical protein Nham_2343 [Nitrobacter hamburgensis X14]
 gi|91800760|gb|ABE63135.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 319

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 138/307 (44%), Gaps = 8/307 (2%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           LL  +  L +F ++      +   +  +   +NGE IT  DI +R  L+++        +
Sbjct: 6   LLRAFCHLALFAVLSFACLNAPLHAQSVAVMVNGEPITSFDIEQRSRLIQISTHKTPTRQ 65

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             + ELI E +K +E +K G+   S  ++  +        +S E  +  L  QG+  +  
Sbjct: 66  QVIDELINEKVKVKEAKKFGVNPTSADIDQQYASMGARMRMSPEQLTKSLASQGVRPDTI 125

Query: 135 KQYLAIQSIWPDVVKNDF----MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
           K  L    +W  +V+  F    ++   ++   +  + +        EY +R V+  +P  
Sbjct: 126 KARLKADLVWGSLVRGRFKDSLLVSDRDVNEALRNSGEDQSKTEGFEYQMRPVVLVVPRG 185

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
              +   ++ R K+A+  R R+ + C    +    + + +I +      +DL P  ++LL
Sbjct: 186 AAAS--VMESRRKEADALRERV-QSCADATRIFKAMRNATIRETVVKTSADLPPPIRDLL 242

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
            K+   + T P +T++GVE +AIC K+    +   K  +  +    K EK   +Y++ +R
Sbjct: 243 DKTPVGHLTPPEITRQGVEMVAICGKKATSVDTPKKKEIREKMFAEKYEKKSKDYLEDIR 302

Query: 310 SNAIIHY 316
            +A+I Y
Sbjct: 303 KSAMIEY 309


>gi|218509345|ref|ZP_03507223.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli Brasil 5]
          Length = 147

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 83/150 (55%), Gaps = 13/150 (8%)

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
           EY+++ ++F IP+ K        KR  +AE SR + P  C++ + FA+ + DV++     
Sbjct: 2   EYMLQQIIFVIPEAK--RGAITGKRKGEAEASRSKFP-GCDQAKVFAATMRDVAVRDLGR 58

Query: 237 LLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA---------LKAY 287
           +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R +  + A         L   
Sbjct: 59  MLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKS 118

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
            + +N P + E +  +Y+ +LR  A I Y+
Sbjct: 119 KAGKNGPPENE-NSKKYLDELRKKAQIAYH 147


>gi|39936127|ref|NP_948403.1| hypothetical protein RPA3064 [Rhodopseudomonas palustris CGA009]
 gi|192291845|ref|YP_001992450.1| SurA domain [Rhodopseudomonas palustris TIE-1]
 gi|39649981|emb|CAE28505.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
 gi|192285594|gb|ACF01975.1| SurA domain [Rhodopseudomonas palustris TIE-1]
          Length = 308

 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 129/275 (46%), Gaps = 8/275 (2%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +NGE IT+ DI +R  L ++       +++ +++LI E +K +E +K G+    + ++  
Sbjct: 37  VNGEPITNFDIDQRSKLNRMSHKADSRQQV-LEDLIDEKVKIKEAKKYGVNPSDSDIDSS 95

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
           F   A    +S    ++ L  QGI  +  K  +  + +W  +V+  F       E E+ A
Sbjct: 96  FSTMASRMRMSTAQMTNMLAAQGIRPDTLKSRIRAEMVWASLVRGRFKDSLQVSEREVQA 155

Query: 166 ---NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                   K +   EY +R V+  +    +     +  R K+AE+ R R+   C + ++ 
Sbjct: 156 QLKGGDDTKAVESFEYQLRPVVMIVSRGSVSES--LDARRKEAEQLRGRI-SSCAEADRV 212

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGE 281
              + + +I        +DL P  + +L K+   + T P VT++G+E +A+C+++    +
Sbjct: 213 FKAMPNAAIRGIVIKTSADLPPALREILDKTPVGHLTPPEVTKQGIEMVALCERKQSTAD 272

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
              K  +  +    K +    EY++++R  A+I Y
Sbjct: 273 TPRKREIREKLFGEKFQAKSKEYLQEVRKAAMIEY 307


>gi|217978373|ref|YP_002362520.1| hypothetical protein Msil_2224 [Methylocella silvestris BL2]
 gi|217503749|gb|ACK51158.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 315

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 129/282 (45%), Gaps = 20/282 (7%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           I  +ING+ IT+ DI +R+ LL++ +     E  A++ L  + L+  E EK G+      
Sbjct: 40  IVASINGDPITNIDIDQRMKLLRVLRKPATREA-AIESLFRDRLQIHEAEKYGVNPRDAD 98

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY--------LAIQSIWPDVVKNDFM 153
           ++   V+ A    L  +   S L   G+ ++ FK Y        + +Q++   V  ++  
Sbjct: 99  ISQQIVKTATEMNLQPQALLSALQAAGVSEDQFKSYFRANLAFTVLVQALNKGVEASETQ 158

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLP 213
           ++    E+E    KQ  K      Y ++ ++F++P         +  R K+AE+ R R  
Sbjct: 159 VRA---ELE----KQGGKAAAGTSYTVQQIIFTLPIGT--TPAILAARSKEAEQLRSRF- 208

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAI 272
            DC    + A  ++DV++         +L  Q + LL K+     T P  +  G+E +A+
Sbjct: 209 TDCKSGAEMARTLNDVTVRDQLTRSSHELGEQLRQLLDKTAIGRLTPPQRSTSGLEMVAV 268

Query: 273 CDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           C +     + A++  ++ +     I++     +K+LR  A+I
Sbjct: 269 CARGPAKDDTAIRQTIAQKLLAAHIQEDGERRLKELRDRAVI 310


>gi|298291093|ref|YP_003693032.1| SurA domain protein [Starkeya novella DSM 506]
 gi|296927604|gb|ADH88413.1| SurA domain protein [Starkeya novella DSM 506]
          Length = 326

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 129/303 (42%), Gaps = 9/303 (2%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQE 79
            V  +     + ++   A +  I   + G+ IT  D+++RI L +L +     +K A+++
Sbjct: 26  LVAGMVAACALAAFPGAASAQGILVMVQGQPITSFDVAQRIKLAQLTERLSLSQKQALED 85

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LI E LK    E+ G+T D + +   F + A  +G + +  +  L + G+     K  + 
Sbjct: 86  LIDERLKIITAERGGVTADKDEIEKMFARMANRSGRTPDQLTQALTQSGLDARMLKTKMR 145

Query: 140 IQSIWPDVVKNDFMLKYGNLEMEIPANKQ-KMKNIT----VREYLIRTVLFSIPDNKLQN 194
              +W   V+  +       + ++ A  Q K +++T      EY IR V+  +   +  N
Sbjct: 146 ADYVWNSYVRGRYSSAATVRDSDVFAALQTKGEDLTKAQRTTEYTIRQVVLVV--GRTAN 203

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ 254
                +R+ +A   R      C+        + +  +        +D+    + ++  + 
Sbjct: 204 PAQRSQRMAEANSLRKSF-TSCDGGVATVRGMREAVVRDPVIRTSADMSEGVRKVMDSTP 262

Query: 255 -NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
               T P VT+ G+E +AIC +R++ GE A K  + A     + E      + + R  A+
Sbjct: 263 VGQLTPPEVTRAGIEMVAICARREVVGESAQKREVRADLETKQFEAVSKRLLAEARKGAM 322

Query: 314 IHY 316
           I Y
Sbjct: 323 IQY 325


>gi|158425946|ref|YP_001527238.1| hypothetical protein AZC_4322 [Azorhizobium caulinodans ORS 571]
 gi|158332835|dbj|BAF90320.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 302

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 137/300 (45%), Gaps = 10/300 (3%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQE 79
           F+L+    +P+++       +++   ++G+ IT  D+++R+ L +L +     +K  ++E
Sbjct: 8   FLLVCALALPVLA--PGVALAQVLVMVSGQPITSNDVAQRMKLHQLIENKSPPQKQVLEE 65

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LI E +K  +  +  I  D + VN  F   A  +G +A+  ++   + G+    FK  L 
Sbjct: 66  LIDEKIKVLQAARFSIEADEDDVNRMFSNIAERSGRTADQLTASFAQSGLKVQTFKDKLR 125

Query: 140 IQSIWPDVVKNDF-MLKYGNLEMEIPANKQKMKN-ITVREYLIRTVLFSIPDNKLQNQGF 197
              +W   V+    ++   + ++    NKQ   +  T  EY++R ++  +          
Sbjct: 126 ADYVWGQYVRARAPVVNIRDSDVIAALNKQGNADAFTATEYVLRPIILVVGGGS----NA 181

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NN 256
              R+ +A   R +    C+   +    + +  +      L S++  + + +L K++   
Sbjct: 182 YGSRLAEANALRAKF-NGCDAGLQMIKGMKETVVRSPINRLSSEIPEKMRAVLDKTEVGR 240

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            T P V+Q GVE  A+C+KR + GE + K  +  + +  + ++     + +LR   +I Y
Sbjct: 241 LTPPEVSQSGVETFAVCEKRTVKGESSKKRDIKDELSNAQFQEQSKRMMAELRKTMLIQY 300


>gi|27379215|ref|NP_770744.1| hypothetical protein bll4104 [Bradyrhizobium japonicum USDA 110]
 gi|27352366|dbj|BAC49369.1| bll4104 [Bradyrhizobium japonicum USDA 110]
          Length = 313

 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 128/278 (46%), Gaps = 12/278 (4%)

Query: 46  INGEVITDGDISKR--IALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVN 103
           +NG+ ITD DI +R  + LL  QK     E   + ELI + +K +E +K G+    + +N
Sbjct: 38  VNGDPITDFDIDQRSKLDLLTTQKTPSRQE--VINELIDDRVKLKEGKKYGVDPGVSDIN 95

Query: 104 YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF----MLKYGNL 159
             F   A+   ++ +  +  L+ +G+     K  +  + +W  +V+  F    M+   ++
Sbjct: 96  QSFEGMAQRMRITTDQLTKSLEVKGVRPETLKARMKSEMVWTSLVRGRFKEKLMVGERDV 155

Query: 160 EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
              + A       I   EY ++ ++  +P  +  +  F + R+K+AE+ R R+   C + 
Sbjct: 156 AQAVQAQAGDKLQIEGTEYKMQPIVLIVP--RGSSPAFQETRMKEAEQYRSRV-ASCEEA 212

Query: 220 EKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDL 278
                   + +I ++     ++L    + +L  +   + T P VT+ G+E + +C ++  
Sbjct: 213 NSLFRSTPNATIRESVTKTTAELPEALRKVLDDTPIGHLTAPEVTKAGIEMVVLCSRKPT 272

Query: 279 GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +   K  +  +    K EK +  Y+ +LR  A+I Y
Sbjct: 273 MIDTPKKREVREKMYQEKYEKTQKAYLDELRKAAMIEY 310


>gi|146340301|ref|YP_001205349.1| hypothetical protein BRADO3324 [Bradyrhizobium sp. ORS278]
 gi|146193107|emb|CAL77118.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 287

 Score = 72.4 bits (176), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 129/286 (45%), Gaps = 9/286 (3%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
           A +  I   +NG+ ITD DI +R  L  L     +  +  + ELI + +K +E +K G+ 
Sbjct: 4   AHAQSIVVMVNGDPITDYDIEQRSKLNFLSTHKQQSRQEVLNELIDDKVKIKEGKKFGVE 63

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
             S+ ++  F        L+AE  +  L+ QG+     KQ +  + +W  +V+  +  + 
Sbjct: 64  PSSSDIDQSFAGMGSRMRLNAEQLTRSLESQGVRPETLKQRIKAEIVWTSLVRGRYKERL 123

Query: 157 GNLEMEIPANKQKMKNITVR-----EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              + ++ A        T +     EY ++ V+  +P++   NQG ++ R K+AE  R R
Sbjct: 124 FVSDKDVAAAVAAAGGDTGQQGQSFEYKMQPVVLIVPNSS--NQGAMEIRQKEAEALRGR 181

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYI 270
           + + C      +    +  + +      +D+ P  + LL  +   + T P  T++G++ +
Sbjct: 182 V-QSCADANNISRTTANAVVKEIVVKTSADIPPNLRKLLDDTPIGHLTPPEATKQGIQMV 240

Query: 271 AICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           A+C +     +      +  Q    K E     Y++++R  A+I Y
Sbjct: 241 ALCARTPTTVDTPKAREIKEQMYAKKYEATSKAYLQEVRKAAMIEY 286


>gi|148255225|ref|YP_001239810.1| hypothetical protein BBta_3828 [Bradyrhizobium sp. BTAi1]
 gi|146407398|gb|ABQ35904.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 312

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 126/290 (43%), Gaps = 17/290 (5%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
           A +  I   +NG+ ITD DI +R+ L  L     +  +  + ELI + +K +E +K G+ 
Sbjct: 29  AQAQSIVVMVNGDPITDYDIEQRMKLNFLSTRKQQSRQEVINELIDDKVKIKEGKKFGVE 88

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK------- 149
             ++ V+  F        L+AE  +  L+ QG+     K  +  + +W  +V+       
Sbjct: 89  PTASDVDQSFAGMGSRMRLNAEQLTKSLESQGVRPETLKARIKAEIVWTSLVRGRYKERL 148

Query: 150 --NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
             +D  +          +++Q        EY ++ ++  + ++   NQ  ++ R K+AE 
Sbjct: 149 LVSDKDVAAAVAAAGGDSDQQGQ----AFEYKMQPIVLIVSNS--SNQAVMEARHKEAEA 202

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKG 266
            R R+ + C           +  I +      +D+ P  + LL  +   + T P  T++G
Sbjct: 203 LRARV-QTCADANNVFKTTANAVIKEIVVKTSADIPPNLRKLLDDTPIGHLTPPEATKQG 261

Query: 267 VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           ++ +A+C +     +   K  +  +    K E     Y++++R  A+I Y
Sbjct: 262 IQMVALCARTPTTVDTPKKRQIREEMYTKKYEATSKAYLQEVRKAAMIEY 311


>gi|301169179|emb|CBW28776.1| survival protein SurA homolog [Haemophilus influenzae 10810]
          Length = 311

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  I +  +   +         G+ +  A
Sbjct: 4   FVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQVRANMGK------KGDRQS-A 56

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 57  IDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQ 116

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +L  
Sbjct: 117 QIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLK 176

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 177 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 225

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 226 YAFPETYAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYER 283

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 284 LVNTQLQDATNDWVKALRKRANIQYF 309


>gi|148827655|ref|YP_001292408.1| thymidylate kinase [Haemophilus influenzae PittGG]
 gi|148718897|gb|ABR00025.1| thymidylate kinase [Haemophilus influenzae PittGG]
          Length = 311

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A ++ R+  T++G  I +  +   +         G+ +  A
Sbjct: 4   FVLRSFLLATLGCVAFTSMAQAAERVVATVDGIPILESQVRANMGK------KGDRQS-A 56

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 57  IDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQ 116

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTVLFS 186
            +A Q +   V         G    E+ A  QKM          + +  +EY +R +L  
Sbjct: 117 QIANQMVMGAVRNKAIQESIGVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLK 176

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 177 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 225

Query: 236 YLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF  ++ KS Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 226 YAFPETYAPQFAQIVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYER 283

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 284 LVNTQLQDATKDWVKALRKRANIQYF 309


>gi|145638627|ref|ZP_01794236.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittII]
 gi|145272222|gb|EDK12130.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittII]
          Length = 311

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 141/326 (43%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  + +  +   +         G+ +  A
Sbjct: 4   FVLRSFLLAALGCVAFVSMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQS-A 56

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 57  IDKIIDDILVQKAVQESGVKIDPREIDHVVEDTAARNGLTYGQFLDALDYQGISLNAFRQ 116

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            +A Q +   V          V  + ++  G   +E    K   + +T +EY +R +L  
Sbjct: 117 QIANQMMMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVTGKEYEVRHILLK 176

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 177 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 225

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 226 YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGTRD--GDLTSEAYTQKAYER 283

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 284 LVNTQLQDATNDWVKALRKRANIQYF 309


>gi|319775614|ref|YP_004138102.1| survival protein SurA [Haemophilus influenzae F3047]
 gi|317450205|emb|CBY86421.1| survival protein SurA homolog [Haemophilus influenzae F3047]
          Length = 311

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  I +  +   +         G+ +  A
Sbjct: 4   FVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQVRANMGK------KGDRQS-A 56

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 57  IDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQ 116

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +L  
Sbjct: 117 QIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLK 176

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 177 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 225

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 226 YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYER 283

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 284 LVNTQLQDATNDWVKALRKRANIQYF 309


>gi|309750126|gb|ADO80110.1| Putative survival protein SurA-like protein [Haemophilus influenzae
           R2866]
          Length = 313

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 141/326 (43%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  + +  +   +         G+ +  A
Sbjct: 6   FVLRSFLLAALGCVAFVSMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQS-A 58

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 59  IDKIIDDILVQKAVQESGVKIDPREIDHVVEDTAARNGLTYGQFLDALDYQGISLNAFRQ 118

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            +A Q +   V          V  + ++  G   +E    K   + +T +EY +R +L  
Sbjct: 119 QIANQMMMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVTGKEYEVRHILLK 178

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 179 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 227

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 228 YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGTRD--GDLTSEAYTQKAYER 285

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 286 LVNTQLQDATNDWVKALRKRANIQYF 311


>gi|329122338|ref|ZP_08250925.1| peptidyl-prolyl cis-trans isomerase [Haemophilus aegyptius ATCC
           11116]
 gi|327473620|gb|EGF19039.1| peptidyl-prolyl cis-trans isomerase [Haemophilus aegyptius ATCC
           11116]
          Length = 313

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  I +  +   +         G+ +  A
Sbjct: 6   FVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQVRANMGK------KGDRQS-A 58

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 59  IDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQ 118

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +L  
Sbjct: 119 QIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLK 178

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 179 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 227

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 228 YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYER 285

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 286 LVNTQLQDATNDWVKALRKRANIQYF 311


>gi|319898023|ref|YP_004136220.1| survival protein sura homolog [Haemophilus influenzae F3031]
 gi|317433529|emb|CBY81912.1| survival protein SurA homolog [Haemophilus influenzae F3031]
          Length = 311

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 141/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+ +
Sbjct: 5   ILKSFLLATLGC----VAFASMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQ 54

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 55  S-AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 225

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY    
Sbjct: 226 ---YAFPETYAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKA 280

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 281 YERLVNTQLQDATKDWVKALRKRANIQYF 309


>gi|16272406|ref|NP_438619.1| stationary-phase survival protein SurA [Haemophilus influenzae Rd
           KW20]
 gi|260580479|ref|ZP_05848307.1| stationary-phase survival protein SurA [Haemophilus influenzae
           RdAW]
 gi|1174486|sp|P44721|SURA_HAEIN RecName: Full=Chaperone surA homolog; Flags: Precursor
 gi|1573432|gb|AAC22116.1| stationary phase survival protein SurA, putative [Haemophilus
           influenzae Rd KW20]
 gi|260092821|gb|EEW76756.1| stationary-phase survival protein SurA [Haemophilus influenzae
           RdAW]
          Length = 313

 Score = 62.4 bits (150), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 139/326 (42%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  + +  +   +         G+ +  A
Sbjct: 6   FVLRSFLLATLGCVAFTSMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQS-A 58

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 59  IDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQ 118

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTVLFS 186
            +A Q +   V              E+ A  QKM          + +T +EY +R +L  
Sbjct: 119 QIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVRHILLK 178

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 179 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 227

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 228 YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYER 285

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 286 LVNTQLQDATNDWVKALRKRANIQYF 311


>gi|145630363|ref|ZP_01786144.1| stationary-phase survival protein SurA [Haemophilus influenzae
           R3021]
 gi|144984098|gb|EDJ91535.1| stationary-phase survival protein SurA [Haemophilus influenzae
           R3021]
          Length = 311

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/326 (22%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 20  FVLIIFCIVPI--VSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           FVL  F +  +  V++ S A +  R+  T++G  + +  +   +         G+ +  A
Sbjct: 4   FVLRSFLLATLGCVAFTSMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQS-A 56

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q
Sbjct: 57  IDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQ 116

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +L  
Sbjct: 117 QIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLK 176

Query: 187 IPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
           +  N L N    +K++               ++ L+  KD      + S  +  S+G   
Sbjct: 177 L--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG--- 225

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQ 291
           Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +
Sbjct: 226 YAFPETYAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYER 283

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHYY 317
              T+++    ++VK LR  A I Y+
Sbjct: 284 LVNTQLQDATNDWVKALRKRANIQYF 309


>gi|68249060|ref|YP_248172.1| survival protein SurA-like protein [Haemophilus influenzae
           86-028NP]
 gi|68057259|gb|AAX87512.1| survival protein SurA homolog [Haemophilus influenzae 86-028NP]
          Length = 313

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 140/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +  R  + K       L+
Sbjct: 7   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPILESQV--RANMGKKGDRQSALD 60

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           KI + +L+V+    + I++SG+  D   ++      A   GL+   F   LD QGI  N 
Sbjct: 61  KI-IDDLLVQ----KAIQESGVKIDPREIDRVVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 227

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY    
Sbjct: 228 ---YAFPETYAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKA 282

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 283 YERLVNTQLQDATNDWVKALRKRANIQYF 311


>gi|229846544|ref|ZP_04466652.1| stationary-phase survival protein SurA [Haemophilus influenzae
           7P49H1]
 gi|229810637|gb|EEP46355.1| stationary-phase survival protein SurA [Haemophilus influenzae
           7P49H1]
          Length = 311

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 141/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+ +
Sbjct: 5   ILKSFLLATLGC----VAFASMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQ 54

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 55  S-AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 225

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY    
Sbjct: 226 ---YAFPETYAPQFAQTVVKSKQGVVSAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKA 280

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 281 YERLVNTQLQDATNDWVKALRKRANIQYF 309


>gi|145632724|ref|ZP_01788458.1| thymidylate kinase [Haemophilus influenzae 3655]
 gi|145634545|ref|ZP_01790254.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittAA]
 gi|229844382|ref|ZP_04464522.1| stationary-phase survival protein SurA [Haemophilus influenzae
           6P18H1]
 gi|144986919|gb|EDJ93471.1| thymidylate kinase [Haemophilus influenzae 3655]
 gi|145268090|gb|EDK08085.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittAA]
 gi|229812631|gb|EEP48320.1| stationary-phase survival protein SurA [Haemophilus influenzae
           6P18H1]
          Length = 311

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 141/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+ +
Sbjct: 5   ILKSFLLATLGC----VAFASMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQ 54

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 55  S-AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 225

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY    
Sbjct: 226 ---YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKA 280

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 281 YERLVNTQLQDATNDWVKALRKRANIQYF 309


>gi|148825262|ref|YP_001290015.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittEE]
 gi|148715422|gb|ABQ97632.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittEE]
          Length = 311

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 141/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+ +
Sbjct: 5   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQ 54

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 55  S-AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
           F+Q +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 225

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY    
Sbjct: 226 ---YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKA 280

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 281 YERLVNTQLQDATNDWVKALRKRANIQYF 309


>gi|84684877|ref|ZP_01012777.1| Probable PpiC-type peptidyl-prolyl cis-trans isomerase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667212|gb|EAQ13682.1| Probable PpiC-type peptidyl-prolyl cis-trans isomerase
           [Rhodobacterales bacterium HTCC2654]
          Length = 414

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N   +T  + ++R+A L++    G++ ++A+ +LI E ++  E E+ GIT D   V   
Sbjct: 47  VNDSAVTVYERNQRMAFLRILNAPGDITQLALDQLINERIQLAEAERMGITADPEAVQNG 106

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
             + A    L  E F +FL + GI    F+ ++    +W +V +  F+ +    E EI
Sbjct: 107 MAEFAARGNLDVEQFGAFLAQAGIAFETFRDFVTAGIVWREVARAKFLPQVSITESEI 164


>gi|260582276|ref|ZP_05850069.1| stationary-phase survival protein SurA [Haemophilus influenzae
           NT127]
 gi|260094644|gb|EEW78539.1| stationary-phase survival protein SurA [Haemophilus influenzae
           NT127]
          Length = 313

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 139/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+ +
Sbjct: 7   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPILESQVRANMGK------KGDRQ 56

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 57  S-AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTRAEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 227

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY    
Sbjct: 228 ---YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKA 282

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 283 YERLVNTQLQDATNDWVKALRKRANIQYF 311


>gi|309972385|gb|ADO95586.1| Putative survival protein SurA-like protein [Haemophilus influenzae
           R2846]
          Length = 313

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 139/329 (42%), Gaps = 50/329 (15%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +  R  + K       L+
Sbjct: 7   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPILESQV--RANMGKKGDRQSALD 60

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           KI + +L+V+    + I++SG+  D   ++      A   GL+   F   LD QGI  N 
Sbjct: 61  KI-IDDLLVQ----KAIQESGVKIDPREIDRVVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIG 232
           L  +  N L N    +K++               ++ L+  KD      + S  +  S+G
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG 227

Query: 233 KAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-- 289
              Y       PQF Q ++K  Q   + P+ T+ G   + +    D  G++  +AY    
Sbjct: 228 ---YAFPETYAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVSD--GDLTAEAYTQKA 282

Query: 290 -AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             +   T+++    ++VK LR  A I Y+
Sbjct: 283 YERLVNTQLQDATNDWVKALRKRANIQYF 311


>gi|145636275|ref|ZP_01791944.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittHH]
 gi|145270440|gb|EDK10374.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittHH]
          Length = 290

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 115/267 (43%), Gaps = 38/267 (14%)

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
           A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+
Sbjct: 35  AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFR 94

Query: 136 QYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
           Q +A Q +   V          V  + ++  G   +E    K   + +  +EY +R +L 
Sbjct: 95  QQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILL 154

Query: 186 SIPDNKLQNQGFVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKA 234
            +  N L N    +K++               ++ L+  KD      + S  +  S+G  
Sbjct: 155 KL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG-- 204

Query: 235 QYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---A 290
            Y       PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      
Sbjct: 205 -YAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYE 261

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           +   T+++    ++VK LR  A I Y+
Sbjct: 262 RLVNTQLQDATNDWVKALRKRANIQYF 288


>gi|113461696|ref|YP_719765.1| peptidyl-prolyl cis-trans isomerase, PPIC-type [Haemophilus somnus
           129PT]
 gi|112823739|gb|ABI25828.1| peptidyl-prolyl cis-trans isomerase, PPIC-type [Haemophilus somnus
           129PT]
          Length = 314

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 142/319 (44%), Gaps = 32/319 (10%)

Query: 20  FVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
           F  ++F I+ ++S    A ++ R+  T++G  I +  + K   +L  +  N E  +IA+ 
Sbjct: 6   FKAVLFSIIGLLSITITAQAAERVVATVDGNPILESQVKK---VLGKRANNEENRQIALN 62

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            +I + L ++ I++ GI      V+      A   GL+   F   LD QGI    ++Q +
Sbjct: 63  SIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQNGLTFGQFLDVLDYQGINYQAYRQQI 122

Query: 139 AIQSIWPDVVKNDFMLKYGNLEME----------IPANKQ-KMKNITVREYLIRTVLFSI 187
           A Q +  + V+N  +    N+  E            A KQ K K +T  EY +R +L  +
Sbjct: 123 AYQILISE-VRNQAIGSSVNVTREEIQDLGLKLFKQAKKQGKEKKVTAPEYNVRHILLKL 181

Query: 188 PDNKLQNQGFVQKRI----KDAEESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLESDL 242
             N L N    + ++     D   +++       K  K + S     S+G   ++     
Sbjct: 182 --NPLLNDAQAKAKLTQIRADILANKITFADAALKYSKDYLSGADGGSLG---FMFPEAY 236

Query: 243 HPQFQNLLKKSQNNT-TNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIE 298
            P+F  +++ S+    + P+ T+ G   + + D R+   +I  +AY+     Q    +++
Sbjct: 237 VPEFAKVIRASKKGVISTPFKTEFGWHILEVTDIRN--ADITREAYMQEAYQQIVNQQLQ 294

Query: 299 KHEAEYVKKLRSNAIIHYY 317
           +   +++K LR  A I Y+
Sbjct: 295 EASGDWIKALRKRAHIQYF 313


>gi|170718609|ref|YP_001783810.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haemophilus somnus
           2336]
 gi|168826738|gb|ACA32109.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haemophilus somnus
           2336]
          Length = 321

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 142/322 (44%), Gaps = 38/322 (11%)

Query: 20  FVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
           F  ++F I+ ++S    A ++ R+  T++G  I +  + K   +L  +  N E  +IA+ 
Sbjct: 13  FKAVLFSIIGLLSITITAQAAERVVATVDGNPILESQVKK---VLGKRANNEENRQIALN 69

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            +I + L ++ I++ GI      V+      A   GL+   F   LD QGI    ++Q +
Sbjct: 70  SIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQNGLTFGQFLDVLDYQGINYQAYRQQI 129

Query: 139 AIQSIWPDVVKNDFMLKYGNLEME----------IPANKQ-KMKNITVREYLIRTVLFSI 187
           A Q +  + V+N  +    N+  E            A KQ K K +T  EY +R +L  +
Sbjct: 130 AYQILISE-VRNQAIGSSVNVTREEIQDLGLKLFKQAKKQGKEKKVTAPEYNVRHILLKL 188

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--------IHDVSIGKAQYLLE 239
             N L N    + ++     +++R     NK+  FA          +     G   ++  
Sbjct: 189 --NPLLNDAQAKAKL-----TQIRADILANKI-TFADAALKYSKDYLSGADGGSLGFMFP 240

Query: 240 SDLHPQFQNLLKKSQNNT-TNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPT 295
               P+F  +++ S+    + P+ T+ G   + + D R+   +I  +AY+     Q    
Sbjct: 241 EAYVPEFAKVIRTSKKGVISTPFKTEFGWHILEVTDIRN--ADITREAYMQEAYQQIVNQ 298

Query: 296 KIEKHEAEYVKKLRSNAIIHYY 317
           ++++   +++K LR  A I Y+
Sbjct: 299 QLQEASGDWIKALRKRAHIQYF 320


>gi|145628832|ref|ZP_01784632.1| thymidylate kinase [Haemophilus influenzae 22.1-21]
 gi|144979302|gb|EDJ88988.1| thymidylate kinase [Haemophilus influenzae 22.1-21]
          Length = 246

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 107/256 (41%), Gaps = 38/256 (14%)

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
           ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q +A Q +   
Sbjct: 2   QKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQQIANQMVMGA 61

Query: 147 VVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTVLFSIPDNKLQNQG 196
           V         G    E+ A  QKM          + +  +EY +R +L  +  N L N  
Sbjct: 62  VRNKAIQESIGVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLKL--NPLLNDA 119

Query: 197 FVQKRIKDAE-----------ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
             +K++               ++ L+  KD      + S  +  S+G   Y       PQ
Sbjct: 120 QAKKQLAKIRSDIIAGKTTFADAALKYSKD------YLSGANGGSLG---YAFPETYAPQ 170

Query: 246 F-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHE 301
           F Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T+++   
Sbjct: 171 FAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQLQDAT 228

Query: 302 AEYVKKLRSNAIIHYY 317
            ++VK LR  A I Y+
Sbjct: 229 NDWVKALRKRANIQYF 244


>gi|56697307|ref|YP_167673.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Ruegeria pomeroyi DSS-3]
 gi|56679044|gb|AAV95710.1| PPIC-type PPIASE domain [Ruegeria pomeroyi DSS-3]
          Length = 412

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL 65
            T+LS  +  +     L +      V+ +S   S  IR  +N  VIT  ++ +RI L+++
Sbjct: 5   LTTLSRCLARMMGAAALTLTLAGGPVAAQSL-FSPAIR--VNQGVITHFELEQRIRLMEV 61

Query: 66  QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
            +I G+ +K A + LI E LK Q +E++GI      V       A    LS ++F + L 
Sbjct: 62  LRIPGDPQKDARRSLIEEALKMQAVEEAGIEVAPEDVQLGIDDFAARARLSTDEFLAALA 121

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
            +G+     + +++ Q  W D V   F+ +
Sbjct: 122 NEGVSAETVRDFVSKQMAWRDYVSARFLAR 151


>gi|126736394|ref|ZP_01752136.1| PPIC-type PPIASE domain [Roseobacter sp. CCS2]
 gi|126714215|gb|EBA11084.1| PPIC-type PPIASE domain [Roseobacter sp. CCS2]
          Length = 383

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 59/108 (54%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+N  VIT  ++S+RI LL++ +  G+L + A   LI + LK+QE+ + G++   + +  
Sbjct: 11  TVNDRVITQYELSQRIRLLEVFRTPGDLNEAARNALIEDRLKQQELARFGVSVPEDALQQ 70

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
              + A    +S   F+  L + GI  +  + ++ +  +W D +++ F
Sbjct: 71  AMEEFAGRANMSLPQFTRVLAQDGIDISTLRDFVEVGILWRDFIRSRF 118


>gi|319943017|ref|ZP_08017300.1| peptidyl-prolyl cis-trans isomerase [Lautropia mirabilis ATCC
           51599]
 gi|319743559|gb|EFV95963.1| peptidyl-prolyl cis-trans isomerase [Lautropia mirabilis ATCC
           51599]
          Length = 491

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 109/250 (43%), Gaps = 11/250 (4%)

Query: 41  RIRTTINGEVITDGDISKRIALL--KLQKING-------ELEKIAVQELIVETLKKQEIE 91
           RI   +N  VIT+ ++  +I L+  +  +  G       EL K  ++++I++  ++Q   
Sbjct: 86  RIVAVVNQGVITESELQAQIHLIEGRAAQTPGAGVPPPDELRKQVLEQMILQLAQEQYAA 145

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
             G+      V+      A+N GLS +  +  L  +G+  + F++ L  + +   + + +
Sbjct: 146 DYGLKPSDAEVDRAVADVAQNNGLSTQQLTERLKDEGVSLDTFRRQLVAEIVSARLRERE 205

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                   E EI A   K   ++  EY IR +L  +P+   Q +   QK   D   ++ R
Sbjct: 206 TASNVSISEGEIDAELAKSGKVSQPEYDIRQILLKLPEGADQKEVARQKARADELVAKAR 265

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ-FQNLLKK-SQNNTTNPYVTQKGVEY 269
              D   L +  S+  D + G +    ++D  P  F + ++K      + P  +  G   
Sbjct: 266 KGADFGALAQENSEAGDAATGGSMGWRKADDLPGLFADTVRKLKPGEISAPVRSPAGFHI 325

Query: 270 IAICDKRDLG 279
           + + D+RD G
Sbjct: 326 LKLQDRRDGG 335


>gi|213018605|ref|ZP_03334413.1| hypothetical protein C1A_378 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995556|gb|EEB56196.1| hypothetical protein C1A_378 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 365

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 100/214 (46%), Gaps = 19/214 (8%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKIN-GELEKIAVQELIVET 84
           ++  +  A    I   +NGE I++ DI +RI    +LL  QKIN  E++   +++LI E 
Sbjct: 1   MLPLRLLATEIEIVADVNGEPISNLDIERRINFINSLLGTQKINQKEVKSQILRQLIDEI 60

Query: 85  LKKQEIEKSGITFDS----NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           +   E +K  I   +    N V  F  Q  +   L A++   ++ K  I  N  K+ +  
Sbjct: 61  IIVSEAQKMNIELSNEELNNAVTLFLTQSLK---LKADEVDQYVKKHNIDLNTLKKQIKC 117

Query: 141 QSIWPDVVKNDF--MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFV 198
           Q +W  +++     ++   + E++  A KQK K+    +YLI    F IPD K+      
Sbjct: 118 QLLWNKIIEVGVVPLINISDQEVD-DARKQKEKS----DYLITFQEFIIPDQKIAEDLVK 172

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
           + R  +  ES +++ K    L +   K+ DV  G
Sbjct: 173 KLRTSNNPESSIKMSKATVNLSQLKGKLKDVLEG 206


>gi|190571205|ref|YP_001975563.1| hypothetical protein WPa_0803 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357477|emb|CAQ54911.1| hypothetical protein WP0803 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 375

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (46%), Gaps = 19/207 (9%)

Query: 37  AMSSRIRTTINGEVITDGDISKRI----ALLKLQKIN-GELEKIAVQELIVETLKKQEIE 91
           A    I   +NGE I++ DI +RI    +LL  QKIN  E++   +++LI E +   E +
Sbjct: 18  ATEIEIVADVNGEPISNLDIERRINFINSLLGTQKINQKEVKSQILRQLIDEIIIVSEAQ 77

Query: 92  KSGITFDS----NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           K  I   +    N V  F  Q  +   L A++   ++ K  I  N  K+ +  Q +W  +
Sbjct: 78  KMNIELSNEELNNAVTLFLTQSLK---LKADEVDQYVKKHNIDLNTLKKQIKCQLLWNKI 134

Query: 148 VKNDF--MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
           ++     ++   + E++  A KQK K+    +YLI    F IPD K+      + R  + 
Sbjct: 135 IEVGVVPLINISDQEVD-DARKQKEKS----DYLITFQEFIIPDQKIAEDLVKKLRTSNN 189

Query: 206 EESRLRLPKDCNKLEKFASKIHDVSIG 232
            ES +++ K    L +   K+ DV  G
Sbjct: 190 PESSIKMSKATVNLSQLKGKLKDVLEG 216


>gi|103486961|ref|YP_616522.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingopyxis
           alaskensis RB2256]
 gi|98977038|gb|ABF53189.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingopyxis
           alaskensis RB2256]
          Length = 446

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 8/112 (7%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL--------IVETLKKQEIEK 92
           R   T+NGE+IT  DI +R+AL+++   N EL     Q L        I E L+ QE   
Sbjct: 54  RPSATVNGEIITATDIEQRMALIRIANNNVELPPEEEQRLRNQVFSNLIDEKLQIQEARA 113

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           + IT D N VN  F + A     + E F+++L  +G      KQ +  +  W
Sbjct: 114 ADITIDENVVNEQFARLAARFKQTPEQFAAYLASKGSSAAAVKQQIRGEFAW 165


>gi|84516316|ref|ZP_01003676.1| PPIC-type PPIASE domain [Loktanella vestfoldensis SKA53]
 gi|84510012|gb|EAQ06469.1| PPIC-type PPIASE domain [Loktanella vestfoldensis SKA53]
          Length = 415

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 71/145 (48%), Gaps = 1/145 (0%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+N  VIT  ++++RI LL++    G++ + A   LI + LK+QEI++ G+      +N 
Sbjct: 42  TVNERVITQYELTQRIRLLEVFGTRGDIAQAARDALIADRLKQQEIDRVGLQVPPEAINA 101

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP 164
              + A    +    F++ L + G+     + +++I   W + V+  F  +    + +I 
Sbjct: 102 ALDEFAGRADMDLAQFNAMLAQNGVDAVTLRDFVSIGVTWREYVRARFNREVTVTDADIA 161

Query: 165 -ANKQKMKNITVREYLIRTVLFSIP 188
            A  Q  +  +  E L+  ++ + P
Sbjct: 162 RAQGQIGRATSEMEVLLNEIIIAAP 186


>gi|294678213|ref|YP_003578828.1| chaperone SurA [Rhodobacter capsulatus SB 1003]
 gi|294477033|gb|ADE86421.1| chaperone SurA [Rhodobacter capsulatus SB 1003]
          Length = 418

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+NG  I+  +I++R   ++L    G++ K+A + LI + L+  + +  GI+     V  
Sbjct: 38  TVNGLAISGYEIAQRARFMELLGATGDVRKMAEEALIDDRLQGWKAQSLGISVSREAVTR 97

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
              + A    LSAEDF   L   G+    ++ ++    IW +VVK      YG   ++I
Sbjct: 98  GMAEFAARANLSAEDFLKALAGAGVEAQTYRDFVTSGVIWREVVKT----TYGGGRIQI 152


>gi|84500986|ref|ZP_00999221.1| PPIC-type PPIASE domain protein [Oceanicola batsensis HTCC2597]
 gi|84391053|gb|EAQ03471.1| PPIC-type PPIASE domain protein [Oceanicola batsensis HTCC2597]
          Length = 402

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 57/107 (53%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N +V+T+ ++ +R  +L+L +  G+++ +A  +LI + L+ Q  E+ GI+   + +   
Sbjct: 31  VNDKVVTEFELDQRTRMLRLFRTPGDIDALAADQLIDDRLRMQAAEEIGISPSEDQIMAG 90

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             + A    LSAE F + L + G+    F+ ++     W + ++  F
Sbjct: 91  MEEFAGRANLSAEQFVAALQQAGVAPESFRDFVRAGVAWRETIRARF 137


>gi|312113659|ref|YP_004011255.1| hypothetical protein Rvan_0880 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218788|gb|ADP70156.1| hypothetical protein Rvan_0880 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 365

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 106/260 (40%), Gaps = 18/260 (6%)

Query: 65  LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF- 123
           L +  G   K  ++ LI + LK Q  ++  IT     V     Q A          + F 
Sbjct: 111 LSEGGGTSRKQVIETLIEDKLKLQAAKRLEITVSDKEVEEVLAQRAGGGDGKKPQLNEFY 170

Query: 124 --LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR 181
              +  GI     +  +  Q  W DV++  +  +   +   +P + QK  +  + ++ +R
Sbjct: 171 QQFEADGISRKTVQNIIRAQLAWRDVIRRQYGPRIAAMLAALPTDDQKPADGDI-QFDVR 229

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
            +  ++  +   ++  V +R+ +AE  R +    C  L K A  + D S+        + 
Sbjct: 230 VLRLAVAGS---DERAVSQRMMEAENLRSKF-TSCADLPKRAKLVADASVKAVDKAKLAS 285

Query: 242 LHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP----TK 296
            +   Q L LK S+   T P +    VE  AIC K      + LK   +A+  P     +
Sbjct: 286 FNKDAQPLILKASEGQMTPPILVSGAVEAYAICKK-----GVVLKRNPAAEQKPDARAQE 340

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++    Y+++L+ +A I Y
Sbjct: 341 YDRFSRRYLQELKKSASIDY 360


>gi|94499974|ref|ZP_01306509.1| Parvulin-like peptidyl-prolyl isomerase [Oceanobacter sp. RED65]
 gi|94427832|gb|EAT12807.1| Parvulin-like peptidyl-prolyl isomerase [Oceanobacter sp. RED65]
          Length = 436

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 124/303 (40%), Gaps = 49/303 (16%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +  I+ +T   +L IF +   +  +   + S I   ++  +I + ++ +RI  +K Q   
Sbjct: 11  TSIIQQITKTALLGIFAVSLPLQAQIQTIDS-IAAVVDDGIIMESELEQRIDTIKRQSQG 69

Query: 70  GEL------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
             L      +   ++ LI+E L+ Q  E+SG+      +N   +  A+  GL+  +F   
Sbjct: 70  MRLPPDDILQDQVLERLIIENLQLQMAERSGMRISDEQLNQTIINIAKQNGLTLREFKKA 129

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIR 181
           L+K G+     ++ +  + I  +V +     K    E ++    N  + K+ T  EY + 
Sbjct: 130 LEKDGVSYAQAREQIRRERIISEVQRYRVGSKINISEQDVDNFLNSVRGKSATAEEYRLG 189

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD------------- 228
            +L  +P                ++ SR +L +  NK E    K+ +             
Sbjct: 190 HILIQVP----------------SQASRAQLKRAQNKAEDIVKKLRNGADFQQMAISQSE 233

Query: 229 ----VSIGKAQYLLESDLHPQFQNL---LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
               +  G   +  E++L   F ++   LKK Q   +NP  +  G   I I DKR  GG+
Sbjct: 234 GRNALKGGDLGWRKEAELPTLFADIVPDLKKGQ--VSNPIRSASGYHIIKISDKR--GGD 289

Query: 282 IAL 284
             +
Sbjct: 290 TQM 292


>gi|146277165|ref|YP_001167324.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555406|gb|ABP70019.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 405

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
           R  +N  VIT+ +  +R+  L +    G+LEK A+  LI + ++    E++G+    + V
Sbjct: 34  RLVVNDRVITNYEFEQRVRFLTILGATGDLEKQAMDALIDDKIRLDAAERAGLKATESQV 93

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                + A    LSAE F + L K G+    F+ ++    +W ++++  F
Sbjct: 94  TEGMEEFAGRANLSAEAFVAELGKAGVAPETFRDFVHAGLVWRELMRARF 143


>gi|301155190|emb|CBW14654.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 310

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 131/318 (41%), Gaps = 41/318 (12%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F ++ + ++       R+  T+NG  I    ++  +     Q+        A+ ++I 
Sbjct: 9   LLFAMIGLFTFSQVQAEERVVATVNGTPILQSQVNAVMGKKGSQRA-------ALDKIID 61

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + L ++ I++SG+  +   VN      A   GL+   F   LD QGI  N FKQ ++ Q 
Sbjct: 62  DMLTEKAIKESGVKVNQAEVNRIVEDIAAKNGLTYGQFLDALDYQGISLNAFKQQISRQM 121

Query: 143 IWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
           +   V          V  + +   G   ++    K   + +  +EY +R +L  +  N L
Sbjct: 122 LMAGVRNHAIQNSVDVTREQVDALGKQMLDEAKAKGTAQKVMGKEYEVRHILLKL--NPL 179

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKL----------EKFASKIHDVSIGKAQYLLESDL 242
            N    +     AE  R+R      K+          + + S  +  S+G A    E+ +
Sbjct: 180 LNDAQAK-----AELERIRSEIISGKMTFADAALKYSKDYLSGANGGSLGYA--FPEAYV 232

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEK 299
            P  + +    Q   + P+ ++ G   + +   RD  G+    AY      Q   +++++
Sbjct: 233 GPFAKMVETTPQGTISAPFKSEFGWHILEVTGTRD--GDKTEDAYRQKAYEQIVNSQLQE 290

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR NA I Y+
Sbjct: 291 ATKDWVKALRKNADIQYF 308


>gi|260912727|ref|ZP_05919213.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Pasteurella
           dagmatis ATCC 43325]
 gi|260633105|gb|EEX51270.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Pasteurella
           dagmatis ATCC 43325]
          Length = 311

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 134/312 (42%), Gaps = 28/312 (8%)

Query: 23  IIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           I F +V + +  +   ++ R+  T+NG  + +  +         +K N    + A+ + I
Sbjct: 10  IFFALVGLFAISTTTQAAERVVATVNGIPVLESQVKANSG----KKGN---RQAALDKAI 62

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L +Q I+ SG+  +   V+      A   GL+   F   LD QGI  N ++Q +A Q
Sbjct: 63  DDILVQQAIQNSGVKVNYAQVDQIIEGIAAQNGLTYGQFLDALDYQGISYNTYRQQIANQ 122

Query: 142 SIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD-- 189
            +  +V          V  + +   G   ++    K   K ++ ++Y +R +L  +    
Sbjct: 123 LLMTEVRNQAIGQSIDVTREQVEALGKQLLQEAKEKGTEKKVSGKQYEVRHILLKLNPLL 182

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLESDLHPQFQN 248
           N  Q +  + +   D    ++       K  K + S  +  S+G A    E+ + P  + 
Sbjct: 183 NDTQAKAQLSQIRADIMAGKMTFADAALKYSKDYLSGANGGSLGFA--FPETYVGPFQKT 240

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA---QNTPTKIEKHEAEYV 305
           ++   Q   + P+ T+ G   + + + RD  G+  L AY      Q   ++++  E ++V
Sbjct: 241 VITSKQGVISAPFKTEFGWHILEVTNTRD--GDRTLDAYRQQAYEQLINSQVKDAEKDWV 298

Query: 306 KKLRSNAIIHYY 317
           K LR NA I Y+
Sbjct: 299 KALRKNADIQYF 310


>gi|149914655|ref|ZP_01903185.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           AzwK-3b]
 gi|149811448|gb|EDM71283.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           AzwK-3b]
          Length = 411

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/231 (18%), Positives = 101/231 (43%), Gaps = 7/231 (3%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N + IT  +I +R  +L L +  G   ++A ++LI E LK      +G+  +   +   
Sbjct: 38  VNDQAITGYEIQQRARMLTLFRSPGNPVELAREQLIEERLKVDAARAAGLVLEDADIRVG 97

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             + A    ++AE+F   L+  G+ +  +++++     W ++V+  F  +    + ++  
Sbjct: 98  MEEFASRANMTAEEFIGALEGAGVSEQSYREFVRAGMTWRELVRARFAPRVSVSDADLER 157

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL-RLPKDCNKLEKFAS 224
            +  +   +    L+  ++  I     Q+   VQ R   A  S L  +P    + E++++
Sbjct: 158 ARAALTEDSGVRVLLSEIIMPI---TPQDAEEVQDRA--ARISELDSIPAFSAEAERYSA 212

Query: 225 KIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICD 274
                  G+  ++  ++L PQ +  +L     + ++P   +  V    + D
Sbjct: 213 SATAARGGRLDWMSITNLPPQLRPVILALGPGDVSDPLPIEGAVALFQLRD 263


>gi|296271661|ref|YP_003654292.1| SurA domain-containing protein [Arcobacter nitrofigilis DSM 7299]
 gi|296095836|gb|ADG91786.1| SurA domain protein [Arcobacter nitrofigilis DSM 7299]
          Length = 283

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 6/113 (5%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F ++   ++ +  M   +  T+N E IT  DI++++A   L+K +      AV ELI 
Sbjct: 13  VLFTLMATFTFSNAQMIDALALTVNDEPITTSDINQKMAETHLKKAD------AVSELID 66

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
           + L KQE+EK  IT D   VN +  + A + G+    F S L ++    + F+
Sbjct: 67  QILYKQELEKQNITVDIFEVNDYLEKLAASNGMDLYTFKSILRQKNKNFDEFE 119


>gi|325576844|ref|ZP_08147459.1| peptidyl-prolyl cis-trans isomerase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325161050|gb|EGC73168.1| peptidyl-prolyl cis-trans isomerase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 310

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 131/318 (41%), Gaps = 41/318 (12%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F ++ + ++       R+  T+NG  I    ++  +     Q+        A+ ++I 
Sbjct: 9   LLFAMIGLFTFSQAQAEERVVATVNGTPILQSQVNAVMGKKGSQRA-------ALDKIID 61

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + L ++ I++SG+  +   VN      A   GL+   F   LD QGI  N FKQ ++ Q 
Sbjct: 62  DMLTEKAIKESGVKVNQAEVNRIVEDIAAKNGLTYGQFLDALDYQGISLNAFKQQISRQM 121

Query: 143 IWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
           +   V          V  + +   G   ++    K   + +  +EY +R +L  +  N L
Sbjct: 122 LMAGVRNHAIQNSVDVTREQVEALGKQMLDEAKAKGTAQKVMGKEYEVRHILLKL--NPL 179

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKL----------EKFASKIHDVSIGKAQYLLESDL 242
            +    +     AE  R+R      K+          + + S  +  S+G A    E+ +
Sbjct: 180 LDDAQAK-----AELERIRSEIILGKMTFADAALKYSKDYLSGANGGSLGYA--FPEAYV 232

Query: 243 HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEK 299
            P  + +    Q   + P+ ++ G   + +   RD  G+    AY      Q   +++++
Sbjct: 233 GPFAKMVETTPQGTVSAPFKSEFGWHILEVTGSRD--GDKTEDAYRQKAYEQIVNSQLQE 290

Query: 300 HEAEYVKKLRSNAIIHYY 317
              ++VK LR NA I Y+
Sbjct: 291 ATKDWVKALRKNADIQYF 308


>gi|254487361|ref|ZP_05100566.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           GAI101]
 gi|214044230|gb|EEB84868.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           GAI101]
          Length = 411

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/264 (18%), Positives = 103/264 (39%), Gaps = 18/264 (6%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           L +    P+ +   +A  +R+    N  V+T+ ++ +R   L+L    G     A+  LI
Sbjct: 21  LALMTATPLAAQNLFAPVARV----NESVVTEFEVQQRQRFLQLLNAPGATRDGALTSLI 76

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            E L+ + + ++GI      +     + A    LS  +F+S L++ G+    F+ ++   
Sbjct: 77  DERLRNEAVAEAGIALTPEGIEDSLTEFAARANLSTAEFTSALERSGVAKETFRDFVVNS 136

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKR 201
             W ++++  +  +    + EI       +   VR  L   ++ + P +  +     ++ 
Sbjct: 137 VGWRELIRARYNARVQITDAEINRALGATRGGGVRVLLSEIIIPAPPKDAARVNALAEQI 196

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSI----GKAQYLLESDLHPQFQNL-LKKSQNN 256
            +          +   +   FAS+    +     G+ ++   S L P  Q L L  +   
Sbjct: 197 AQS---------RSAAEFSGFASRYSATASRGRGGRLEWQDLSSLPPSLQPLILGLAPGE 247

Query: 257 TTNPYVTQKGVEYIAICDKRDLGG 280
            T P      V    + D ++ G 
Sbjct: 248 VTAPLPIPNAVALFQLRDIQETGA 271


>gi|254417887|ref|ZP_05031611.1| SurA N-terminal domain family [Brevundimonas sp. BAL3]
 gi|196184064|gb|EDX79040.1| SurA N-terminal domain family [Brevundimonas sp. BAL3]
          Length = 393

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 109/258 (42%), Gaps = 26/258 (10%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALL----KLQKINGELEKI---AVQELIVETLKKQEI 90
           M+  I  T+N ++IT  D+ +++ +L    ++Q     L  I   A+  LI + LK QEI
Sbjct: 1   MADGIVATVNDKIITGFDLRQQMLMLIASSQVQPTEQNLPAIQQAALNRLIEQRLKAQEI 60

Query: 91  EK-SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
            K   +      ++    Q AR  G++   +  FL + GI  N F++ L  +  W  +V 
Sbjct: 61  TKFESLKVTDQEIDEEIAQMARQAGVTPAAYMEFLQQGGIQPNAFRESLRTEIGWGQLVP 120

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSIPDNKLQNQG------FVQKRI 202
             F  +     +++    +++ +   + +YLI  +         Q          VQ+ I
Sbjct: 121 GRFNSRARPSTLQVDQEVRRLNDAAAQPQYLIGEIYIEAARVGGQEAAMNGARQLVQQII 180

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTN 259
           + A    +         ++F+S     +   G A ++++  + P  Q +  + Q    +N
Sbjct: 181 QGAPFQAV--------AQQFSSAPSASARVPGDAGWVVKGTVQPALQTIFDQLQPGQLSN 232

Query: 260 PYVTQKGVEYIAICDKRD 277
           P     GV  I + DKRD
Sbjct: 233 PIAVDGGVYIIYMRDKRD 250



 Score = 40.8 bits (94), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESD---LHPQFQNLLKKSQ-NNTTNPYVTQK 265
           LR   +C+ +   A     V IG    L ESD   L PQFQ   +  +  + + P  T  
Sbjct: 285 LRQGLNCDNILSQARATQGV-IGA--DLGESDVANLAPQFQQFARTGEIGSVSTPIRTPL 341

Query: 266 GVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           G+  +A+C +R  G E   +  +  +     +   E  Y++ LRS+A+I +
Sbjct: 342 GLHLVAVCGRRVGGPEAPNRQQVEGRLRSQNLAVLERRYLRDLRSDALIEF 392


>gi|332558337|ref|ZP_08412659.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides WS8N]
 gi|332276049|gb|EGJ21364.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides WS8N]
          Length = 405

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
           R  +N  VIT+ +  +R+  L +    G++EK A+  LI + ++    E++G+      +
Sbjct: 34  RLVVNDRVITNYEFEQRVRFLTILGATGDVEKQAMDALIEDKIRFDAAEQAGLKATEEQI 93

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                + A    LSAE F++ L K G+    F+ ++    IW ++++  F
Sbjct: 94  KEGMEEFAGRANLSAEQFAAELGKAGVAVETFRDFVHAGLIWRELMRAKF 143


>gi|77463460|ref|YP_352964.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides 2.4.1]
 gi|77387878|gb|ABA79063.1| Probable PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 435

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
           R  +N  VIT+ +  +R+  L +    G++EK A+  LI + ++    E++G+      +
Sbjct: 64  RLVVNDRVITNYEFEQRVRFLTILGATGDVEKQAMDALIEDKIRFDAAEQAGLKATEEQI 123

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                + A    LSAE F++ L K G+    F+ ++    IW ++++  F
Sbjct: 124 KEGMEEFAGRANLSAEQFAAELGKAGVAVETFRDFVHAGLIWRELMRAKF 173


>gi|110680309|ref|YP_683316.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           denitrificans OCh 114]
 gi|109456425|gb|ABG32630.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           denitrificans OCh 114]
          Length = 406

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 62/146 (42%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N  VIT+ +I +R   L L    G   +  V+ELI E L+ Q +  +G+      +   
Sbjct: 35  VNDAVITEFEIEQRQQFLTLLNAPGSSRQAVVEELINERLRAQAVANAGLELSDAALQEG 94

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             + A    L  ++F + L++ GI    F+ ++ +   W D +   F  +    E EI  
Sbjct: 95  MTEFAGRVNLGVDEFKTVLEENGIAAETFEDFVRVGVSWRDFIAARFGPRLQVSEEEIDQ 154

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNK 191
                   +  + L+  ++   P ++
Sbjct: 155 ALGSTNGASNIQVLVSEIIIPAPPSR 180


>gi|126462315|ref|YP_001043429.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126103979|gb|ABN76657.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 435

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
           R  +N  VIT+ +  +R+  L +    G++EK A+  LI + ++    E++G+      +
Sbjct: 64  RLVVNDRVITNYEFEQRVRFLTILGATGDVEKQAMDALIEDKIRFDAAEQAGLKATEEQI 123

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                + A    LSAE F++ L K G+    F+ ++    IW ++++  F
Sbjct: 124 KEGMEEFAGRANLSAEQFAAELGKAGVAVETFRDFVHAGLIWRELMRAKF 173


>gi|221639318|ref|YP_002525580.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides KD131]
 gi|221160099|gb|ACM01079.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides KD131]
          Length = 405

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
           R  +N  VIT+ +  +R+  L +    G++EK A+  LI + ++    E++G+      +
Sbjct: 34  RLVVNDRVITNYEFEQRVRFLTILGATGDVEKQAMDALIEDKIRFYAAEQAGLKATEEQI 93

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                + A    LSAE F++ L K G+    F+ ++    IW ++++  F
Sbjct: 94  KEGMEEFAGRANLSAEQFAAELGKAGVAVETFRDFVHAGLIWRELMRAKF 143


>gi|260576764|ref|ZP_05844749.1| SurA domain protein [Rhodobacter sp. SW2]
 gi|259021016|gb|EEW24327.1| SurA  domain protein [Rhodobacter sp. SW2]
          Length = 402

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 82/180 (45%), Gaps = 6/180 (3%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
           R  +N  VI+  ++ +RI+ + +  +   +E++A+  LI E L+    ++  +      V
Sbjct: 31  RVYVNDRVISQYELDQRISFMTVLGLRENVEEVALNALIDERLQMTVAKQYNVKLTPKQV 90

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
                + A    LS E+F + L   G+    F+ ++    IW ++V+  F  +    E E
Sbjct: 91  EAGMAEFAGRAQLSTEEFLTALAPAGVEAQGFRDFVTAGLIWREIVRAKFGPRASISEAE 150

Query: 163 I-PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           I  A  Q  KN +V + L   ++   P+ +L       +R+K    ++ R P+D  K  +
Sbjct: 151 IDQAIAQIDKNTSV-QILASEIVIPAPEGQLPVALATARRLK----AQSRTPEDFAKAAR 205


>gi|118590091|ref|ZP_01547494.1| hypothetical protein SIAM614_11273 [Stappia aggregata IAM 12614]
 gi|118437063|gb|EAV43701.1| hypothetical protein SIAM614_11273 [Stappia aggregata IAM 12614]
          Length = 132

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 2/113 (1%)

Query: 42  IRTTINGEVITDGDISKRIALLKL-QKINGEL-EKIAVQELIVETLKKQEIEKSGITFDS 99
           I+  +N   ITD DIS+R  L+ + Q+ +  + +K A +EL+ + +K  E E+ GI    
Sbjct: 14  IKIIVNDVPITDYDISQRARLITMTQRKSASIAKKQAEEELVDDQVKLAEAERVGIDVSK 73

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
           + V+  F   ARN  +S    S  L   G+  +  K+ L  Q  W  V+++ F
Sbjct: 74  SEVDNAFNNIARNVKMSPAQLSKALRSGGVQPDTLKERLKAQLAWNQVLRSRF 126


>gi|259419301|ref|ZP_05743218.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Silicibacter sp.
           TrichCH4B]
 gi|259345523|gb|EEW57377.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Silicibacter sp.
           TrichCH4B]
          Length = 425

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/266 (20%), Positives = 107/266 (40%), Gaps = 8/266 (3%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK-LQKINGELEKIAVQ 78
             L +   +P     +  + S +  T+N +VIT  ++ +R   L  L  + G+  + A  
Sbjct: 27  LALAVALTLPAADVGAQGLFSPV-ITVNEDVITTYELQQRARFLTVLGSVQGDPLETARN 85

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
           +LI + LK+Q + + G+T   + +     + A+   LS E+F S L + G+     + + 
Sbjct: 86  DLIEDRLKRQVMREVGLTLSEDEITEGMRELAQRANLSLEEFLSGLRQAGVDPETVRDFT 145

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFV 198
           +    W + ++  F+ +    E EI          +V+  L   +L    +N  Q Q   
Sbjct: 146 SAGLGWREYIRGRFLAQARPSEAEIDRAMGTAGTGSVQVLLSEIILPLTQENAAQIQELA 205

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNT 257
            +  +   E+            +F++     + G+  ++  S L PQ Q  +L       
Sbjct: 206 TQISELKNEAAF-----TASAAQFSASDSSANGGRLPWMSLSRLPPQLQEVVLGLEPGQI 260

Query: 258 TNPYVTQKGVEYIAICDKRDLGGEIA 283
           T P   Q  +    +   R++ G  A
Sbjct: 261 TQPLPMQGAIAIFRMRGLREVDGRSA 286


>gi|323495831|ref|ZP_08100899.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio
           sinaloensis DSM 21326]
 gi|323319047|gb|EGA71990.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio
           sinaloensis DSM 21326]
          Length = 431

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 84/176 (47%), Gaps = 21/176 (11%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQ-KINGE-------LEKIAVQELIVETLKKQEIEK 92
           +I   +NG VI + DI   I  LK   K +G+       L +   ++LI++TL++QE E+
Sbjct: 29  KINVIVNGGVILESDIDTSIKTLKANAKKSGQGLPTADVLRQQVTEKLIIDTLQQQEAER 88

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            GI  D N +N    + A+N   + E  S  +  +G+  + F++ +  + I     +N  
Sbjct: 89  IGIRIDDNRLNEAIEEIAKNNNQTIEQLSDSIAAEGLEYSEFREQVR-KEIAATEARNAL 147

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
           + +  N+   +PA    + NI  +E    TV + I        G +Q R+ D +++
Sbjct: 148 VRRRINI---LPAEVDNLANILAQETNA-TVQYKI--------GHIQLRVNDGDDA 191


>gi|332288953|ref|YP_004419805.1| peptidyl-prolyl cis-trans isomerase SurA [Gallibacterium anatis
           UMN179]
 gi|330431849|gb|AEC16908.1| peptidyl-prolyl cis-trans isomerase SurA [Gallibacterium anatis
           UMN179]
          Length = 313

 Score = 49.7 bits (117), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 133/313 (42%), Gaps = 30/313 (9%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQE 79
           F+L++ C+   ++   +A+  ++  T+NG  I +  + +    L  +         A+ +
Sbjct: 8   FLLLVGCLS--LATTGYAVE-KVVATVNGTPILNSQVKQ---ALGKRADTAANRAAALDD 61

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           +I + L ++ I+ + I+     +     Q A   GL+   F   LD QGIG+  F+Q +A
Sbjct: 62  VIDDMLVQKAIKDAKISVSQQQIQQIMHQIANENGLTYGQFLDALDYQGIGEAKFRQQIA 121

Query: 140 IQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
            Q I   V          V  + + K G         K  +K +   +YL+  +L  I  
Sbjct: 122 HQIIMGQVRNKAISESISVSREQIEKLGKQMYNEAKQKGTLKTVKSPQYLVSHIL--IKT 179

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQFQ 247
           N L N    +K++       +          K  SK  +   + G   +       P+FQ
Sbjct: 180 NPLLNDAQAKKQLSSLRSDIIAGKTTFAAAAKTYSKDYLSGANGGSLDWNFPEVYEPEFQ 239

Query: 248 NLLKKSQNNT-TNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA---- 302
           +++K S+    + P+ T+ G   + + DKRD  G+   +AY+  Q    ++   +A    
Sbjct: 240 SMVKNSKKGVISQPFKTKYGWHILEVVDKRD--GDKTKEAYM--QKAYQQVVNQQAMEAS 295

Query: 303 -EYVKKLRSNAII 314
            ++VK LR +A I
Sbjct: 296 KDWVKTLRKSADI 308


>gi|83952309|ref|ZP_00961041.1| PPIC-type PPIASE domain [Roseovarius nubinhibens ISM]
 gi|83837315|gb|EAP76612.1| PPIC-type PPIASE domain [Roseovarius nubinhibens ISM]
          Length = 441

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 1/140 (0%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           K   T  V ++  + P+ +    A S      T+N   IT  +I +R   L+L +  G+ 
Sbjct: 16  KFFQTSAVALVLGLTPLTAAPVIAQSKFEAVITVNNAPITQFEIEQRARFLRLLRAPGDP 75

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
             +A ++LI + LK Q   +SGI  +   +     + A    LS  +    L  +G+ + 
Sbjct: 76  IALAREQLIEDRLKLQAARQSGIEVNEEQIAAGMDRFASQANLSGAEMVKLLASEGVYEE 135

Query: 133 HFKQYLAIQSIWPDVVKNDF 152
            F+ ++     W D+ +  F
Sbjct: 136 TFRAFIIAGVSWSDLTRARF 155


>gi|260433485|ref|ZP_05787456.1| ppic-type ppiase domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417313|gb|EEX10572.1| ppic-type ppiase domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 417

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N +++T  ++ +R   L+L  I G  E    + LI E L+KQ + ++GI      V   
Sbjct: 47  VNQDIVTWYELEQRQRFLELLGIPGSSEAEVRKALIDERLRKQAMREAGIQSAPEDVQLA 106

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
             + A    LS E+F + L   G+     + Y+A Q  W D V   F+ +    + EI
Sbjct: 107 IDEFAARGQLSPEEFLAALSDAGVAPETVRDYVASQLAWRDYVSARFISQARPTQDEI 164


>gi|163735798|ref|ZP_02143227.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           litoralis Och 149]
 gi|161390884|gb|EDQ15224.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           litoralis Och 149]
          Length = 415

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 54/118 (45%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N  VIT+ +I +R   L L    G   +  ++ELI E L+ Q +  +G+      +   
Sbjct: 44  VNDGVITEFEIEQRQQFLILLNAPGSSRQAVIEELINERLRAQAVANAGLELSDAAMQDG 103

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
            ++ A    L  ++F + L++ GI    F+ ++ +   W D +   F  +    E EI
Sbjct: 104 MIEFAGRVNLGVDEFKTVLEENGIAATTFEDFVRVGVSWRDFIAARFGPRLQVSEEEI 161


>gi|240949661|ref|ZP_04753996.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor
           NM305]
 gi|240295919|gb|EER46595.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor
           NM305]
          Length = 317

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 66/136 (48%), Gaps = 5/136 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +K  +   +L+ F     +S   +A   R+  T++G +I +  +++ +     +K N E 
Sbjct: 1   MKFTSAKSLLVAFVATLGLSQSLFAAEERVVATVDGNMIMESQVARALG----KKANTEA 56

Query: 73  -EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             K A++ +I E L ++ I++SG+  D   V+    + A   GL+       LD QGI  
Sbjct: 57  NRKAALESIIDEMLVQKAIQQSGVKVDYRRVDQAIEEIAARNGLTYGQLLDALDYQGISL 116

Query: 132 NHFKQYLAIQSIWPDV 147
           N ++Q +A Q +   V
Sbjct: 117 NQYRQQIAQQMMMEAV 132


>gi|329903502|ref|ZP_08273518.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Oxalobacteraceae bacterium IMCC9480]
 gi|327548325|gb|EGF33013.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Oxalobacteraceae bacterium IMCC9480]
          Length = 475

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 14/190 (7%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQ-KINGE-------LEKIAVQELIVETLKKQEIEKS 93
           I   +N +VIT  D++ R+AL++ + K  G        LEK  ++ +IV+  + Q    S
Sbjct: 66  IVAVVNSDVITRLDLNSRVALVETRMKQQGSQLPQRALLEKQILERMIVDRAQLQLAADS 125

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF----KQYLAIQSIWPDVVK 149
           GI  D   ++    + A    LS +DF + L+++G   + F    ++ +A+Q I    V 
Sbjct: 126 GIKIDDVMLDRAMARLAEQNKLSMQDFRNQLEREGTPFSRFREEIREEIAMQRIREREVD 185

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
           N   +    ++  + A K   +     EY +  +L  IP+N    Q   ++   D    +
Sbjct: 186 NKLQITESEVDNYLDAEKNAPQ--IQPEYNLAQILIRIPENATAEQIAARRARADDVARQ 243

Query: 210 LRLPKDCNKL 219
           LR   D  KL
Sbjct: 244 LRSGADFAKL 253


>gi|89070359|ref|ZP_01157666.1| PPIC-type PPIASE domain protein [Oceanicola granulosus HTCC2516]
 gi|89044006|gb|EAR50181.1| PPIC-type PPIASE domain protein [Oceanicola granulosus HTCC2516]
          Length = 405

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 53/108 (49%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+N   I+  +I +R  LL++    G+LE +A ++L+ + LK  E++++G+     ++  
Sbjct: 33  TVNDSAISFYEIDQRAKLLRVFNTPGDLEALAREQLVEDRLKLAELDRAGLQLSEESLAA 92

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                A    L  E F   L + G+ +   + ++ +   W D ++  +
Sbjct: 93  EMEAFAGRADLPYEQFIGVLAEAGVAEETLRDFVRVGVSWRDYIRTRY 140


>gi|83942391|ref|ZP_00954852.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. EE-36]
 gi|83846484|gb|EAP84360.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. EE-36]
          Length = 405

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/230 (18%), Positives = 95/230 (41%), Gaps = 6/230 (2%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N  V+T+ ++ +R   L++    G   + A+  LI E L+ + + ++GI      +   
Sbjct: 35  VNESVVTEFEVQQRQRFLEVLNAPGATREGALTSLIDERLRNEAVAEAGIELTPQGIEDS 94

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             + A    LS E+F+  L + G+    F+ ++     W ++V+  +  +    + EI  
Sbjct: 95  LAEFASRADLSTEEFTQALGQSGVSRETFRDFVVNSVGWRELVRARYASRVQITDAEINR 154

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
              + +   VR  L+  ++   P  +      + ++I  ++ +     +  N   ++++ 
Sbjct: 155 ALGETQGSGVR-VLVSEIIIPAPPQQAARVNALAEQISQSKSTA----EFSNYASRYSAT 209

Query: 226 IHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICD 274
                 G+  +   +DL P  Q L L  +    T+P      V    + D
Sbjct: 210 ASRGRGGRLPWQNLTDLPPSLQPLILNLAPGEVTDPLPIPNAVALFQLRD 259


>gi|83953611|ref|ZP_00962332.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83841556|gb|EAP80725.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. NAS-14.1]
          Length = 405

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/230 (18%), Positives = 95/230 (41%), Gaps = 6/230 (2%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N  V+T+ ++ +R   L++    G   + A+  LI E L+ + + ++GI      +   
Sbjct: 35  VNESVVTEFEVQQRQRFLEVLNAPGATREGALTSLIDERLRNEAVAEAGIELTPQGIEDS 94

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             + A    LS E+F+  L + G+    F+ ++     W ++V+  +  +    + EI  
Sbjct: 95  LAEFASRADLSTEEFTQALGQSGVSRETFRDFVVNSVGWRELVRARYASRVQITDAEINR 154

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
              + +   VR  L+  ++   P  +      + ++I  ++ +     +  N   ++++ 
Sbjct: 155 ALGETQGSGVR-VLVSEIIIPAPPQQAARVNALAEQISQSKST----AEFSNYASRYSAT 209

Query: 226 IHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICD 274
                 G+  +   +DL P  Q L L  +    T+P      V    + D
Sbjct: 210 ASRGRGGRLPWQNLTDLPPSLQPLILNLAPGEVTDPLPIPNAVALFQLRD 259


>gi|254509382|ref|ZP_05121467.1| chaperone SurA [Vibrio parahaemolyticus 16]
 gi|219547690|gb|EED24730.1| chaperone SurA [Vibrio parahaemolyticus 16]
          Length = 431

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 90/204 (44%), Gaps = 29/204 (14%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-KINGE-------LEKIAVQELIV 82
           ++Y       +I   +N  VI + DI   I  LK   + NG+       L +   ++LI+
Sbjct: 19  LAYAQPVALDKINVIVNSGVILESDIDTSIKTLKANARKNGQGLPEQEVLRQQVTEKLII 78

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           +TL++QE E+ G+  D N +N    + A+N   + E  S  +  +G+  + F++ +  + 
Sbjct: 79  DTLQQQEAERIGVRIDDNRLNQAIEEIAKNNNQTIEQLSDSIAAEGLEYSEFREQVR-KE 137

Query: 143 IWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           I     +N  + +  N+   +PA    + NI  +E    TV + I          +Q R+
Sbjct: 138 IAATEARNALVRRRINI---LPAEVDNLANILAQETNA-TVQYKI--------SHIQLRV 185

Query: 203 KDAEESRLRLPKDCNKLEKFASKI 226
            D +        D + LEK A  I
Sbjct: 186 NDGD--------DASALEKQAKDI 201


>gi|300023220|ref|YP_003755831.1| SurA domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525041|gb|ADJ23510.1| SurA domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 442

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 106/258 (41%), Gaps = 29/258 (11%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           ++K A++ELI E LK QE +K  +T + + V+      A    ++ + F+  +   G   
Sbjct: 200 VKKQAIEELIDERLKLQEAKKQSVTIEDSEVDRVITGIAERNKMTLDQFTKQV---GGSI 256

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNL---------EMEIPANKQKMKNITVREYLIRT 182
           +  K  +     W +VV+     ++G L         +M   A     +++   E  I+ 
Sbjct: 257 DPMKSRIRAALSWNEVVRR----RFGPLINVNTKDVDKMVATAAGSAQEDV---ELQIQR 309

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV---SIGKAQYLLE 239
           V   +P  K++  G  Q RI++AE+ R R   DC      A+ I      +IGK +    
Sbjct: 310 VQIMLP-KKMEEHGIAQ-RIEEAEKVRSRF-TDCKSTAAAATGIPGAKFENIGKRKS--- 363

Query: 240 SDL-HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIE 298
           S L  P    LL  S      P V    VE   +C +  +  +   +     +    + E
Sbjct: 364 STLPEPTRTLLLNASDGEMLPPSVGDGAVELYVVCGRDSVKSDADKRTQAEGELKQKEFE 423

Query: 299 KHEAEYVKKLRSNAIIHY 316
                Y+K LR +A I Y
Sbjct: 424 VMARRYLKDLREDAHIEY 441


>gi|257465500|ref|ZP_05629871.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor 202]
 gi|257451160|gb|EEV25203.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor 202]
          Length = 317

 Score = 46.2 bits (108), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 5/136 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +K  +   +L+ F     +S    A   R+  T++G +I +  +++ +     +K N E 
Sbjct: 1   MKFTSAKSLLVAFVATLGLSQSLLAAEERVIATVDGNMIMESQVTRALG----KKANTEA 56

Query: 73  -EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             K A++ +I E L ++ I++SG+  D   V+    + A   GL+       LD QGI  
Sbjct: 57  NRKAALENIIDEMLVQKAIQQSGVKVDYRRVDQAIEEIAVRNGLTYGQLLDALDYQGITL 116

Query: 132 NHFKQYLAIQSIWPDV 147
           N ++Q +A Q +   V
Sbjct: 117 NQYRQQIAQQMMMEAV 132


>gi|163746451|ref|ZP_02153809.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380336|gb|EDQ04747.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 412

 Score = 46.2 bits (108), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 72/164 (43%), Gaps = 1/164 (0%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N E IT  ++ +R   ++L    G      +  LI + L+ Q +E++G+    + +   
Sbjct: 41  VNDEAITGYEVQQRQRFMQLIGAPGTDSNSVIDSLIEDRLRGQILEQAGLEVTPDGIRAG 100

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP- 164
             + A    LS E+F   L +  I +  F+ ++ I + W D+++  +  +    + E+  
Sbjct: 101 MTEFAGRADLSTEEFLKVLGQAQISEETFRDFIVISAAWRDLIRARYNGRVNITDEEVER 160

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
           A      N  +R  L   ++ + P N  Q     ++  + + E+
Sbjct: 161 ALGSSRGNNGLRVLLSEIIIPAPPQNADQVNALAERIAQSSSEA 204


>gi|302383690|ref|YP_003819513.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194318|gb|ADL01890.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 450

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 107/265 (40%), Gaps = 24/265 (9%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKR----IALLKLQKINGELEKI---AVQEL 80
            P+     + M+  I  T+N +VIT  D+ +R    IA+ ++Q     +  I   A+Q L
Sbjct: 50  APLPPQPEFKMADGIVATVNDQVITGFDLRQRMLTTIAMSQVQPTEENIPAIQQQALQGL 109

Query: 81  IVETLKKQEIEK-SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           I E L+  EI K   +      V+    + A   G + + +  FL   GI   + ++ L 
Sbjct: 110 IEERLQAAEIAKFETLKITDAEVDEEIARMAEEAGTTPQAYVEFLTSGGIRAENLREQLR 169

Query: 140 IQSIWPDVVKNDFMLKYGNLEMEI-PANKQKMKNITVREYLIRTVLFSIPDNKLQNQG-- 196
            +  W ++V   F  +      ++  A +Q  +  +  +YL+  +         Q Q   
Sbjct: 170 TEIGWRELVGGRFNSRSRVSRAQVQQALRQVTETASKPQYLVGEIYLEAARVGGQQQAMN 229

Query: 197 ----FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
                VQ+ ++ A    +          +F++       G A +L++  + P+ Q  L+ 
Sbjct: 230 GAEQLVQQMVQGAPFQAV--------ARQFSAAPSAARGGDAGWLVQGTVQPELQAALEA 281

Query: 253 SQ-NNTTNPYVTQKGVEYIAICDKR 276
            +    + P     GV  I + DKR
Sbjct: 282 LEVGQLSRPIPVSGGVYIIYMRDKR 306


>gi|99080787|ref|YP_612941.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Ruegeria sp. TM1040]
 gi|99037067|gb|ABF63679.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Ruegeria sp. TM1040]
          Length = 424

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 100/246 (40%), Gaps = 7/246 (2%)

Query: 45  TINGEVITDGDISKRIALLK-LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVN 103
           T+N +VIT  ++ +R   L  L  + G+  + A  +LI + LK+Q ++  G+T     V 
Sbjct: 50  TVNEDVITTYELEQRALFLSVLGSVQGDPFETARDDLIEDRLKRQVMKDVGLTLSEEEVT 109

Query: 104 YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
               + A+   L+ E+F + L++ G+     + +      W + V+  F+ +    E EI
Sbjct: 110 EGMRELAQRANLTLEEFLASLNQAGVAPETVRDFTTAGLGWREYVRGRFLSQARPSEAEI 169

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
                   + +V+  L   +L    +N  Q Q      I+ +E +R             A
Sbjct: 170 DRAMGTAGSGSVQVLLSEIILPLTQENAAQVQDLA---IQISELTRAEAFAASAAQFSAA 226

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEI 282
               D   G+  ++  S L PQ Q  +L       T P   Q  +    +   R++ G  
Sbjct: 227 DSRTDG--GRLPWMSLSRLPPQLQEVVLGLEPGEITQPLPMQGAIAIFRMRGLREVDGRS 284

Query: 283 ALKAYL 288
           A  A +
Sbjct: 285 ATYAAI 290


>gi|329850880|ref|ZP_08265725.1| PPIC-type PPIASE domain protein [Asticcacaulis biprosthecum C19]
 gi|328841195|gb|EGF90766.1| PPIC-type PPIASE domain protein [Asticcacaulis biprosthecum C19]
          Length = 445

 Score = 45.4 bits (106), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/260 (20%), Positives = 109/260 (41%), Gaps = 29/260 (11%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKL-------QKINGELEKIAVQELIVETLKKQEI 90
           +S  +  ++N ++IT  D+ +R+ LL +       Q+     ++ A+  L+ E L+ QE+
Sbjct: 55  LSEGMLISVNDDMITSYDLKQRMLLLIVTSGVQVTQENYAAFQQQAINGLVDERLQMQEL 114

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
           +   +  D   +N    + A  +GL+ E   + L K GI     K  +  ++ W  +V  
Sbjct: 115 DHWKVKVDDADINEELERMASQSGLTGEQLLTELKKVGIEPATLKSQIRAETGWSRLVGG 174

Query: 151 DFM--LKYGNLEME-----IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
            +    K G+ +++     I A+ QK      ++YL+  +            G ++   K
Sbjct: 175 RYQSNAKVGSAQVDGTMDRIVADGQK------QQYLVAEIFLDP-----AQAGGIENAQK 223

Query: 204 DAEESRLRLPKDCNKLEKFASKIHDVSI----GKAQYLLESDLHPQFQNLLKKSQNNTTN 259
            A++   +L       +  A +  +       G A +L+  +L P  +  L  +Q     
Sbjct: 224 GAQQLYNQLQARAAPFQAVARQFSNAPSAAQGGDAGWLVADNLDPAIEVALAAAQPGEMT 283

Query: 260 PYVTQKGVEYIAICDKRDLG 279
           P +T +   YI +  ++  G
Sbjct: 284 PPITTEDGVYIYLLRQKTTG 303


>gi|323493622|ref|ZP_08098743.1| survival protein SurA [Vibrio brasiliensis LMG 20546]
 gi|323312145|gb|EGA65288.1| survival protein SurA [Vibrio brasiliensis LMG 20546]
          Length = 432

 Score = 45.4 bits (106), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 81/174 (46%), Gaps = 21/174 (12%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQ-KINGE-------LEKIAVQELIVETLKKQEIEKS 93
           I   +N  V+   DI   +  LK   K +G+       L +   ++LIV+T+++QE ++ 
Sbjct: 30  IAVIVNSGVVLQSDIDTSLKTLKANAKKSGQSLPSEQVLREQVTEKLIVDTIQQQEAQRI 89

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
           G+  D N +N    + ARN   + E  S+ + ++G+    F++ +  + I     +N  +
Sbjct: 90  GVRIDDNRLNEAIEEIARNNQQTVEQLSASIAQEGLSYAEFREQVR-KEIAASEARNALV 148

Query: 154 LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
            +  N+   +PA    + NI  +E    TV + I        G +Q R+ D ++
Sbjct: 149 RRRINI---LPAEVDNLANILAKETNA-TVQYKI--------GHIQLRVNDGDD 190


>gi|87198910|ref|YP_496167.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134591|gb|ABD25333.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 456

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 79/163 (48%), Gaps = 10/163 (6%)

Query: 41  RIRTTINGEVITDGDISKRIALL---KLQKINGE----LEKIAVQELIVETLKKQEIEKS 93
           R    +NGE+IT  D+ +R+AL+      KI+GE    L    ++ LI ETL+ QE + +
Sbjct: 64  RATAIVNGEIITGTDVEQRLALIVSANGGKIDGEEKERLRMQVLRNLIDETLQIQEAKAA 123

Query: 94  GITFDSNTVNYFFVQHA-RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            +  D   V+  + + A +N G SA+    +L + G      K+ +  +  W ++++ + 
Sbjct: 124 DVPADDGQVDASYERVATQNFGQSADALEKYLARIGSSAASLKRQIRGEIAWQNLLRRNV 183

Query: 153 MLKYGNLEMEIPANKQKMK-NITVREYLIRTV-LFSIPDNKLQ 193
                  E E+    Q+++ +    EY I  + L +  +NK Q
Sbjct: 184 QPFVNVSEGEVQEAMQRLQASKGTEEYRIGEIFLAATEENKPQ 226


>gi|161830191|ref|YP_001595995.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 331]
 gi|161762058|gb|ABX77700.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 331]
          Length = 321

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 137/333 (41%), Gaps = 47/333 (14%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS----------RIRTTINGEVITDGDISKRIALL 63
           K+LT+  ++II  +  I ++    + +          +I   +N E+IT  +++  +   
Sbjct: 4   KILTS--MVIILSVTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHALTAA 61

Query: 64  KLQKINGEL--------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
           K Q +  ++        +K  + +LI + L+ Q  + + I   +N +N    + ++   L
Sbjct: 62  KQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQANHL 121

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNIT 174
           S       L ++GI    F+  L  Q I   +            + +I A  KQ    I 
Sbjct: 122 SQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAGQIA 181

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIH----D 228
            +EY I T+L  +P +  Q Q      I  A+     + K   K   F  A K+H    D
Sbjct: 182 SKEYHIATILIPLPASATQAQ------INHAKGKAALILKQLQKGSSFETAMKMHPGSAD 235

Query: 229 VSIGKAQYLLESDLHPQF--QNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIAL 284
           +    A+ L      PQ   + +LK   N  T P     G   I + DK  ++   +  +
Sbjct: 236 LGWRSAKEL------PQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKEAKNTVSDQQI 289

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           +  +  Q    K+EK   +++ +LRS+A IH Y
Sbjct: 290 QRIVYQQ----KVEKALQKWLTQLRSSAYIHIY 318


>gi|167646489|ref|YP_001684152.1| SurA domain-containing protein [Caulobacter sp. K31]
 gi|167348919|gb|ABZ71654.1| SurA domain [Caulobacter sp. K31]
          Length = 452

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 85/213 (39%), Gaps = 25/213 (11%)

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--------KQ 168
           A  FS+       GD     +++   + P+V      L+ G L   IP          ++
Sbjct: 249 ARQFSASPTAANGGDAG---WISPGEMPPEVDAAIEQLRPGQLSAPIPVRDGVYIIYLRE 305

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL-PK--DCNKLEKFASK 225
           K          ++ V  ++P +  Q Q      +  A +  L L PK  +C  LE  A K
Sbjct: 306 KRSGAKTALVDLKQVALALPKDASQAQ------VDAANKVLLDLKPKIVNCETLEATAGK 359

Query: 226 IHDVSIGKAQYLLESDLHPQFQ---NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEI 282
           +  V  G       +DL P FQ   N LK  Q   ++P  T  G+  IA+C KR  G + 
Sbjct: 360 VEGVVAGDLGEAEITDLAPAFQQAANTLKVGQ--VSDPIRTDAGLHLIAVCGKRQSGAQA 417

Query: 283 ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             +  +  +    ++      Y++ LR++A I 
Sbjct: 418 PTRDQIENRLRGQQLALISKRYLRDLRNSATIE 450


>gi|110834907|ref|YP_693766.1| survival protein SurA [Alcanivorax borkumensis SK2]
 gi|122070614|sp|Q0VMV4|SURA_ALCBS RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|110648018|emb|CAL17494.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Alcanivorax borkumensis SK2]
          Length = 435

 Score = 45.1 bits (105), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 59/127 (46%), Gaps = 8/127 (6%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-KINGE------- 71
            + +   ++P+ S     M  RI   +N   I   ++ +RI  + LQ +  G+       
Sbjct: 15  LLAMAVLMIPVWSQAKVQMLDRIVAVVNDGAIMASELDERINTIALQFQEKGQQLPSPAI 74

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +  +  +I+E L+ Q  E++GI  D  ++N      AR   +S EDF++ L + G   
Sbjct: 75  LREQVLDRMILERLQLQLAERAGIKVDEASLNEALAGIARQNDMSLEDFAATLREDGYSW 134

Query: 132 NHFKQYL 138
             F++ +
Sbjct: 135 TQFREQI 141


>gi|215919309|ref|NP_820955.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 493]
 gi|206584194|gb|AAO91469.2| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii RSA 493]
          Length = 321

 Score = 44.7 bits (104), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 137/333 (41%), Gaps = 47/333 (14%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS----------RIRTTINGEVITDGDISKRIALL 63
           K+LT+  ++II  +  I ++    + +          +I   +N E+IT  +++  +   
Sbjct: 4   KILTS--MVIILSVTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHALTAA 61

Query: 64  KLQKINGEL--------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
           K Q +  ++        +K  + +LI + L+ Q  + + I   +N +N    + ++   L
Sbjct: 62  KQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQANHL 121

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNIT 174
           S       L ++GI    F+  L  Q I   +            + +I A  KQ    I 
Sbjct: 122 SQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAGQIA 181

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIH----D 228
            +EY I T+L  +P +  Q Q      I  A+     + K   K   F  A K+H    D
Sbjct: 182 SKEYHIATILIPLPASATQAQ------INHAKGKAALVLKQLQKGSSFETAMKMHPGSAD 235

Query: 229 VSIGKAQYLLESDLHPQF--QNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIAL 284
           +    A+ L      PQ   + +LK   N  T P     G   I + DK  ++   +  +
Sbjct: 236 LGWRSAKEL------PQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKEAKNTVSDQQI 289

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           +  +  Q    K+EK   +++ +LRS+A IH Y
Sbjct: 290 QRIVYQQ----KVEKALQKWLTQLRSSAYIHIY 318


>gi|73667407|ref|YP_303423.1| hypothetical protein Ecaj_0794 [Ehrlichia canis str. Jake]
 gi|72394548|gb|AAZ68825.1| ATP synthase F1 subcomplex epsilon subunit [Ehrlichia canis str.
           Jake]
          Length = 399

 Score = 44.7 bits (104), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 66/125 (52%), Gaps = 4/125 (3%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL-QKINGE-LEKIAVQE 79
           L+I C++ + S   +A   +I   +N ++I++ D+ KR+A+ K   K++G    +IA+  
Sbjct: 12  LLILCVM-LFSSTVFA-DVKIVAMVNDDLISNLDLEKRVAINKFFYKVDGSTAAEIALDA 69

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LI E++ +QE +K  IT     +     Q      L   DF S+++ QG+    F Q++ 
Sbjct: 70  LIDESIWRQEAKKLKITVTERDILEAVKQFLVMKNLGNIDFKSYVETQGLDYKMFMQHMK 129

Query: 140 IQSIW 144
            + +W
Sbjct: 130 SKLLW 134


>gi|159043736|ref|YP_001532530.1| SurA domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157911496|gb|ABV92929.1| SurA domain protein [Dinoroseobacter shibae DFL 12]
          Length = 398

 Score = 44.7 bits (104), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/225 (18%), Positives = 98/225 (43%), Gaps = 20/225 (8%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+N E I+  ++ +R   +   ++ G+  ++A + LI + LK Q    +G+    + +  
Sbjct: 31  TVNNEGISGYELEQREKFVTALRLPGDPARLAREGLIEDKLKLQAARAAGLEIGIDELEL 90

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF--MLKYGNLEME 162
              + A    L+ E F + L  +G+    F+ ++    +W ++++  F    +  + E+E
Sbjct: 91  GLEEFASRANLTTEQFIAALADEGVAPETFRDFVRADLVWRELIRQRFGPRARVSDAEVE 150

Query: 163 IPANKQKMKN---ITVREYLIRTVLFSIPDNKLQNQGF---VQKRIKDAEESRLRLPKDC 216
                Q   +   I V E +I T     PD +++ +     +++R++   +         
Sbjct: 151 RALALQGAASGARIRVAEIIIPTP----PDRRVEAETLAANIRERVQTTAQF-------S 199

Query: 217 NKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNP 260
              ++F++     + G   ++  S+L P   Q LL     + ++P
Sbjct: 200 EAAQRFSAASSRANGGLRDWIAVSELPPGLAQRLLTLGPGDVSDP 244


>gi|254429963|ref|ZP_05043670.1| SurA N-terminal domain family [Alcanivorax sp. DG881]
 gi|196196132|gb|EDX91091.1| SurA N-terminal domain family [Alcanivorax sp. DG881]
          Length = 442

 Score = 44.7 bits (104), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 13/138 (9%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWA-----MSSRIRTTINGEVITDGDISKRI--ALLKLQ 66
           + L     L+    + ++   +W+     M  RI   +N   I   ++ +RI    L+ Q
Sbjct: 11  RTLHARHTLLGLLAMAVLMLPAWSQAKVQMLDRIVAVVNDGAIMASELDERINTIALQFQ 70

Query: 67  KINGELEKIAV------QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
           +   +L   AV        +++E L+ Q  E+ GI  D  ++N      AR  G+S EDF
Sbjct: 71  EKGQQLPPPAVMREQVLDRMVLERLQLQLAERGGIKVDDASLNQALAGIARQNGMSLEDF 130

Query: 121 SSFLDKQGIGDNHFKQYL 138
           ++ L + G     F++ +
Sbjct: 131 AAALRQDGYDWPQFREQI 148


>gi|86138690|ref|ZP_01057263.1| PPIC-type PPIASE domain protein [Roseobacter sp. MED193]
 gi|85824750|gb|EAQ44952.1| PPIC-type PPIASE domain protein [Roseobacter sp. MED193]
          Length = 396

 Score = 44.3 bits (103), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 55/119 (46%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T++   IT  ++++R   + + +  G+ E +A QELI + LK  E+ K GI+     +  
Sbjct: 25  TVDNAAITYYELNQRALFMGVLRTPGDPEVMARQELIKDRLKLAELAKVGISPSEEEITA 84

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
              + A    LS  +F + L + GI     + +  +   W + +   F+ +    E EI
Sbjct: 85  GMTELASRANLSLNEFLTVLKQNGIDPETVRDFTKVGIGWREYIGARFLSRARPTEAEI 143


>gi|117925616|ref|YP_866233.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Magnetococcus sp.
           MC-1]
 gi|117609372|gb|ABK44827.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Magnetococcus sp.
           MC-1]
          Length = 442

 Score = 44.3 bits (103), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 49/252 (19%), Positives = 110/252 (43%), Gaps = 20/252 (7%)

Query: 42  IRTTINGEVITDGDISK--RIALLKLQKINGE-----LEKIAVQELIVETLKKQEIEKSG 94
           I   + GE+I + +I+   R  ++K  +   +     L +  +   ++  L+ Q+ ++ G
Sbjct: 35  IAAVVEGEIILESEIADQLRAQVMKFSRAGEQVDVALLRRRVLDGAVMRVLRAQKAKQLG 94

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF----KQYLAIQSIWPDVVKN 150
           I      V+    + A++  +S E F   L ++G+G + +    +  L +Q I   V+  
Sbjct: 95  INLKDADVDGAVQRMAQHNNVSVEQFKMMLAREGVGFDSYLSSIRDQLYVQQIIRQVILP 154

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
              +    ++    A +Q  + I    E  I+ +L S+P+N L ++    + I D  +S 
Sbjct: 155 SVRVSDEEVQDLYKATRQDPEKIGGEPELRIKQILLSVPENALIHR---VREISDKAKSL 211

Query: 210 LRLPKDCNKLEKFASKIHD----VSIGKAQYLLESDLHPQFQNLLKKSQNNT-TNPYVTQ 264
           +   +      + AS+  D    ++ G   +    +L  Q ++L+ K ++   + P  T 
Sbjct: 212 VSQLRGGASFARLASEHSDDPSGLNGGDMGWFKRGELQAQIEDLVFKLEDGAISEPVRTT 271

Query: 265 KGVEYIAICDKR 276
           +G     + ++R
Sbjct: 272 QGFHIFMVAERR 283


>gi|329890123|ref|ZP_08268466.1| PPIC-type PPIASE domain protein [Brevundimonas diminuta ATCC 11568]
 gi|328845424|gb|EGF94988.1| PPIC-type PPIASE domain protein [Brevundimonas diminuta ATCC 11568]
          Length = 457

 Score = 44.3 bits (103), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 50/253 (19%), Positives = 112/253 (44%), Gaps = 20/253 (7%)

Query: 38  MSSRIRTTINGEVITDGDISKRI----ALLKLQKIN---GELEKIAVQELIVETLKKQEI 90
           +S  I  T+N  +IT  D+ +R+    A+ ++Q      G +++ A+ +LI + L+  E+
Sbjct: 66  LSDGIIATVNDRIITGFDLRQRMLVLMAMTQVQPTEENIGAIQQQALNDLIDQHLQAAEL 125

Query: 91  EK-SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
            K   +      ++      AR  G +   + +FL++ GI    F++ +  +  W ++V 
Sbjct: 126 AKFEQLKIGDAEIDQEIADMARQAGTTPASYINFLEQGGISIPAFREQMRTEIGWRELVG 185

Query: 150 NDF--MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
             F    + G  ++E    +Q  ++ T  +YLI  +       +    G +Q+ +  A +
Sbjct: 186 GRFRDRARVGKSQIE-QTMRQMTESATKPQYLIGEIYL-----EAARVGGMQEAMNGARQ 239

Query: 208 SRLRLPKDCNKL---EKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
              ++ +    +    +F++       G A ++++  + P  Q+++        +NP   
Sbjct: 240 LVQQMIQGAPFMAVARQFSAAPSAARGGDAGWVVQGTVQPALQSVMDTLEAGQLSNPIPV 299

Query: 264 QKGVEYIAICDKR 276
             GV  + + DKR
Sbjct: 300 DGGVYILYMRDKR 312



 Score = 40.8 bits (94), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 240 SDLHPQFQNLLKKSQNNTTNPYV-TQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIE 298
           +DL PQFQ + + ++  + +  V T  GV  +A+CD+R LGG  A     SAQ    +++
Sbjct: 378 ADLLPQFQQVARSAEVGSVSTAVRTPLGVHLLAVCDRR-LGGPDA----PSAQQVEARLQ 432

Query: 299 KHE-----AEYVKKLRSNAIIH 315
                     Y++ LR++A+I 
Sbjct: 433 NQNYAMLGRRYLRDLRADALIE 454


>gi|260428595|ref|ZP_05782574.1| ppic-type ppiase domain protein [Citreicella sp. SE45]
 gi|260423087|gb|EEX16338.1| ppic-type ppiase domain protein [Citreicella sp. SE45]
          Length = 410

 Score = 43.9 bits (102), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 95/232 (40%), Gaps = 7/232 (3%)

Query: 50  VITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQH 109
           VIT  ++ +R  +L L    G    +A ++L+ + L+ Q  + +GI      +     + 
Sbjct: 43  VITGYELDQRARMLTLLNAPGNTNDLAREQLVDDRLRLQAAQNAGIEPTEEEILDGMSEF 102

Query: 110 ARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQ 168
           A    LS E+F + L + G+ +  F+ ++   + W  +V++ F+ +      E+  A   
Sbjct: 103 AGRAQLSREEFVTALGRAGVAEQTFRDFVRAGAAWRSLVQSRFVQQSQVSPAEVDRALAG 162

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
              + TVR  L   ++   P N  + +   ++  +   ES           +  A+   D
Sbjct: 163 NGGSSTVRVLLSEIIMPLSPQNVEEVRARAERIAQMTSESEF----SAQARQYSATATRD 218

Query: 229 VSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
              G+  +   ++L PQ + + L  S    T P   Q  V    + D  + G
Sbjct: 219 AG-GRLPWRELNELPPQLRPMILGLSPGQVTQPIPIQGAVALFQLRDIEETG 269


>gi|126728790|ref|ZP_01744605.1| PPIC-type PPIASE domain [Sagittula stellata E-37]
 gi|126710720|gb|EBA09771.1| PPIC-type PPIASE domain [Sagittula stellata E-37]
          Length = 412

 Score = 43.9 bits (102), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 70/148 (47%), Gaps = 3/148 (2%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N +VIT  ++ +R  +L++ +  G+L K+A ++LI + L+ Q    +GI      +   
Sbjct: 38  VNEQVITGYELEQRKRMLQVMRAPGDLNKVAREQLIDDRLRLQAARDAGIQPSPEELLDG 97

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA 165
             + A    L+ E F+  L + G+ +  ++ ++     W  +V+  F  +    E E+  
Sbjct: 98  MEEFASRASLTREQFTQALAQAGVDEETYRDFVRAGLSWRMLVQQRFAGRANVSEDEVDR 157

Query: 166 NKQKMKN--ITVREYLIRTVLFSIPDNK 191
                +N   TVR  L+  ++  +P  +
Sbjct: 158 ALSSGQNGTSTVR-VLLSEIIMPMPPGQ 184


>gi|241761719|ref|ZP_04759806.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752284|ref|YP_003225177.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|241374027|gb|EER63560.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258551647|gb|ACV74593.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 471

 Score = 43.9 bits (102), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 25/173 (14%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIA-----------VQELIVETLKKQEIEKSG 94
           +NG +IT+ DI +R AL+ L    G++ +I+           ++ LI ETL+ QE + + 
Sbjct: 75  VNGTIITNTDIEQRFALI-LASAGGDVSRISEEDRNMARLQILRNLIDETLEIQEAKAND 133

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV--KNDF 152
           I      ++  F  +ARN   + E FS+ L   G      K+ +     W  ++  + + 
Sbjct: 134 IIITPTELDQIFEHYARNMKKTPEAFSADLQAIGSSAKSVKRQVEADMAWRRLLGRRVEP 193

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD----------NKLQNQ 195
            +   N E++   N+ K       EY I  + FS  D          NK+Q+Q
Sbjct: 194 FVNISNEEVQNIINRMKAAK-GKDEYHIAEIFFSANDTNRAEVRAKANKIQDQ 245


>gi|88658238|ref|YP_507033.1| SurA domain-containing protein [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599695|gb|ABD45164.1| surA domain protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 395

 Score = 43.5 bits (101), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKL-QKINGE-LEKIAV 77
           +L++F I+    Y S   +S +I   +N E+I++ D+ KRIA+ K   K+ G   E+IA+
Sbjct: 8   LLVLFIIL----YSSNVFASVKIVAMVNDELISNLDLEKRIAINKFFYKVEGNTAEEIAL 63

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
             LI E++ +QE  K  +T     +     Q      L   D  S+++ QG+    F Q+
Sbjct: 64  NALIDESIWRQEARKLKVTVTERDLLEAIKQFLVIKNLGNIDLKSYVEAQGLDYKLFVQH 123

Query: 138 LAIQSIWPDVV 148
           +  + +W  ++
Sbjct: 124 MKSKLLWNKIL 134


>gi|68171990|ref|ZP_00545291.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67998586|gb|EAM85338.1| conserved hypothetical protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 395

 Score = 43.5 bits (101), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKL-QKINGE-LEKIAV 77
           +L++F I+    Y S   +S +I   +N E+I++ D+ KRIA+ K   K+ G   E+IA+
Sbjct: 8   LLVLFIIL----YSSNVFASVKIVAMVNDELISNLDLEKRIAINKFFYKVEGNTAEEIAL 63

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
             LI E++ +QE  K  +T     +     Q      L   D  S+++ QG+    F Q+
Sbjct: 64  NALIDESIWRQEARKLKVTVTERDLLEAIKQFLVIKNLGNIDLKSYVEAQGLDYKLFVQH 123

Query: 138 LAIQSIWPDVV 148
           +  + +W  ++
Sbjct: 124 MKSKLLWNKIL 134


>gi|163743160|ref|ZP_02150542.1| PPIC-type PPIASE domain [Phaeobacter gallaeciensis 2.10]
 gi|161383577|gb|EDQ07964.1| PPIC-type PPIASE domain [Phaeobacter gallaeciensis 2.10]
          Length = 421

 Score = 43.5 bits (101), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 65/141 (46%), Gaps = 4/141 (2%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F   P  +   +A +     T+N  V+T+ ++ +R   L L +  G+ +K A ++LI+
Sbjct: 32  VMFGPAPAAAQGLFAPA----VTVNDAVVTNYELQQRARFLTLLRDPGDPQKKAREDLIL 87

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + LK   + ++GI      +     + A    LS ++F + L + G+     + +  +  
Sbjct: 88  DRLKLDVLAQAGIEPTEEEIVEGMTELAGRANLSLQEFLNVLGQNGVAPETLRDFTRVGI 147

Query: 143 IWPDVVKNDFMLKYGNLEMEI 163
            W + V   ++ +    E EI
Sbjct: 148 AWREYVAARYLAQARPSEEEI 168


>gi|154706423|ref|YP_001425383.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii Dugway
           5J108-111]
 gi|154355709|gb|ABS77171.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii Dugway
           5J108-111]
          Length = 321

 Score = 43.5 bits (101), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 136/333 (40%), Gaps = 47/333 (14%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS----------RIRTTINGEVITDGDISKRIALL 63
           K+LT+  ++II  +  I ++    + +          +I   +N E+IT  +++  +   
Sbjct: 4   KILTS--MVIILSVTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHALTAA 61

Query: 64  KLQKINGEL--------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
           K Q +  ++        +K  + +LI + L+ Q  + + I   +N +N    + ++   L
Sbjct: 62  KQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQANHL 121

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNIT 174
           S       L ++GI    F+  L  Q I   +            + +I A  KQ    I 
Sbjct: 122 SQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAGQIA 181

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIH----D 228
             EY I T+L  +P +  Q Q      I  A+     + K   K   F  A K+H    D
Sbjct: 182 STEYHIATILIPLPASATQAQ------INHAKGKAALVLKQLQKGSSFETAMKMHPGSAD 235

Query: 229 VSIGKAQYLLESDLHPQF--QNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIAL 284
           +    A+ L      PQ   + +LK   N  T P     G   I + DK  ++   +  +
Sbjct: 236 LGWRSAKEL------PQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKEAKNTVSDQQI 289

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           +  +  Q    K+EK   +++ +LRS+A IH Y
Sbjct: 290 QRIVYQQ----KVEKALQKWLTQLRSSAYIHIY 318


>gi|283856448|ref|YP_163047.2| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775452|gb|AAV89936.2| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 435

 Score = 43.5 bits (101), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 25/173 (14%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIA-----------VQELIVETLKKQEIEKSG 94
           +NG +IT+ DI +R AL+ L    G++ +I+           ++ LI ETL+ QE + + 
Sbjct: 39  VNGTIITNTDIEQRFALI-LASAGGDVSRISEEDRNMARLQILRNLIDETLEIQEAKAND 97

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV--KNDF 152
           I      ++  F  +ARN   + E FS+ L   G      K+ +     W  ++  + + 
Sbjct: 98  IIITPTELDQIFEHYARNMKKTPEAFSADLQAIGSSAKSVKRQVEADMAWRRLLGRRVEP 157

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD----------NKLQNQ 195
            +   N E++   N+ K       EY I  + FS  D          NK+Q+Q
Sbjct: 158 FVNISNEEVQNIINRMKAAK-GKDEYHIAEIFFSANDTNRAEVRAKANKIQDQ 209


>gi|326386746|ref|ZP_08208367.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208799|gb|EGD59595.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 467

 Score = 43.5 bits (101), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 67/162 (41%), Gaps = 15/162 (9%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQE-----------LIVETLKKQE 89
           R    +NGE+IT  DI +R+AL+     NG   KI  +E           LI ETL+ QE
Sbjct: 73  RATAIVNGEIITGTDIDQRLALII--NANGGGNKIPAEEQERLRAQVLRNLIDETLQIQE 130

Query: 90  IEKSGITFDSNTVNYFFVQHA-RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
            +  GI  D   VN  F + A +N G +      +L   G      K+ +  +  W  ++
Sbjct: 131 AKGVGIEIDEEEVNQSFDRVAQQNFGQNTAALEKYLTSIGSSAASLKRQIKGEMAWQRLL 190

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNI-TVREYLIRTVLFSIPD 189
           + +        + E+     +MK      EY I  +  S  D
Sbjct: 191 RRNVQPYINVSDSEVREMMDRMKAAKGTEEYHIGEIFLSATD 232


>gi|163739707|ref|ZP_02147115.1| leucyl aminopeptidase [Phaeobacter gallaeciensis BS107]
 gi|161386937|gb|EDQ11298.1| putative chaperone surA [Phaeobacter gallaeciensis BS107]
          Length = 421

 Score = 43.1 bits (100), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 65/141 (46%), Gaps = 4/141 (2%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F   P  +   +A +     T+N  V+T+ ++ +R   L L +  G+ +K A ++LI+
Sbjct: 32  VMFGPAPAAAQGLFAPA----VTVNDAVVTNYELQQRARFLTLLRDPGDPQKKAREDLIL 87

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + LK   + ++GI      +     + A    LS ++F + L + G+     + +  +  
Sbjct: 88  DRLKLDVLAQAGIEPTEEEIVEGMTELAGRANLSLQEFLNVLGQNGVAPETLRDFTRVGI 147

Query: 143 IWPDVVKNDFMLKYGNLEMEI 163
            W + V   ++ +    E EI
Sbjct: 148 AWREYVAARYLAQARPSEEEI 168


>gi|212213438|ref|YP_002304374.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuG_Q212]
 gi|212011848|gb|ACJ19229.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuG_Q212]
          Length = 321

 Score = 43.1 bits (100), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 136/336 (40%), Gaps = 53/336 (15%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS-------------RIRTTINGEVITDGDISKRI 60
           K+LT+  V     I+ + S  ++A S+             +I   +N E+IT  +++  +
Sbjct: 4   KILTSMVV-----ILSVTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 61  ALLKLQKINGEL--------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
              K Q +  ++        +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKKVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMK 171
             LS       L ++GI    F+  L  Q I   +            + +I A  KQ   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIH-- 227
            I   EY I T+L  +P +  Q Q      I  A+     + K   K   F  A K+H  
Sbjct: 179 QIASTEYHIATILIPLPASATQAQ------INHAKGKAALVLKQLQKGSSFETAMKMHPG 232

Query: 228 --DVSIGKAQYLLESDLHPQF--QNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGE 281
             D+    A+ L      PQ   + +LK   N  T P     G   I + DK  ++   +
Sbjct: 233 SADLGWRSAKEL------PQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKEAKNTVSD 286

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
             ++  +  Q    K+EK   +++ +LRS+A IH Y
Sbjct: 287 QQIQRIVYQQ----KVEKALQKWLTQLRSSAYIHIY 318


>gi|156973131|ref|YP_001444038.1| hypothetical protein VIBHAR_00810 [Vibrio harveyi ATCC BAA-1116]
 gi|156524725|gb|ABU69811.1| hypothetical protein VIBHAR_00810 [Vibrio harveyi ATCC BAA-1116]
          Length = 427

 Score = 43.1 bits (100), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 37/62 (59%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +G+  + F++
Sbjct: 70  VEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAEGLSYSEFRE 129

Query: 137 YL 138
            +
Sbjct: 130 QI 131


>gi|153834210|ref|ZP_01986877.1| chaperone SurA [Vibrio harveyi HY01]
 gi|148869398|gb|EDL68404.1| chaperone SurA [Vibrio harveyi HY01]
          Length = 427

 Score = 43.1 bits (100), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 37/62 (59%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +G+  + F++
Sbjct: 70  VEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAEGLSYSEFRE 129

Query: 137 YL 138
            +
Sbjct: 130 QI 131


>gi|114766150|ref|ZP_01445154.1| PPIC-type PPIASE domain [Pelagibaca bermudensis HTCC2601]
 gi|114541610|gb|EAU44652.1| PPIC-type PPIASE domain [Roseovarius sp. HTCC2601]
          Length = 408

 Score = 43.1 bits (100), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 54/108 (50%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T++  VIT  +I +R  ++ L    G + +++ ++LI + L+ +    +GI      +  
Sbjct: 36  TVDEMVITGYEIEQRRRMMTLLNAPGNVNELSREQLIDDRLRLKAARAAGIEPSEQDILD 95

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
              + A    LS E F + L++ G+ +  F+ ++   + W D+V+  F
Sbjct: 96  GMDEFAGRADLSREQFVAVLNQGGVDEETFRDFVRAGTAWRDLVRAQF 143


>gi|164685824|ref|ZP_01945801.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165918731|ref|ZP_02218817.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 334]
 gi|212219488|ref|YP_002306275.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuK_Q154]
 gi|164601340|gb|EAX33680.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165917559|gb|EDR36163.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 334]
 gi|212013750|gb|ACJ21130.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuK_Q154]
          Length = 321

 Score = 43.1 bits (100), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 136/333 (40%), Gaps = 47/333 (14%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS----------RIRTTINGEVITDGDISKRIALL 63
           K+LT+  ++II  +  I ++    + +          +I   +N E+IT  +++  +   
Sbjct: 4   KILTS--MVIILSVTSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHALTAA 61

Query: 64  KLQKINGEL--------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL 115
           K Q +  ++        +K  + +LI + L+ Q  + + I   +N +N    + ++   L
Sbjct: 62  KQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQANHL 121

Query: 116 SAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNIT 174
           S       L ++GI    F+  L  Q I   +            + +I A  KQ    I 
Sbjct: 122 SQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAGQIA 181

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF--ASKIH----D 228
             EY I T+L  +P +  Q Q      I  A+     + K   K   F  A K+H    D
Sbjct: 182 STEYHIATILIPLPASATQAQ------INHAKGKAALVLKQLQKGSSFETAMKMHPGSAD 235

Query: 229 VSIGKAQYLLESDLHPQF--QNLLKKSQNNTTNPYVTQKGVEYIAICDK--RDLGGEIAL 284
           +    A+ L      PQ   + +LK   N  T P     G   + + DK  ++   +  +
Sbjct: 236 LGWRSAKEL------PQVFVKTVLKMKPNEVTGPIQAPNGFHIVKLLDKEAKNTVSDQQI 289

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           +  +  Q    K+EK   +++ +LRS+A IH Y
Sbjct: 290 QRIVYQQ----KVEKALQKWLTQLRSSAYIHIY 318


>gi|261250209|ref|ZP_05942785.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio orientalis CIP
           102891]
 gi|260939325|gb|EEX95311.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio orientalis CIP
           102891]
          Length = 432

 Score = 42.4 bits (98), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 22/198 (11%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL------QKINGE 71
           T   L+I   + +V  +  A+ + +   +N  V+   DI   I  LK       Q +  E
Sbjct: 7   TLLALMIASPINLVQAEPVALDT-VAVIVNTSVVLQSDIDTSIKTLKANAKKKGQSLPSE 65

Query: 72  --LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
             L +   ++LIV+T+++QE E+ G+  D N +N    + A+N   + E   + +  +G+
Sbjct: 66  EILTEQVTEKLIVDTIQQQEAERLGVRIDDNRLNEAISEIAKNNQQTVEQLRASIASEGL 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               F++ +  + I     +N  + +  N+   +PA    +  +  +E    TV + I  
Sbjct: 126 NYAEFREQIR-KEIAASEARNALVRRRINI---LPAEVDNLSELLAQETNA-TVQYKI-- 178

Query: 190 NKLQNQGFVQKRIKDAEE 207
                 G +Q R+ D ++
Sbjct: 179 ------GHIQLRVNDGDD 190


>gi|163802667|ref|ZP_02196558.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Vibrio sp. AND4]
 gi|159173555|gb|EDP58375.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Vibrio sp. AND4]
          Length = 427

 Score = 42.4 bits (98), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 41/69 (59%)

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ +  +G+
Sbjct: 63  GVLKEQVVEKLIIDTLQGQEAKRIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQMEGL 122

Query: 130 GDNHFKQYL 138
             + F++ +
Sbjct: 123 NYSEFREQI 131


>gi|269960923|ref|ZP_06175293.1| survival protein SurA [Vibrio harveyi 1DA3]
 gi|269834363|gb|EEZ88452.1| survival protein SurA [Vibrio harveyi 1DA3]
          Length = 427

 Score = 42.4 bits (98), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +G+    F++
Sbjct: 70  VEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAEGLSYPEFRE 129

Query: 137 YL 138
            +
Sbjct: 130 QI 131


>gi|260878025|ref|ZP_05890380.1| chaperone protein SurA [Vibrio parahaemolyticus AN-5034]
 gi|308089886|gb|EFO39581.1| chaperone protein SurA [Vibrio parahaemolyticus AN-5034]
          Length = 427

 Score = 42.0 bits (97), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E+ ++ +  +G+  
Sbjct: 65  LKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNNQSVEELAASVQAEGLSY 124

Query: 132 NHFKQYL 138
             F++ +
Sbjct: 125 PEFREQI 131


>gi|28897112|ref|NP_796717.1| survival protein SurA [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838965|ref|ZP_01991632.1| chaperone SurA [Vibrio parahaemolyticus AQ3810]
 gi|260361686|ref|ZP_05774713.1| chaperone protein SurA [Vibrio parahaemolyticus K5030]
 gi|260896920|ref|ZP_05905416.1| chaperone protein SurA [Vibrio parahaemolyticus Peru-466]
 gi|260903392|ref|ZP_05911787.1| chaperone protein SurA [Vibrio parahaemolyticus AQ4037]
 gi|81728608|sp|Q87ST4|SURA_VIBPA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|28805321|dbj|BAC58601.1| survival protein SurA [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747553|gb|EDM58485.1| chaperone SurA [Vibrio parahaemolyticus AQ3810]
 gi|308088746|gb|EFO38441.1| chaperone protein SurA [Vibrio parahaemolyticus Peru-466]
 gi|308109029|gb|EFO46569.1| chaperone protein SurA [Vibrio parahaemolyticus AQ4037]
 gi|308115514|gb|EFO53054.1| chaperone protein SurA [Vibrio parahaemolyticus K5030]
 gi|328471910|gb|EGF42787.1| survival protein SurA [Vibrio parahaemolyticus 10329]
          Length = 427

 Score = 42.0 bits (97), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E+ ++ +  +G+  
Sbjct: 65  LKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNNQSVEELAASVQAEGLSY 124

Query: 132 NHFKQYL 138
             F++ +
Sbjct: 125 PEFREQI 131


>gi|85711793|ref|ZP_01042849.1| Periplasmic parvulin-like peptidyl-prolyl isomerase [Idiomarina
           baltica OS145]
 gi|85694408|gb|EAQ32350.1| Periplasmic parvulin-like peptidyl-prolyl isomerase [Idiomarina
           baltica OS145]
          Length = 432

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 53/280 (18%), Positives = 114/280 (40%), Gaps = 13/280 (4%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK---- 64
           +   +K  T+  + ++ CI   V++    +  R+   ++  VI +  I + I  +K    
Sbjct: 1   MKQLVKFSTSVSIALMMCITATVAHAQQVLD-RVAVIVDDGVILESQIEQLIKQVKQSEN 59

Query: 65  LQKINGELEKI----AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
               N   +K+    A + LI + L+ Q  E+ GI      ++    + A++ G+S ++ 
Sbjct: 60  FSSANAPSDKVLRTQATERLIQQELQLQMAERMGIEVSEAQLDQAISRIAQDRGMSVDEL 119

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREY 178
                  G     F++ +  + I   V +     +      E+    N  +  + +  EY
Sbjct: 120 RENTINSGQSWPAFREQIKTEIITSQVERAAVQRRVSVTPQEVENLVNLIEQNDASPTEY 179

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYL 237
            +R +L  +  +    +    KR   A   RL   +D ++L  + +S  + +  G   ++
Sbjct: 180 RLRQILIGVDSDAPNEKQEAAKRRAQAVIDRLEEGEDFSQLAIRSSSGSNALDGGDLGWM 239

Query: 238 LESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
            E+ +   F  ++K KS+     P  +  G   + + DKR
Sbjct: 240 TENSMPTLFAEVVKGKSKGEIIGPIRSGVGFHILQVADKR 279


>gi|152978410|ref|YP_001344039.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Actinobacillus
           succinogenes 130Z]
 gi|150840133|gb|ABR74104.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Actinobacillus
           succinogenes 130Z]
          Length = 317

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 130/297 (43%), Gaps = 33/297 (11%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKINGEL-EKIAVQELIVETLKKQEIEKSGITFDS 99
           ++  T+NGE I +  + + +     ++ N E   ++AV ++I + L ++ +++SG+  + 
Sbjct: 30  QVVATVNGEPILESQLQRVMG----KRANTESNRRVAVDKIIDDMLVQKAVKESGVKVNP 85

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             VN      A   GL+       LD QGI  + FK  ++ Q +  + V+N  + K  ++
Sbjct: 86  AQVNQIVHNIADQNGLTYGQLLDALDYQGISLSQFKANISNQILMAE-VRNRSIGKGVDV 144

Query: 160 EME-IPANKQKM----------KNITVREYLIRTVLFSIPD--NKLQNQGFVQKRIKDAE 206
             E +    +KM          K IT  +Y  R +L  +    N  Q +  + +   D +
Sbjct: 145 SREQVEELSRKMLQQAKAGGNPKAITATQYKARHILLKLTPLLNDAQAKAQLTQIRADIQ 204

Query: 207 ESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQ 264
             +    +      K + S  +   +G   +    +  P+F  ++  + Q   + P+ T+
Sbjct: 205 SGKTTFAEAAKNYSKDYLSGANGGDLG---FAFPENYVPEFAKMMTTAKQGVISAPFKTE 261

Query: 265 KGVEYIAICDKRDLGGEIA-----LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            G   + + D R   G+I       KAY +  N   ++ ++  ++VK LR +A I Y
Sbjct: 262 FGWHILEVTDTRQ--GDITDVAYRQKAYETLVN--EQLREYSKDWVKALRKHAEIKY 314


>gi|224438394|ref|ZP_03659321.1| hypothetical protein HcinC1_10416 [Helicobacter cinaedi CCUG 18818]
 gi|313144836|ref|ZP_07807029.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129867|gb|EFR47484.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 276

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 106/267 (39%), Gaps = 54/267 (20%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVET 84
            C+  +VS         IR  +NG  IT  +ISK    +K+ K      K A+  LI E 
Sbjct: 8   LCLCVLVSQAEIIAGVAIR--VNGHAITLSEISKLQTQMKISK------KAAIDMLINER 59

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG----DNHFKQYLAI 140
           LK  EIE+  I+ D   ++    Q A N  LS +   + + + G       N  K+ L  
Sbjct: 60  LKDDEIERFKISIDEFKIDEEISQIAANANLSKDALLAKVTRDGTTLQEYRNKIKKQLQT 119

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL----IRTVLFSIPDNKLQNQG 196
           + +   ++ ++  +     E E+ +   K K    +E+L    +R V ++      QN+G
Sbjct: 120 KELMQRILASNISISS---EDELLSYYTKHK----KEFLLPSSVRVVRYT-----AQNEG 167

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE----SDLHPQFQNLLKK 252
            +Q  I+         PK               +I   Q + E    S L PQ   +   
Sbjct: 168 NLQNAIQS--------PK--------------TTIQGVQKINETISLSSLSPQIAQVFLN 205

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLG 279
           + NN   P +T  G  +++   K  LG
Sbjct: 206 TPNNEFTPVLTTGGNSFVSFLVKERLG 232


>gi|260775523|ref|ZP_05884420.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260608704|gb|EEX34869.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 431

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 80/167 (47%), Gaps = 19/167 (11%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L +   ++LIV+T+++QE E+ G+  D N +N    + A+N   + +  ++ + ++G+  
Sbjct: 68  LREQVTEKLIVDTIQQQEAERIGVRIDDNRLNEAIDEIAKNNNQTLQQLNTSIAEEGLSY 127

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
             F++ +  + I  +  +N  + +  N+   +PA    + NI  +E    TV + I    
Sbjct: 128 AQFREQVR-KEIAANEARNALVRRRINI---LPAEVDNLANILAKETNA-TVQYKI---- 178

Query: 192 LQNQGFVQKRIKDA------EESRLRLPKDCNKLEKFASKIHDVSIG 232
               G +Q R+ D       EE   ++ K+ N+   F++  +  S G
Sbjct: 179 ----GHIQLRVNDGDDKAAIEEKANQIVKELNQGSDFSTMAYTYSKG 221


>gi|254229741|ref|ZP_04923149.1| ppic-type ppiase domain protein [Vibrio sp. Ex25]
 gi|262392437|ref|YP_003284291.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. Ex25]
 gi|151937708|gb|EDN56558.1| ppic-type ppiase domain protein [Vibrio sp. Ex25]
 gi|262336031|gb|ACY49826.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. Ex25]
          Length = 427

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ ++ +G+  
Sbjct: 65  LKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNEQSVEQLAASVESEGLSY 124

Query: 132 NHFKQYL 138
             F++ +
Sbjct: 125 PEFREQI 131


>gi|91227110|ref|ZP_01261594.1| survival protein SurA [Vibrio alginolyticus 12G01]
 gi|269964662|ref|ZP_06178900.1| survival protein SurA [Vibrio alginolyticus 40B]
 gi|91188762|gb|EAS75049.1| survival protein SurA [Vibrio alginolyticus 12G01]
 gi|269830561|gb|EEZ84782.1| survival protein SurA [Vibrio alginolyticus 40B]
          Length = 427

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 40/67 (59%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L++  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ ++ +G+  
Sbjct: 65  LKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNEQSVEQLAASVESEGLSY 124

Query: 132 NHFKQYL 138
             F++ +
Sbjct: 125 PEFREQI 131


>gi|152982039|ref|YP_001352108.1| peptidyl-prolyl cis-trans isomerase SurA [Janthinobacterium sp.
           Marseille]
 gi|151282116|gb|ABR90526.1| peptidyl-prolyl cis-trans isomerase SurA [Janthinobacterium sp.
           Marseille]
          Length = 469

 Score = 41.6 bits (96), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 85/197 (43%), Gaps = 19/197 (9%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALL--KLQKING------ELEKIAVQELIVETLKKQE 89
           ++  I   +N EVIT  D  +R  ++  +LQ   G      +L++  ++ +IVE  + Q+
Sbjct: 48  LADAIIVVVNNEVITRYDFLERYKMIEARLQSQGGNLPPREQLQRQLLERMIVERAQLQQ 107

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG----DNHFKQYLAIQSIWP 145
            +++GI  D   ++    + A    LS  +F   L++ G+      N  +  +AIQ +  
Sbjct: 108 AKETGIKIDDTMLDRAMGRIAEQNKLSMPEFRKRLEEDGLVYSKFRNEIRDEMAIQRLRE 167

Query: 146 DVVKNDFMLKYGNLEMEIPA---NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
             V N   +     ++EI A             +E  I  +L  +P+N  Q Q    KR 
Sbjct: 168 REVDNKVQVS----DVEIDAYMAAHNAPAATAPQELHIAQILIRVPENATQKQLADSKRR 223

Query: 203 KDAEESRLRLPKDCNKL 219
            D   ++L    D  KL
Sbjct: 224 ADEVVAQLAAGADFAKL 240


>gi|254463317|ref|ZP_05076733.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Rhodobacterales
           bacterium HTCC2083]
 gi|206679906|gb|EDZ44393.1| peptidyl-prolyl cis-trans isomerase SurA, putative
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 416

 Score = 41.6 bits (96), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 51/107 (47%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N   IT+ +I +R+  L L +  G+  K+A ++LI + LK    +  GI+     V+  
Sbjct: 45  VNDRSITNFEIDERVKFLGLLRTPGDHRKLAREQLIEDRLKLGAAQSVGISPTQEEVDAG 104

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             + A    L   +F   ++  G+ ++ F+ ++     W  +V+  F
Sbjct: 105 MGEFAGRVNLETAEFIKAINAGGVSEDAFRAFVLSGLAWRQLVQAKF 151


>gi|256828792|ref|YP_003157520.1| SurA domain-containing protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256577968|gb|ACU89104.1| SurA domain protein [Desulfomicrobium baculatum DSM 4028]
          Length = 305

 Score = 41.2 bits (95), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 122/296 (41%), Gaps = 38/296 (12%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKIN-GELEKIAVQEL---IVETLKKQEIEKS 93
           +  RI   +NGE+IT  D+ ++I L   Q  +    EKIA Q L   I + + +QE ++ 
Sbjct: 27  LVDRIVAVVNGEIITFQDLQQQIRLSVGQTPDPATAEKIAPQVLDGMIDDVILRQEAQRL 86

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN--- 150
            I    + V+    Q      LS EDF   L  QG+    FK+         D+ K+   
Sbjct: 87  KIEVSDSEVDNEIRQFKARRRLSEEDFERTLRLQGLTPEQFKERSR-----EDITKHKML 141

Query: 151 DFMLKYGNL--EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
            +M++   +  + EI A  ++ ++    E ++   +  + D +  N   + K + + E S
Sbjct: 142 GYMVRRKVVVTQEEIDAYMEQNRSELTTERIVDVQMLVLVDEERANS--LWKSLSEGEVS 199

Query: 209 RLRLPKDCNKLEKFASKIHDVSIG-KAQYLLESDL------HPQFQNLLKKSQNNTTNPY 261
                            +   SIG KA+  +  D+       P    L   S    + P+
Sbjct: 200 -------------LEEAVERYSIGPKAENGVMRDVSWRELAEPWRDGLRNLSAGELSKPF 246

Query: 262 VTQKGVEYIAICDKRD--LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           + Q     + + D+RD     + A++  +       K+E+   EY+  LRS AII 
Sbjct: 247 LVQDKWVILKLLDRRDGVRQEDAAVEEEVREAIMRPKLEERFKEYMNGLRSKAIIQ 302


>gi|197105171|ref|YP_002130548.1| peptidyl-prolyl cis-trans isomerase family protein
           [Phenylobacterium zucineum HLK1]
 gi|196478591|gb|ACG78119.1| peptidyl-prolyl cis-trans isomerase family protein
           [Phenylobacterium zucineum HLK1]
          Length = 468

 Score = 41.2 bits (95), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 74/163 (45%), Gaps = 14/163 (8%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALL-------KLQKINGELEKIAVQELIVETLKKQE 89
            +S  +   +N E+I+  D+++R+ LL         ++   + ++ A+  L+ E L+ QE
Sbjct: 74  GISESVAAVVNDEIISTYDLAQRMRLLIATSGVQPTEQTLPQFQREALVSLVDERLQFQE 133

Query: 90  I------EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           +      +K  I      V+      AR   ++ E F SFL  +GIG +  +Q +  Q  
Sbjct: 134 LRRVEREQKIDIVATDEEVDEEIADMARQNNMTREQFLSFLGARGIGVDTLRQQIRAQVS 193

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLF 185
           W   ++  +  +    + +I A + +++    + +Y I  VL 
Sbjct: 194 WARWIRGRYGSRLRIGDDQIAATQARLEAAAAKPQYQISEVLI 236


>gi|15603073|ref|NP_246145.1| hypothetical protein PM1208 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721561|gb|AAK03292.1| SurA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 311

 Score = 40.8 bits (94), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 130/316 (41%), Gaps = 38/316 (12%)

Query: 23  IIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           I + I+ +  Y S A ++ R+  T+NG  + +  + K +         G+ + +A+ ++I
Sbjct: 10  IFWAILGLFIYVSTAQAAERVVATVNGVPVLESQVKKNMGK------KGQYQ-VALDKVI 62

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L +Q I+ SGI  +   V+      A   GL+       LD QGI  N ++Q +A Q
Sbjct: 63  DDILVQQAIQNSGIKVNYAQVDQIIEGIAAQNGLTYGQLLDALDYQGISYNAYRQQIANQ 122

Query: 142 SIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
            +  ++          V  + +    N  +         K I+  +Y +R +L  +  N 
Sbjct: 123 ILMGEIRNQAIGQSIDVTREQVEALSNQLLNQAKQAGTEKKISAPQYEVRHILLKL--NP 180

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH-------DVSIGKAQYLLESDLHP 244
           L N    +     A+ +++R      K+    + +H         + G   +        
Sbjct: 181 LLNDAQAK-----AQLTQIRADIIAGKMSFADAALHYSKDYLSGANGGSLGFAFPEAYVG 235

Query: 245 QFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL---KAYLSAQNTPTKIEKH 300
            FQ  +L   +   + P+ T+ G   + + + R+    I +   KAY   Q    +++  
Sbjct: 236 AFQKAILTTKKGVISAPFKTEFGWHILEVTNTREGDKTIDVYRQKAY--EQLVNQQVKDV 293

Query: 301 EAEYVKKLRSNAIIHY 316
           E ++VK LR NA I Y
Sbjct: 294 EKDWVKALRKNAEIRY 309


>gi|254464586|ref|ZP_05077997.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacterales
           bacterium Y4I]
 gi|206685494|gb|EDZ45976.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacterales
           bacterium Y4I]
          Length = 305

 Score = 40.8 bits (94), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 51/109 (46%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+N +VIT  ++ +R       ++ G+  + A +ELI + LK   ++++GI      +  
Sbjct: 44  TVNDQVITRYELEQRARFQAALRVPGDPLETAREELINDRLKLMVLKQAGIELSEEDITA 103

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
              + A    LS  +F + L +QG+     + +  +   W +  +  F+
Sbjct: 104 GMEELAGRANLSLNEFLTVLQQQGVAPQTLRDFTKVGLGWREYTRARFL 152


>gi|260773615|ref|ZP_05882531.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio metschnikovii CIP
           69.14]
 gi|260612754|gb|EEX37957.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio metschnikovii CIP
           69.14]
          Length = 431

 Score = 40.0 bits (92), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQ---KINGE 71
           L T  +  +  +V I + ++  +   R+   +N  VI   DI    ALL ++   K N +
Sbjct: 3   LWTLALYTLTSLVSIATVQAQPVELDRVAVIVNSGVILQSDIDS--ALLTVRANAKTNQQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LIV+TL++QE ++ G+  D NT+N    + A N   + E     +
Sbjct: 61  TLPPENILREQIIEKLIVDTLQQQEADRIGVRIDDNTLNDAITEIAHNNQQTPEQLRLSI 120

Query: 125 DKQGIGDNHFKQYL 138
            +QG+    F++ +
Sbjct: 121 AEQGLTYPEFREQI 134


>gi|58617519|ref|YP_196718.1| hypothetical protein ERGA_CDS_07920 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417131|emb|CAI28244.1| Hypothetical protein ERGA_CDS_07920 [Ehrlichia ruminantium str.
           Gardel]
          Length = 425

 Score = 40.0 bits (92), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 69/140 (49%), Gaps = 13/140 (9%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKL-QKINGELEK 74
           T    L+IF       Y S A ++ ++   +NGE+I+  D+ + IA+ K    ++ ++ K
Sbjct: 30  TIGLFLLIFAF-----YCSNAFANVKMVAMVNGELISSLDLERYIAISKFFYHVDSDVAK 84

Query: 75  -IAVQELIVETLKKQEIEKSGITFDS----NTVNYFFVQHARNTGLSAE-DFSSFLDKQG 128
            IA+  LI E + KQE EK  +        + VN  FV    N   +   DF S+ ++QG
Sbjct: 85  DIALDSLIDEYIWKQEAEKLKVVVSEQEILDAVNQLFVMKGSNHKENHNNDFKSYTEQQG 144

Query: 129 IGDNHFKQYLAIQSIWPDVV 148
           +  +   Q++  + +W  ++
Sbjct: 145 LDYDMLIQHVKSKLLWNKIL 164


>gi|89054302|ref|YP_509753.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Jannaschia sp. CCS1]
 gi|88863851|gb|ABD54728.1| PPIC-type PPIASE domain [Jannaschia sp. CCS1]
          Length = 422

 Score = 40.0 bits (92), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 48/107 (44%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N  ++T+ +I +RI  L++    G+L + A++ L+ E L+       G       +   
Sbjct: 50  VNDTIVTNFEIGQRIRFLQVLNAQGDLREQAIEALVNERLQLDAALAVGAEASPEAIETG 109

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             + A    L  E F   + ++GI     + ++A    W +VV+  F
Sbjct: 110 LEEFAGRANLGPEQFLRQMAQEGIAPETVRDFVANGITWRNVVRARF 156


>gi|149927949|ref|ZP_01916199.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Limnobacter sp.
           MED105]
 gi|149823388|gb|EDM82621.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Limnobacter sp.
           MED105]
          Length = 456

 Score = 40.0 bits (92), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 52/103 (50%), Gaps = 8/103 (7%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQEIEKS 93
           I   +N ++IT  ++++++AL++ Q            EL K  +  ++++  + Q+ E+ 
Sbjct: 55  IVAVVNTDIITRSELNRQVALIERQMSRRGAPLPDRIELRKQVLDRMVMDRAQLQKAEEV 114

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           GI  +   +     + A   GLS EDF + L ++G+    F++
Sbjct: 115 GIRIEEAQIEAAMARVADQNGLSLEDFLARLQEEGVSPARFRE 157


>gi|294012540|ref|YP_003546000.1| peptidyl-prolyl cis-trans isomerase SurA [Sphingobium japonicum
           UT26S]
 gi|292675870|dbj|BAI97388.1| peptidyl-prolyl cis-trans isomerase SurA [Sphingobium japonicum
           UT26S]
          Length = 461

 Score = 40.0 bits (92), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 11/116 (9%)

Query: 46  INGEVITDGDISKRIALLKLQKING------ELEKIAVQ---ELIVETLKKQEIEKSGIT 96
           +NG +IT  D+ +R+AL+     NG      E E++ VQ    LI ETL+ QE   + I 
Sbjct: 75  VNGRIITGTDVDQRLALII--TANGGKVSDEEKERLRVQVLRNLIDETLQIQEAAANDIK 132

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            D   ++  + + A N   S   F  +L +QG      K+ +  +  W  +++ + 
Sbjct: 133 VDKAEIDQSYERVAANFRQSPAQFDQYLRQQGSSSASIKRQIEGELAWSRLLRRNI 188


>gi|145640429|ref|ZP_01796013.1| thymidylate kinase [Haemophilus influenzae R3021]
 gi|145275015|gb|EDK14877.1| thymidylate kinase [Haemophilus influenzae 22.4-21]
          Length = 137

 Score = 40.0 bits (92), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+ +
Sbjct: 5   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPVLESQVRANMGK------KGDRQ 54

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 55  S-AIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIW 144
           F+Q +A Q + 
Sbjct: 114 FRQQIANQMVM 124


>gi|307294654|ref|ZP_07574496.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingobium
           chlorophenolicum L-1]
 gi|306879128|gb|EFN10346.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingobium
           chlorophenolicum L-1]
          Length = 461

 Score = 39.7 bits (91), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 27/166 (16%)

Query: 46  INGEVITDGDISKRIALLKLQKING------ELEKIAVQ---ELIVETLKKQEIEKSGIT 96
           +NG +IT  D+ +R+AL+     NG      E E++ VQ    LI ETL+ QE   + I 
Sbjct: 75  VNGRIITGTDVDQRLALIL--TANGGKVSDEEKERLRVQVLRNLIDETLQIQEAAANDIK 132

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
            D   ++  + + A N   S   F  +L  QG      K+ +  +  W  +++       
Sbjct: 133 VDKAEIDQSYERVAANFRQSPSQFDQYLRAQGSSSASIKRQIEGELAWSRLLRR------ 186

Query: 157 GNLEMEIPANKQKMKNITVR--------EYLIRTV-LFSIPDNKLQ 193
            N++  +  ++ ++K++  R        EY I  + L + P+N+ Q
Sbjct: 187 -NIQPFVNVSEDEVKSVVDRMNAAKGSDEYRIGEIYLSATPENQQQ 231


>gi|34556608|ref|NP_906423.1| hypothetical protein WS0160 [Wolinella succinogenes DSM 1740]
 gi|34482322|emb|CAE09323.1| conserved hypothetical protein [Wolinella succinogenes]
          Length = 279

 Score = 39.7 bits (91), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
           A++ LI + L + EIE+ GI+ +   VN    + A++ G + E F SFLD++G+    +K
Sbjct: 54  AMEMLIDKMLHQDEIERYGISTNEIEVNQEVERIAKSNGATLEQFRSFLDQKGVNWESYK 113

Query: 136 QYL 138
           + L
Sbjct: 114 EDL 116


>gi|126739402|ref|ZP_01755095.1| PPIC-type PPIASE domain [Roseobacter sp. SK209-2-6]
 gi|126719502|gb|EBA16211.1| PPIC-type PPIASE domain [Roseobacter sp. SK209-2-6]
          Length = 426

 Score = 39.7 bits (91), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T++  VIT+ ++ +R   + L +  G++ + A +ELI + LK   +++ GI  D   +  
Sbjct: 55  TVDSAVITNYELDQRERFMALLRTPGDIAEKAREELIDDRLKLAILDEFGIEVDDEEIKQ 114

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
              + A    LS E+F   L + GI     +    +   W + +   ++ +    E EI
Sbjct: 115 GMTELAGRANLSLEEFLGVLRQNGIAPETVRDLTRVGISWRNFLGARYLSQARPTEEEI 173


>gi|237746912|ref|ZP_04577392.1| chaperone SurA [Oxalobacter formigenes HOxBLS]
 gi|229378263|gb|EEO28354.1| chaperone SurA [Oxalobacter formigenes HOxBLS]
          Length = 468

 Score = 39.7 bits (91), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 76/156 (48%), Gaps = 15/156 (9%)

Query: 47  NGEVITDGDISKRIALL--KLQKIN------GELEKIAVQELIVETLKKQEIEKSGITFD 98
           N +VIT G++++RI ++  +LQK N       EL+K  ++ +IVE+ + Q  ++ G+  D
Sbjct: 59  NNDVITMGELNERIQMIESQLQKQNVNLPPRAELQKQVLEHMIVESAQMQLAKEMGLRID 118

Query: 99  SNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG-DNH---FKQYLAIQSIWPDVVKNDFML 154
              ++    + A +  ++   F  ++++ G   ++H    +  + +Q +    V N   +
Sbjct: 119 DTQLDRTIARIAESKHMTVPQFQQYIERDGTSFESHREKIRSEITMQRLRDREVVNKIQI 178

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
               ++  + A+ Q      VR   +  +L  IP+N
Sbjct: 179 NDAEVDHLLGADSQMQMPEQVR---LGHILIRIPEN 211


>gi|239818232|ref|YP_002947142.1| SurA domain protein [Variovorax paradoxus S110]
 gi|239804809|gb|ACS21876.1| SurA domain protein [Variovorax paradoxus S110]
          Length = 469

 Score = 39.7 bits (91), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 107/251 (42%), Gaps = 19/251 (7%)

Query: 46  INGEVITDGDISKRIALL-----KLQKI-NGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           +N E IT+ ++  R+  L     + +++   EL ++ ++ LI E  + Q  +++GI  D 
Sbjct: 69  VNSEPITNTEVQSRVTRLIRENAEAERVPRAELTRLVLERLISERAQLQLAKENGIKVDE 128

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             ++      AR   +S E+    +  +GI    F+  L  Q +   +   +   K    
Sbjct: 129 VAIDQAEQTVARQNQISVEELRRRVVAEGISQREFRNDLRDQLLLTRLRDREVESKVKIS 188

Query: 160 EMEIPANKQKMKNITVREYLIRTV-----LFSIPDNKLQNQ-GFVQKRIKDAEESRLRLP 213
           + E     +  +N   ++  ++ +     L ++P+N  + Q   +Q+R +   + R R  
Sbjct: 189 DAEADEYLRDQRNAPTKDAALQNINLAHLLVAVPENATEAQVATLQQRAQGLAQ-RARAG 247

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTN----PYVTQKGVEY 269
           +D  KL +  S   D + G A  +  +D +P     ++ +Q+   N    P  +  G   
Sbjct: 248 EDFAKLVQENSDSPDRANGGAVGMRTADRYPSL--FVEATQSTPVNGIAGPIRSGAGFHV 305

Query: 270 IAICDKRDLGG 280
           + +  K  LG 
Sbjct: 306 LKVLAKAQLGA 316


>gi|254511943|ref|ZP_05124010.1| ppic-type ppiase domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221535654|gb|EEE38642.1| ppic-type ppiase domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 417

 Score = 39.7 bits (91), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 64/148 (43%), Gaps = 13/148 (8%)

Query: 27  IVPIVSYKSWAM-----------SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI 75
           I+P+++    AM           S  IR  +N +++T  ++ +R   L+L       E  
Sbjct: 19  ILPVMALALTAMATPQAQGQSLFSPAIR--VNQDIVTWYELEQRQQFLELLGAPNSSEIE 76

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
             + LI + L+KQ + ++GI      V       A    LS+E+F   L+  G+     +
Sbjct: 77  VREALIDDRLRKQVMREAGIEAAPEAVETGIDDIAARGNLSSEEFLQLLNDAGVSRETVR 136

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
            ++A Q  W D +   F+ +    E EI
Sbjct: 137 DFVADQLTWRDYISARFLSQARPSEDEI 164


>gi|149194720|ref|ZP_01871815.1| possible periplasmic protein [Caminibacter mediatlanticus TB-2]
 gi|149135143|gb|EDM23624.1| possible periplasmic protein [Caminibacter mediatlanticus TB-2]
          Length = 271

 Score = 39.7 bits (91), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 79/166 (47%), Gaps = 16/166 (9%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQE 79
           F+LI+  +    ++ +  +  R+   +NGE IT  DI+K    L +        + A+  
Sbjct: 4   FILILIFL----NFVNAKIVDRVVAVVNGEPITSYDITKTFKSLNIS------PREALNI 53

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN---HFKQ 136
           LI + + + EI++ GI  D   +     + A+  G+S  +F ++L ++G  +N   + K+
Sbjct: 54  LIDQKIIENEIKRRGIEVDDFDIENAIEKIAKQNGMSVFEFKNYLKERGEYNNFLKNLKK 113

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK---MKNITVREYL 179
            +  Q ++  +V +   +    L+     NK+K    K I V EY+
Sbjct: 114 DIQKQKLFAQIVNSKLKVSNKELKNFYDQNKEKFTTFKQIEVIEYI 159


>gi|221234696|ref|YP_002517132.1| peptidyl-prolyl cis-trans isomerase [Caulobacter crescentus NA1000]
 gi|220963868|gb|ACL95224.1| peptidyl-prolyl cis-trans isomerase [Caulobacter crescentus NA1000]
          Length = 449

 Score = 39.3 bits (90), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 44/112 (39%), Gaps = 23/112 (20%)

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICD 274
           C  LE  A+K+  +  G       +DL P FQ    K +    ++P  T  G+  IA+C 
Sbjct: 347 CQSLEATAAKVDGLVAGDLGEAEITDLAPAFQEAANKLEVGQISDPIRTDAGLHLIAVCG 406

Query: 275 KRDLGGEIALKAYLSAQNTPT--KIEKH---------EAEYVKKLRSNAIIH 315
           KR  G            N PT  +IE              Y++ LR+ A I 
Sbjct: 407 KRQGGA-----------NAPTHDQIENRLRGQQLALIAKRYLRDLRNQATIE 447


>gi|154253778|ref|YP_001414602.1| SurA domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154157728|gb|ABS64945.1| SurA domain [Parvibaculum lavamentivorans DS-1]
          Length = 443

 Score = 39.3 bits (90), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 5/104 (4%)

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
           L++ +L   PD + Q    V +R ++AEE R R    C+   +  +K    +    + ++
Sbjct: 308 LMQVLLPLTPDAEPQA---VSRRAREAEEFR-RQTNSCDDAARNITKYLSGAASPKRDVI 363

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
              L P+ +  L      NTT P  +++G+E + +C  +   GE
Sbjct: 364 AGQLDPRLRQALSGLKAGNTTAPIRSERGIEMVVVCGHKAAEGE 407


>gi|114328860|ref|YP_746017.1| peptidyl-prolyl cis-trans isomerase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317034|gb|ABI63094.1| peptidyl-prolyl cis-trans isomerase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 468

 Score = 39.3 bits (90), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 47/249 (18%), Positives = 100/249 (40%), Gaps = 15/249 (6%)

Query: 42  IRTTINGEVITDGDISKRIALLKL-------QKINGELEKIAVQELIVETLKKQEIEKSG 94
           I   +NG+VI+ GD+  R  L  +       +++   L    +++L+ E L+ QEI++ G
Sbjct: 72  IVAVVNGDVISKGDVDARRRLFAMSTGLPMSKEVLDRLTPQVLRQLVDEKLRLQEIQRRG 131

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           I    + + +      +  G+  +     L   G+        + +Q  W  V++     
Sbjct: 132 IVITDSDIAHSIQGMEQRNGMQPDALRHKLAADGVSMRTLIDQIRVQLGWTRVLRQQLGE 191

Query: 155 KYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSI--PDNKLQNQGFVQKRIKDAEESRLR 211
           +    + EI   ++ + +   + EY +  +   +  P        F    I+    S   
Sbjct: 192 RVRISDKEIQDEEELLASQKGQTEYRVSEIFIPVDDPSRAQAAHDFADTVIQQL-RSGAP 250

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
            P    +  +  + +    +G   ++  + L PQ  ++LK+      +NP     G+E +
Sbjct: 251 FPVVAAQFSQSQTALEGGDLG---WVQPNQLDPQVVSVLKEMPPGAISNPIDVAGGIEIV 307

Query: 271 AICDKRDLG 279
           A+  KR +G
Sbjct: 308 ALRGKRIIG 316


>gi|16125933|ref|NP_420497.1| peptidyl-prolyl cis-trans isomerase family protein [Caulobacter
           crescentus CB15]
 gi|13423099|gb|AAK23665.1| peptidyl-prolyl cis-trans isomerase family protein [Caulobacter
           crescentus CB15]
          Length = 501

 Score = 39.3 bits (90), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 44/112 (39%), Gaps = 23/112 (20%)

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICD 274
           C  LE  A+K+  +  G       +DL P FQ    K +    ++P  T  G+  IA+C 
Sbjct: 399 CQSLEATAAKVDGLVAGDLGEAEITDLAPAFQEAANKLEVGQISDPIRTDAGLHLIAVCG 458

Query: 275 KRDLGGEIALKAYLSAQNTPT--KIEKH---------EAEYVKKLRSNAIIH 315
           KR  G            N PT  +IE              Y++ LR+ A I 
Sbjct: 459 KRQGGA-----------NAPTHDQIENRLRGQQLALIAKRYLRDLRNQATIE 499


>gi|307825062|ref|ZP_07655283.1| SurA domain protein [Methylobacter tundripaludum SV96]
 gi|307733810|gb|EFO04666.1| SurA domain protein [Methylobacter tundripaludum SV96]
          Length = 434

 Score = 39.3 bits (90), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 42  IRTTINGEVITDGDISKRIALL--KLQKINGE------LEKIAVQELIVETLKKQEIEKS 93
           I   +  +VI + ++ K +A++  ++Q+ N        L K  ++++IV+ L++Q  EK+
Sbjct: 34  IIAVVEEDVILERELQKEVAVIEQRIQQSNAAIPPAYVLRKQVLEKMIVDKLQRQLAEKA 93

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
           GIT     +N      AR   +  E F + L+ QGI    F
Sbjct: 94  GITVSEEMLNSSAADIARRNNMDIEQFRAELEGQGISYQSF 134


>gi|170724097|ref|YP_001751785.1| outer membrane porin [Pseudomonas putida W619]
 gi|169762100|gb|ACA75416.1| outer membrane porin [Pseudomonas putida W619]
          Length = 439

 Score = 39.3 bits (90), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 15/87 (17%)

Query: 85  LKKQEIEKSGITFDSNTV-----------NYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + KQ ++ +G+  DSNT+           + F + H R+TG +  ++  + ++ G+GD  
Sbjct: 258 IDKQYVQAAGLNGDSNTIWSLAATYAYGAHSFTLAHQRSTGSTGYNYGWYQNEGGVGDGG 317

Query: 134 FKQYLAIQSIWPDVVKND---FMLKYG 157
              YLA  S W D    D   + L YG
Sbjct: 318 STIYLA-NSYWSDFNAEDERSWQLGYG 343


>gi|322379755|ref|ZP_08054065.1| chaperone SurA [Helicobacter suis HS5]
 gi|321147826|gb|EFX42416.1| chaperone SurA [Helicobacter suis HS5]
          Length = 371

 Score = 39.3 bits (90), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 53/256 (20%), Positives = 113/256 (44%), Gaps = 28/256 (10%)

Query: 66  QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
           +K+N    + A+  LI++ ++ QEI++  I  + + V+      A++ G++  DF   L 
Sbjct: 137 EKVNHVNRQQAINSLILQRIQAQEIKRLKIDIEDDKVDAEIENIAKHNGMNVSDFMRTLA 196

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL-IRTVL 184
            +GI    +K  L  Q    ++++N  +            N        +REY       
Sbjct: 197 GEGINPVAYKAQLKKQLETRELLRNILLF-----------NANTNSETKMREYYNAHRDE 245

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           F++P + L  + +  K  +   ++          LE   + +  V+ G+ +  +++ L+P
Sbjct: 246 FTVPSDVLATR-YTAKDTQTLTQA----------LEHKDTDVPGVTKGEERISIKA-LNP 293

Query: 245 QFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIAL---KAYLSAQNTPTKIEKH 300
           Q   +   ++ +T  P +   G  Y+A   +  LG  E++    + +++ +    + +K 
Sbjct: 294 QIAQMFLSTKEHTFTPILNAGGGNYVAFYIEEKLGKQEVSFAQARGFIANKLIEEQQDKI 353

Query: 301 EAEYVKKLRSNAIIHY 316
            AEY +KLR  A I +
Sbjct: 354 LAEYYEKLRVKAKIKF 369


>gi|332185309|ref|ZP_08387058.1| PPIC-type PPIASE domain protein [Sphingomonas sp. S17]
 gi|332015033|gb|EGI57089.1| PPIC-type PPIASE domain protein [Sphingomonas sp. S17]
          Length = 475

 Score = 38.9 bits (89), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 105/254 (41%), Gaps = 34/254 (13%)

Query: 46  INGEVITDGDISKRIALL----KLQKINGE----LEKIAVQELIVETLKKQEIEKSGITF 97
           +N  V+T  D+ +R+AL      + K++ E    L    +++LI ETL+ QE + + IT 
Sbjct: 87  VNDTVLTGTDLDQRMALAMALNNVTKLSPEDRDRLRMQILRQLIDETLQIQEAKSAEITV 146

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
            +  ++  + + ++  G +    ++FL + G  +   ++ +  +  W     N ++ K  
Sbjct: 147 TAPEIDQAYARFSQQFGKTPTQMTAFLRQVGSSERSMRRQIEGELAW-----NRYLRK-- 199

Query: 158 NLEMEIPANKQKMKNITVR--------EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
            +E  I    +++  I  R        EY ++ +  S  +   Q Q F   R   AE   
Sbjct: 200 RVEPFINVGDEEVNAIRARLEAAKGTEEYNLKEIFLSA-NEATQQQVFANARQIIAE--- 255

Query: 210 LRLPKDCNKLEKFASKIHDVSI----GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQ 264
             + K     E FA    + S     G   ++  + L P+ Q+  +  Q      P    
Sbjct: 256 --IQKGQQPFEYFARSFSEASTRAVNGDLGWVRAAQLPPELQSAAQSMQVGQVAGPIPIP 313

Query: 265 KGVEYIAICDKRDL 278
            G   + + DKR +
Sbjct: 314 GGFSILYLTDKRQV 327


>gi|261855875|ref|YP_003263158.1| SurA domain protein [Halothiobacillus neapolitanus c2]
 gi|261836344|gb|ACX96111.1| SurA domain protein [Halothiobacillus neapolitanus c2]
          Length = 465

 Score = 38.9 bits (89), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 103/242 (42%), Gaps = 21/242 (8%)

Query: 12  FIKLLTTYFVL-------IIFCIVPIVSYKSWA----MSSRIRTTINGEVITDGDISKRI 60
           F +L   +  L       ++F    I +  + A    M  RI   +N  VIT   ++ RI
Sbjct: 14  FARLTPAWLALAAGLSFGVVFSTPTIAADLTPAAGEQMFDRIVAVVNQSVITQRQLNDRI 73

Query: 61  ----ALLKLQKING----ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
               + + +Q ++     +LE+  +  +I E ++ Q  ++ GIT D   ++      A+ 
Sbjct: 74  QQVSSQINIQALSPSDFKQLEERVLDRMITEEVELQRAKQIGITVDEQRLDSALDGIAQR 133

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN-KQKMK 171
            G+S +     + +QG   N ++  +  Q I  ++ + +   +    + +I    KQ M 
Sbjct: 134 NGMSLDQLQQAVTRQGEDWNAYRDNIRKQIIIDELKRREVYERVDITDRDIDEYLKQYMG 193

Query: 172 NIT-VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS 230
             T   EY +  +L S+P+N   +Q    K+  D   + L+  +D  K+    S   D +
Sbjct: 194 ADTDTTEYHLAQILISVPENATPSQVENAKKRADDVMAALKAGQDFAKVSAERSDAPDAT 253

Query: 231 IG 232
            G
Sbjct: 254 KG 255


>gi|217969876|ref|YP_002355110.1| SurA domain protein [Thauera sp. MZ1T]
 gi|217507203|gb|ACK54214.1| SurA domain protein [Thauera sp. MZ1T]
          Length = 438

 Score = 38.9 bits (89), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 119/281 (42%), Gaps = 36/281 (12%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ------KINGE--LEKIAVQE 79
           +P+ S        RI   +N EVIT  ++  RI   + Q      ++  E  L++  ++ 
Sbjct: 23  LPVHSAPRAVEVDRIVAVVNNEVITGLELRARIEQTRRQLARQGAQLPPEEVLQRQLLER 82

Query: 80  LIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLA 139
           LIVE  + Q   +S +  D  T++    + A N  LS +   + L+K G+  + F+    
Sbjct: 83  LIVERAQLQLARESSLRVDDVTLDRAIERIASNNKLSIDQLRATLEKDGVTWSRFR---- 138

Query: 140 IQSIWPDVVKNDFM---LKYGNLEMEIPANKQKMKNITV--------REYLIRTVLFSIP 188
                 D ++++ +   L+   ++  I     ++ N           +E+ +  +L   P
Sbjct: 139 ------DEIRSEILLTRLREREVDSRIVVTDAEIDNFIANNPDAFSGQEFAVAHILLRTP 192

Query: 189 DNKLQNQGFVQKRIKDAEE--SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ- 245
           +     Q  V+   + AE+  +RLR  +D  ++    S   D   G +      D  P  
Sbjct: 193 EGASPQQ--VEAVARRAEQVMARLRSGEDFARVAAEVSDAPDGLQGGSLGWRPLDRLPAL 250

Query: 246 FQNLLKKSQNNTTNPYV-TQKGVEYIAICDKRDLGGEIALK 285
           F + +++ +   T+P + +  G+  + + D R  GG  A++
Sbjct: 251 FADAVRRMRPGETSPVLRSAAGLHIVRLVDARG-GGAAAVQ 290


>gi|315453271|ref|YP_004073541.1| hypothetical protein HFELIS_08670 [Helicobacter felis ATCC 49179]
 gi|315132323|emb|CBY82951.1| putative periplasmic protein [Helicobacter felis ATCC 49179]
          Length = 346

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 103/246 (41%), Gaps = 28/246 (11%)

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
           AV  LI++ ++ QEI++  I  + + ++      AR+ G+  +DF   L  +GI    +K
Sbjct: 121 AVNALILQRIQAQEIKRLKIDIEDDKIDAEIENIARHNGMDMQDFLRTLASEGINPTTYK 180

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYL-IRTVLFSIPDNKLQN 194
             L  Q    ++++N  +            N        +REY       FS+P   +  
Sbjct: 181 AQLKKQLETRELLRNILLF-----------NTNTNSETKMREYYNAHKSEFSVPSEII-- 227

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ 254
                  I+   +    L K    LE     I  V+ G+ +  +++ L+PQ   +   +Q
Sbjct: 228 ------TIRYTAQDTQALTK---ALENRNLDIPGVTKGEEKINIKT-LNPQIAQMFLSTQ 277

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGE----IALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
            +T  P +   G  +++   K  +G E       K +++ +    + +K  AEY +KLR 
Sbjct: 278 EHTFTPILNAGGGNFVSFYIKEKIGKENVSFSQAKHFIANKLIEEQQDKILAEYYEKLRV 337

Query: 311 NAIIHY 316
            A I +
Sbjct: 338 KAKIKF 343


>gi|148553334|ref|YP_001260916.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas
           wittichii RW1]
 gi|148498524|gb|ABQ66778.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas
           wittichii RW1]
          Length = 446

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 14/115 (12%)

Query: 42  IRTT---INGEVITDGDISKRIALLKLQKING------ELEKIAVQ---ELIVETLKKQE 89
           IRT    +NG +IT  D+ +R+AL+     NG      E E++ +Q    LI ETL+ QE
Sbjct: 53  IRTATAIVNGTIITQTDVEQRLALVI--AANGGNIPDEERERLRLQVLRNLIDETLQIQE 110

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
                +      V   + + A N   S ++F+ FL ++G      K+ +  ++ W
Sbjct: 111 ATAQKVEVSREEVQQTYDRVAANFRKSPKEFAEFLHEKGSSQASIKRQIEGEAAW 165


>gi|295689679|ref|YP_003593372.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Caulobacter segnis
           ATCC 21756]
 gi|295431582|gb|ADG10754.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Caulobacter segnis
           ATCC 21756]
          Length = 452

 Score = 38.5 bits (88), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 42/112 (37%), Gaps = 23/112 (20%)

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICD 274
           C  LE  A K+  +  G       +DL P FQ    K      ++P  T  G+  IA+C 
Sbjct: 350 CQTLETVAGKVDGLVAGDLGEAEITDLAPAFQEAASKLDIGQISDPIRTDAGLHLIAVCG 409

Query: 275 KRDLGGEIALKAYLSAQNTPT--KIEKH---------EAEYVKKLRSNAIIH 315
           KR  G            N PT  +IE              Y++ LR+ A I 
Sbjct: 410 KRQGGA-----------NAPTHDQIENRLRGQQLALISKRYLRDLRNQATIE 450


>gi|89094171|ref|ZP_01167114.1| peptidyl-prolyl cis-trans isomerase SurA [Oceanospirillum sp.
           MED92]
 gi|89081646|gb|EAR60875.1| peptidyl-prolyl cis-trans isomerase SurA [Oceanospirillum sp.
           MED92]
          Length = 430

 Score = 38.1 bits (87), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 72/158 (45%), Gaps = 10/158 (6%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQ------KINGE--LEKIAVQELIVETLKKQEIEK 92
           RI   +N  +I   ++ +R ++ + Q      +I  E  L K  +  LI+E+++KQ  E+
Sbjct: 32  RIAAVVNEGIILQSELEQRTSITREQLQSRNTRIPPEHILRKQVLNRLIIESIQKQMAEQ 91

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN-- 150
           +G+    + +N      A   GLS + F   L  +G   N  ++ +  + +   V +N  
Sbjct: 92  NGVRVSDSQLNGAIANIAAQNGLSIDQFREALIAEGRDYNQAREQIRNEMLINSVQQNLV 151

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIP 188
           +  ++    E+    N +  K+    E+L+  +L + P
Sbjct: 152 NRRIRVSEQELSNFLNSEDGKSQASAEFLLGHILIATP 189


>gi|57239486|ref|YP_180622.1| hypothetical protein Erum7600 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579465|ref|YP_197677.1| hypothetical protein ERWE_CDS_08010 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161565|emb|CAH58493.1| putative membrane protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58418091|emb|CAI27295.1| Hypothetical protein ERWE_CDS_08010 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 425

 Score = 38.1 bits (87), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 68/140 (48%), Gaps = 13/140 (9%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKL-QKINGELEK 74
           T    L+IF       Y S A ++ ++   +NGE+I+  D+ + IA+ K    ++ ++ K
Sbjct: 30  TIGLFLLIFAF-----YCSNAFANVKMVAMVNGELISSLDLERYIAISKFFYHVDSDVAK 84

Query: 75  -IAVQELIVETLKKQEIEKSGITFDS----NTVNYFFVQHARNTGLSAE-DFSSFLDKQG 128
            I +  LI E + KQE EK  +        + VN  FV    N   +   DF S+ ++QG
Sbjct: 85  DIELDSLIDEYIWKQEAEKLKVVVSEQEILDAVNQLFVMKGSNHKENHNNDFKSYTEQQG 144

Query: 129 IGDNHFKQYLAIQSIWPDVV 148
           +  +   Q++  + +W  ++
Sbjct: 145 LDYDMLIQHVKSKLLWNKIL 164


>gi|119383650|ref|YP_914706.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paracoccus
           denitrificans PD1222]
 gi|119373417|gb|ABL69010.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paracoccus
           denitrificans PD1222]
          Length = 423

 Score = 37.7 bits (86), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/105 (20%), Positives = 48/105 (45%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           +N  V+T  ++ +R+  L++ +        A Q LI + L+     + GI      ++  
Sbjct: 35  VNDSVVTRYELDQRMRFLQILRAPDGDRASAEQALIDDRLRLFAARQMGIAASDAQIDAG 94

Query: 106 FVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
             + A    +  E+F+  L + G+    F+ ++A   +W ++V+ 
Sbjct: 95  LAEFAGRANMDVEEFTRALAQAGVEQQTFRDFIAAGVVWRELVRQ 139


>gi|319796618|ref|YP_004158258.1| sura domain [Variovorax paradoxus EPS]
 gi|315599081|gb|ADU40147.1| SurA domain [Variovorax paradoxus EPS]
          Length = 469

 Score = 37.7 bits (86), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 104/247 (42%), Gaps = 13/247 (5%)

Query: 46  INGEVITDGDISKRIALL-----KLQKI-NGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           +N E IT+ D+  R+  L       +++  GEL ++ ++ LIVE  + Q  +++GI  D 
Sbjct: 69  VNSEPITNTDVQSRVTRLIKENPDAERVPRGELTRLVLERLIVERAQLQLAKENGIKVDD 128

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF--MLKYG 157
             ++      AR   +S  +    +  +GI    F++ L  Q +   +   +    +K  
Sbjct: 129 VAIDQAEQTVARQNEISLVELRRRVAAEGIALADFRKDLRDQLLLTRLRDREVESKVKIS 188

Query: 158 NLEMEIPANKQK---MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
           + E +     Q+    KN  ++   +  VL  +P+N    Q    ++       R R  +
Sbjct: 189 DSEADEYLRDQRNSNTKNAALQNLNLAQVLVVLPENATDAQVAAAQKKAQGLAERARAGE 248

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQ-FQNLLKKSQ-NNTTNPYVTQKGVEYIAI 272
           D  KL +  S   D + G A  +  +D +P  F + ++ +  N    P  +  G   + +
Sbjct: 249 DFEKLVRENSDSPDRANGGAIGMRSADRYPPLFVDAVQSTAVNGIAGPVRSSAGFHVLKV 308

Query: 273 CDKRDLG 279
             K  +G
Sbjct: 309 LAKAQIG 315


>gi|283850614|ref|ZP_06367901.1| SurA domain protein [Desulfovibrio sp. FW1012B]
 gi|283573857|gb|EFC21830.1| SurA domain protein [Desulfovibrio sp. FW1012B]
          Length = 330

 Score = 37.7 bits (86), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/136 (19%), Positives = 68/136 (50%), Gaps = 14/136 (10%)

Query: 21  VLIIFCIVPIVSYKSWA--MSSRIRTTINGEVITDGDISKRIALLKLQKING-------- 70
           + ++  ++  ++  +WA  +  ++   +NG++IT  D++ R+A L LQ+  G        
Sbjct: 7   ICLMLVLLVALTTTAWATQLVDKVVAVVNGKLITMFDVNARLADL-LQRTQGVSMRPDDP 65

Query: 71  ---ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
              EL +  ++ +I + L +QE  +  ++     ++    +  +   L+ + F + L+K+
Sbjct: 66  QAAELRRQVLESMINDILIEQEAARLKVSISETELDSQIDEIKKKNNLTQQQFVAELNKE 125

Query: 128 GIGDNHFKQYLAIQSI 143
           G+    F++ + + S+
Sbjct: 126 GMTLKDFRERMRLDSV 141


>gi|94497694|ref|ZP_01304262.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas sp.
           SKA58]
 gi|94422911|gb|EAT07944.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas sp.
           SKA58]
          Length = 462

 Score = 37.7 bits (86), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 11/116 (9%)

Query: 46  INGEVITDGDISKRIALLKLQKING------ELEKIAVQ---ELIVETLKKQEIEKSGIT 96
           +NG +IT  D+ +R+AL+     NG      E E++ VQ    LI ETL+ QE   + I 
Sbjct: 76  VNGRIITGTDVDQRLALII--TANGGKVSDEEKERLRVQVLRNLIDETLQIQEAAANDIK 133

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
                +   + + A N   S  +F ++L  QG      K+ +  +  W  +++ + 
Sbjct: 134 IAPEEIEQSYQRVAANFRKSPTEFDAYLRSQGSSAASIKRQIEGELAWSRLLRRNI 189


>gi|149179628|ref|ZP_01858140.1| peptidyl-prolyl isomerase [Planctomyces maris DSM 8797]
 gi|148841534|gb|EDL55985.1| peptidyl-prolyl isomerase [Planctomyces maris DSM 8797]
          Length = 217

 Score = 37.7 bits (86), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 15/110 (13%)

Query: 46  INGEVITDGDISKRIALL-----------KLQKINGELEKIAVQELIVETLKKQEIEKSG 94
           +NG VIT  D+ +R+ALL           +LQ++  ++    ++ LI ETL+ Q  E   
Sbjct: 61  VNGYVITGTDLDQRLALLVNANQTEIPAEELQRVRAQV----LRNLIDETLQIQAAEAEE 116

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           I      V   F + A       ED  ++L   G      K+ +  +  W
Sbjct: 117 IVISDAEVEQTFARVAAQNNQRPEDMENYLASIGSSSASLKRQIRGELAW 166


>gi|258513569|ref|YP_003189791.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257777274|gb|ACV61168.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 327

 Score = 37.4 bits (85), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 77/168 (45%), Gaps = 22/168 (13%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLK-------LQKINGE--------LEKIAVQELIVE 83
           ++ +  T+NGE IT   + KR++++K        QKI G+        ++   + E+I +
Sbjct: 21  NTNVVATVNGEEITQQQLDKRVSIVKDYYEKQYGQKIEGQDAQKLIDNMKPGLLDEMISD 80

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           TLK+QE  K G       +    +   +    + E F +FL +Q + +      L +Q +
Sbjct: 81  TLKRQEARKVGKDMTDQQIQE-KIDGVKKQFPNEEAFKNFLAQQDLTEKDMAYMLNLQDV 139

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI-PDN 190
              V+K+        ++     NK++ K  T  +Y +R +L S  PD+
Sbjct: 140 ---VLKDVKAPTEEEVQEYYDQNKEQFK--TAEQYEVRHILISTDPDD 182


>gi|121611714|ref|YP_999521.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Verminephrobacter
           eiseniae EF01-2]
 gi|121556354|gb|ABM60503.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Verminephrobacter
           eiseniae EF01-2]
          Length = 482

 Score = 37.4 bits (85), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 51/115 (44%), Gaps = 10/115 (8%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-KINGE-------LEKIAVQELIVE 83
           S   WA    I   +N E +T+ ++  R+   + Q    G        L    ++ LI+E
Sbjct: 69  SATGWA--DFIVAVVNSEPVTNNEVRSRLVRAEAQIARQGASMPSREWLAHEVLERLILE 126

Query: 84  TLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            ++ Q+  +SGI  D   +       AR  G++ E F + L++ GIG   F+  L
Sbjct: 127 RVQLQQARESGIRVDDFALAQAEQGVARQNGMTLEQFYARLERDGIGKERFRAEL 181


>gi|226942107|ref|YP_002797181.1| SurA [Laribacter hongkongensis HLHK9]
 gi|226717034|gb|ACO76172.1| SurA [Laribacter hongkongensis HLHK9]
          Length = 434

 Score = 37.4 bits (85), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 8/158 (5%)

Query: 41  RIRTTINGEVITDGDISKRI----ALLKLQKI----NGELEKIAVQELIVETLKKQEIEK 92
           RI   +N + IT   +  R+    A L  QK+     G L++  ++ +I E ++ Q    
Sbjct: 35  RIVAVVNKQAITQQALDTRVREAEAQLTRQKVPLPPAGVLQQQMLERMINEEVQLQYAGN 94

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
           +GI  DS  ++    + A    L+ E F + L   GI +  F+  L+ Q I   + + + 
Sbjct: 95  NGIALDSAELDRIMDRLAEQNRLTPEQFRARLKADGINEAAFRADLSRQVILDRLREREV 154

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
             K    + E+ A  +   +    E+ +  +L ++P+ 
Sbjct: 155 DSKVNVSDSEVDAVLRSAVSANRTEFRLSHILITLPEQ 192


>gi|254476481|ref|ZP_05089867.1| ppic-type ppiase domain protein [Ruegeria sp. R11]
 gi|214030724|gb|EEB71559.1| ppic-type ppiase domain protein [Ruegeria sp. R11]
          Length = 421

 Score = 37.4 bits (85), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 56/119 (47%)

Query: 45  TINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNY 104
           T+N  V+T+ ++ +R   L L +  G+  + A ++LI + LK + + ++GI      V  
Sbjct: 50  TVNDSVVTNYELQQRARFLALLREPGDPLEKAREDLIEDRLKLEVLAQAGIDPTDEEVTA 109

Query: 105 FFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
              + A    LS ++F + L + G+     + +  +   W   V + ++ +    E EI
Sbjct: 110 GMTELAGRANLSLQEFLNVLRENGVDPQTLRDFSRVGIAWRGYVGSRYIGQARPSEEEI 168


>gi|303256196|ref|ZP_07342212.1| peptidyl-prolyl cis-trans isomerase SurA [Burkholderiales bacterium
           1_1_47]
 gi|331001252|ref|ZP_08324878.1| SurA protein [Parasutterella excrementihominis YIT 11859]
 gi|302860925|gb|EFL84000.1| peptidyl-prolyl cis-trans isomerase SurA [Burkholderiales bacterium
           1_1_47]
 gi|329568979|gb|EGG50775.1| SurA protein [Parasutterella excrementihominis YIT 11859]
          Length = 453

 Score = 37.4 bits (85), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 67/159 (42%), Gaps = 9/159 (5%)

Query: 41  RIRTTINGEVITDGDISKRI--ALLKLQKINGELEKI------AVQELIVETLKKQEIEK 92
           RI   +N +VIT+  + +RI      L++ N  L  +       +  +I+E + +Q+   
Sbjct: 49  RIAAVVNHDVITEIQLQQRIHQVATNLRRRNIPLPPMDNLRDQTLDRMILERIIEQKARD 108

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
           +GI  D N +N    Q A N GL+       L   GI    FK  +  + +   + + D 
Sbjct: 109 TGIRIDDNMLNGAIEQIATNNGLTVPQLEKKLAADGISVPSFKSEIRSELLTQRLRERDV 168

Query: 153 MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSIPDN 190
             K    E EI    +       R EY +  ++ S P+N
Sbjct: 169 DDKIQIPESEIDQYLKDQSGPGKRMEYRLSRIVISFPEN 207


>gi|149186120|ref|ZP_01864434.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Erythrobacter sp.
           SD-21]
 gi|148830151|gb|EDL48588.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Erythrobacter sp.
           SD-21]
          Length = 448

 Score = 37.0 bits (84), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 15/112 (13%)

Query: 44  TTINGEVITDGDISKRIALL-----------KLQKINGELEKIAVQELIVETLKKQEIEK 92
             +NG VIT  D+ +R+ALL           +LQ++  ++    ++ LI ETL+ Q  E 
Sbjct: 59  AVVNGYVITGTDLDQRLALLVNANQTEIPAEELQRVRAQV----LRNLIDETLQIQAAEA 114

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
             I      V   F + A       ED  ++L   G      K+ +  +  W
Sbjct: 115 EEIVISDAEVEQTFARVAAQNNQRPEDMENYLASIGSSSASLKRQIRGELAW 166


>gi|85710398|ref|ZP_01041462.1| peptidyl-prolyl isomerase [Erythrobacter sp. NAP1]
 gi|85687576|gb|EAQ27581.1| peptidyl-prolyl isomerase [Erythrobacter sp. NAP1]
          Length = 448

 Score = 37.0 bits (84), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 33  YKSWAMSSRIRTTI-NGEVITDGDISKRIALL----KLQKINGELEKIAVQ---ELIVET 84
           Y S   + R  T + NG VIT  DI +R+AL+    +++  + E +++ VQ    LI ET
Sbjct: 47  YGSENPNERAPTAVVNGFVITGTDIDQRVALVTNASEVEVSDAERQRLRVQVLRNLIDET 106

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQ-HARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           LK Q      I  +   V   + Q  A+N G + E    +L   G      K+ +  +  
Sbjct: 107 LKIQAARAQEIGVERAEVEQTYQQLAAQNFGQNPERMDEYLASIGSSPAALKRQIEGEIA 166

Query: 144 WPDVVKNDF 152
           W ++++ + 
Sbjct: 167 WENLIRRNI 175


>gi|296532230|ref|ZP_06894978.1| peptidyl-prolyl cis-trans isomerase [Roseomonas cervicalis ATCC
           49957]
 gi|296267447|gb|EFH13324.1| peptidyl-prolyl cis-trans isomerase [Roseomonas cervicalis ATCC
           49957]
          Length = 401

 Score = 36.6 bits (83), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 99/258 (38%), Gaps = 25/258 (9%)

Query: 42  IRTTINGEVITDGDISKRIALLKLQKINGELEKIA------VQELIV-ETLKKQEIEKSG 94
           I   +NG+V+T G+++ R  L  L    G    +       V  L+V E L+ QE+++ G
Sbjct: 10  IVAVVNGDVVTAGEVAGRARLFALNAGMGPAPDVVQRLRPQVTRLLVDERLRMQEVQRRG 69

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF-- 152
           I      V     +     GL        L   GI        +  Q  W  +V+     
Sbjct: 70  IPVPDEDVAEAVQEIESRNGLPRGGLVGQLRAAGIPPRALFDQIRNQIGWSRLVRAQLGQ 129

Query: 153 --MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
              +    +   + A+K +       EYL+  +   + D   + +  V++ ++D    +L
Sbjct: 130 QAQISPAEVAEFVAAHKARTGQP---EYLVSEIFIPVDDPGAEPE--VRRFVEDV-VGQL 183

Query: 211 R----LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQK 265
           R     P    +  +  + +    +G   ++   +  P   ++L++       NP     
Sbjct: 184 RRGVPFPAAATQFSQSQTALQGGDMG---WVRGEEFDPGVASILERMPPGAIANPQRVPG 240

Query: 266 GVEYIAICDKRDLGGEIA 283
           G + +A+  KR+ G ++A
Sbjct: 241 GFQIVALRQKRETGRDLA 258


>gi|299531915|ref|ZP_07045315.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni S44]
 gi|298720090|gb|EFI61047.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni S44]
          Length = 475

 Score = 36.6 bits (83), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 8/118 (6%)

Query: 42  IRTTINGEVITDGDISKRIALL--KLQKING------ELEKIAVQELIVETLKKQEIEKS 93
           I   +N E IT+ ++  R+  +   + +  G      EL +  ++ LIVE ++ QE + +
Sbjct: 72  IVAVVNSEPITNNEVRARMERVAQNVTEQGGQLPSQSELARQVLERLIVERVQLQEAKDT 131

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           GI  D+ TV+      AR          S L  +GI +  F+  +  Q +   V + D
Sbjct: 132 GINIDNMTVDQAVANVARQNNTDKAGLVSRLKAEGISEAQFRSEIRNQMLMQRVRERD 189


>gi|219870954|ref|YP_002475329.1| peptidyl-prolyl cis-trans isomerase SurA [Haemophilus parasuis
           SH0165]
 gi|219691158|gb|ACL32381.1| peptidyl-prolyl cis-trans isomerase SurA [Haemophilus parasuis
           SH0165]
          Length = 312

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 124/312 (39%), Gaps = 37/312 (11%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQ 88
            + ++ S     R+  T++G  I    + + +     +K N E  + A  E I++    Q
Sbjct: 15  ALFAFSSANAEERVVATVDGYPIMQSQVKQALG----KKANTEANRKAALETIIDDFVVQ 70

Query: 89  E-IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
             I++SGI  D   V+      A   G++       LD QGI  + ++Q LA Q +   V
Sbjct: 71  RAIKESGIKVDYAYVDQMMEDVAAQNGITYGQLLDALDYQGISLSQYRQQLAHQLLMEQV 130

Query: 148 ----VKNDFMLKYGNLE------MEIPANKQKMKNITVREYLIRTVLFSIPD--NKLQNQ 195
               + N   +   +++      ++       ++ ++  EY I  +L       N +Q +
Sbjct: 131 RQQSIGNSIQVDPKDVQSLAKDMLDKAKTNGTLETVSATEYRISHILIKTTPILNDMQAK 190

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI------GKAQYLLESDLHPQFQNL 249
             +     D +  ++   +        A+KI+ V        G   +         F N+
Sbjct: 191 AKLLSITADIKSGKITFEE--------AAKINSVDYISGIDGGDLGFNFLDAYDSTFANI 242

Query: 250 LKKSQNNT-TNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYV 305
             KS+ +  ++P+ +Q G   + + D R   G+    AYL     Q    +++    +++
Sbjct: 243 ASKSKIDVISSPFKSQFGWHILKVTDTRR--GDRTEDAYLQKAYEQLIDKQVQVASKDWI 300

Query: 306 KKLRSNAIIHYY 317
           K LRS   I Y+
Sbjct: 301 KVLRSKLDIKYF 312


>gi|104779703|ref|YP_606201.1| peptidyl-prolyl cis-trans isomerase A [Pseudomonas entomophila L48]
 gi|95108690|emb|CAK13384.1| putative peptidyl-prolyl cis-trans isomerase A [Pseudomonas
           entomophila L48]
          Length = 439

 Score = 36.6 bits (83), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 92/219 (42%), Gaps = 12/219 (5%)

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G LE+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S E F + L   G+
Sbjct: 69  GALEQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNGMSLEQFRAALAHDGL 128

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRTVLFSI 187
             +  ++ +  + I   V +     +    E E+    N    K     EY +  +L   
Sbjct: 129 SYDDAREQIKREMIISRVRQRRVAERIQVSEQEVKNFLNSDLGKMQLSEEYRLANILIPT 188

Query: 188 PDNKLQNQGFVQKRIKDAEE--SRLRLPKDCNKL--EKFASKIHDVSIGKAQYLLESDLH 243
           P++   N   +Q   + A +   +L+   D  +L   + AS+ + +  G+  +     L 
Sbjct: 189 PESA--NSDAIQAAARQAGDVYQQLKQGADFARLAIARSASE-NALEGGEMGWRKAGQLP 245

Query: 244 PQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           P F  +L   +  + T P     G   + + +KR  GGE
Sbjct: 246 PDFAKMLSSMATGDVTQPIRIPNGFIILKLEEKR--GGE 282


>gi|264680840|ref|YP_003280750.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni CNB-2]
 gi|262211356|gb|ACY35454.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Comamonas
           testosteroni CNB-2]
          Length = 475

 Score = 36.6 bits (83), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 8/118 (6%)

Query: 42  IRTTINGEVITDGDISKRIALL--KLQKING------ELEKIAVQELIVETLKKQEIEKS 93
           I   +N E IT+ ++  R+  +   + +  G      EL +  ++ LIVE ++ QE + +
Sbjct: 72  IVAVVNSEPITNNEVRARMERVAQNVTEQGGQLPSQSELARQVLERLIVERVQLQEAKDT 131

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           GI  D+ TV+      AR          S L  +GI +  F+  +  Q +   V + D
Sbjct: 132 GINIDNMTVDQAVANVARQNNTDKAGLVSRLKAEGISEAQFRSEIRNQMLMQRVRERD 189


>gi|224373789|ref|YP_002608161.1| putative periplasmic protein [Nautilia profundicola AmH]
 gi|223588950|gb|ACM92686.1| putative periplasmic protein [Nautilia profundicola AmH]
          Length = 270

 Score = 36.6 bits (83), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           I+F +  I+S  S  +  +I  T+N   IT  ++ K  + LK+ K        A+Q L+ 
Sbjct: 4   ILFVLSLIISLHSEVID-KIIATVNNIPITSYEVDKLASSLKISKDK------ALQYLLD 56

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           + L + EI+K GI  D   +     + A+  GLS  +F + L ++G
Sbjct: 57  QKLIQSEIQKRGIDVDDFEIENAMEKIAKQNGLSLFEFKNILMQKG 102


>gi|221069847|ref|ZP_03545952.1| SurA domain protein [Comamonas testosteroni KF-1]
 gi|220714870|gb|EED70238.1| SurA domain protein [Comamonas testosteroni KF-1]
          Length = 475

 Score = 36.6 bits (83), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 42  IRTTINGEVITDGDISKRIALLK--LQKING------ELEKIAVQELIVETLKKQEIEKS 93
           I   +N E IT+ ++  R+A +   + +  G      EL +  ++ LIVE ++ QE   +
Sbjct: 72  IVAVVNSEPITNNEVRARMARVAQNVTEQGGQLPSQSELARQVLERLIVERVQLQEARDT 131

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           GI  D+  V+      AR          S L  +GI +  F+  +  Q +   V + D
Sbjct: 132 GINVDNLAVDQAVANVARQNSTDRAGLVSRLKAEGISEAQFRAEIRSQMLMQRVRERD 189


>gi|99035882|ref|ZP_01314934.1| hypothetical protein Wendoof_01000229 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 413

 Score = 36.6 bits (83), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 92/211 (43%), Gaps = 21/211 (9%)

Query: 37  AMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEKIAV-QELIVETLKKQEIE 91
           A    I   +NGE I++ DI KRI    +L   Q +N +  K  V +ELI E +   E +
Sbjct: 50  ATEIEIVADVNGEPISNLDIEKRINFINSLFGTQSVNQKEAKPQVLRELIDEIIIINEAQ 109

Query: 92  KSGITFDS----NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           +  I   +    N +  F  Q  +   L A +   +++K  I     ++ +  Q +W  +
Sbjct: 110 RLNIKLSNEELDNAIMLFLTQSFK---LKANEVDQYIEKHNIDLGILRKQIKCQLLWSKI 166

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN-----QGFVQK-R 201
           ++   +      + E+   K++ +     +YLI    F IPD K ++     +  V+K R
Sbjct: 167 IEVRIVPFINISDKEVDDVKRQTEK---PDYLITFQEFIIPDQKDKDVYGIAEDLVKKLR 223

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
             D  ES +++ K    L +   K+  V  G
Sbjct: 224 NSDNPESPIKMRKATVNLSQLKGKLKSVLEG 254


>gi|77165200|ref|YP_343725.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosococcus oceani
           ATCC 19707]
 gi|254434050|ref|ZP_05047558.1| SurA N-terminal domain family [Nitrosococcus oceani AFC27]
 gi|122070652|sp|Q3JAF1|SURA_NITOC RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|76883514|gb|ABA58195.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosococcus oceani
           ATCC 19707]
 gi|207090383|gb|EDZ67654.1| SurA N-terminal domain family [Nitrosococcus oceani AFC27]
          Length = 426

 Score = 36.6 bits (83), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 61/123 (49%), Gaps = 13/123 (10%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-KINGE- 71
           ++L T FVL      PI S+ +  +  RI   +N +++ + ++ + +  ++ Q    G  
Sbjct: 3   RVLVTIFVLFW----PIGSFAAINLD-RIVAVVNEDIVLESELEQMVRTVQDQLAAQGTS 57

Query: 72  ------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
                 LE+  ++ L++E L+ Q   ++GI     T+N    + A++ GL+   F + L+
Sbjct: 58  LPPGYVLERQVLERLVMEQLQLQLAARTGIQVGDETLNEALGRIAQDNGLTLSQFRNVLE 117

Query: 126 KQG 128
           + G
Sbjct: 118 QDG 120


>gi|167854677|ref|ZP_02477457.1| bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
           adenyltransferase [Haemophilus parasuis 29755]
 gi|167854214|gb|EDS25448.1| bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
           adenyltransferase [Haemophilus parasuis 29755]
          Length = 312

 Score = 36.6 bits (83), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 66/316 (20%), Positives = 122/316 (38%), Gaps = 45/316 (14%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQ 88
            + ++ S     R+  T++G  I    + + +     +K N E  + A  E I++    Q
Sbjct: 15  ALFAFSSANAEERVVATVDGYPIMQSQVKQALG----KKANTEANRKAALETIIDDFVVQ 70

Query: 89  E-IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
             I++SGI  D   V+      A   G++       LD QGI  + ++Q LA Q +   V
Sbjct: 71  RAIKESGIKVDYAYVDQMMEDVAAQNGITYGQLLDALDYQGISLSQYRQQLAHQLLMEQV 130

Query: 148 VKNDFMLKYGNLEMEIPANKQK--------------MKNITVREYLIRTVLFSIPD--NK 191
            +       GN     P + Q               ++ ++  EY I  +L       N 
Sbjct: 131 RQQSI----GNSIQVDPKDVQSLAKDMLDKAKINGTLETVSATEYRISHILIKTTPILND 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI------GKAQYLLESDLHPQ 245
           +Q +  +     D +  ++   +        A+KI+ V        G   +         
Sbjct: 187 MQAKAKLLSITADIKSGKITFEE--------AAKINSVDYISGIDGGDLGFNFLDAYDST 238

Query: 246 FQNLLKKSQNNT-TNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHE 301
           F N+  KS+ +  ++P+ +Q G   + + D R   G+    AYL     Q    +++   
Sbjct: 239 FANIASKSKIDVISSPFKSQFGWHILKVTDTRR--GDRTEDAYLQRAYEQLIDKQVQVAS 296

Query: 302 AEYVKKLRSNAIIHYY 317
            +++K LRS   I Y+
Sbjct: 297 KDWIKVLRSKLDIKYF 312


>gi|254362982|ref|ZP_04979046.1| peptidylprolyl isomerase [Mannheimia haemolytica PHL213]
 gi|153094638|gb|EDN75442.1| peptidylprolyl isomerase [Mannheimia haemolytica PHL213]
          Length = 314

 Score = 36.6 bits (83), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 134/327 (40%), Gaps = 39/327 (11%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL+ + F + +  +   ++  + A   R+   +N   I    + +   +L  +K     
Sbjct: 1   MKLVKSLFAVAVATMS--LTQTAHAFEERVVALVNDTPIMQSQVQR---VLGKKKATETA 55

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++ A+ ++I + L +Q ++++G+      VN      A   G++       LD QGI   
Sbjct: 56  QRAAIDQVIDDMLVQQAMKEAGVKVSPAAVNQAVENVAIQNGITYGQLLDALDYQGITLE 115

Query: 133 HFK----QYLAIQSIWPDVVKNDFML---KYGNLEMEIPANKQ---KMKNITVREYLIRT 182
            FK    Q +A++ +    +     +   +   L  E+ A  +   K+K ++ +E+ I  
Sbjct: 116 QFKRNIAQQMAMEQVRHISISKSIQVAPQQVQALAKELMAKDKAAGKLKTVSGKEHRISH 175

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +L     N + N    + ++     S L    +  K+  + A+K H  S+  A      D
Sbjct: 176 ILLKT--NPILNDAQAKAKL-----SSLTTDINSGKISFEEAAKTH--SVDYASGADGGD 226

Query: 242 L--------HPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS--- 289
           L         P F N+  K   N  + P+ +Q G   + + D R+  G+    AY     
Sbjct: 227 LGFNFLEIYDPAFANVASKIKPNQISAPFKSQFGWHILKVTDTRN--GDRTEDAYHQRAY 284

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            Q    + E+   ++VK LR  A I Y
Sbjct: 285 QQLVNKQAEEASKDWVKALRKTANIQY 311


>gi|37678664|ref|NP_933273.1| parvulin-like peptidyl-prolyl isomerase [Vibrio vulnificus YJ016]
 gi|37197404|dbj|BAC93244.1| parvulin-like peptidyl-prolyl isomerase [Vibrio vulnificus YJ016]
          Length = 443

 Score = 36.6 bits (83), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    F++
Sbjct: 85  VDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYEEFRE 144

Query: 137 YL 138
            +
Sbjct: 145 QI 146


>gi|121956507|sp|Q7MP84|SURA_VIBVY RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score = 36.2 bits (82), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    F++
Sbjct: 70  VDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYEEFRE 129

Query: 137 YL 138
            +
Sbjct: 130 QI 131


>gi|237803361|ref|ZP_04590946.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025342|gb|EGI05398.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 440

 Score = 36.2 bits (82), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 100/243 (41%), Gaps = 17/243 (6%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L+K  +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  
Sbjct: 71  LQKQVLDRLILENLQLQMGERSGIRVSDDELNQAIASIAQRNNMSVEQFRAALIHDGVSY 130

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSIP 188
           +  ++ +  + I   V +     +    E E+    A+ Q    ++  E+ +  +L + P
Sbjct: 131 DDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLS-EEFHLANILIATP 189

Query: 189 DNK----LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD-VSIGKAQYLLESDLH 243
           D+     +Q      K I D    + +   D  KL    S   + +  G   +   + L 
Sbjct: 190 DSASSDVIQAAALKAKSIYD----QAKKGADFAKLAATTSSSENALEGGDMGWRKAAQLP 245

Query: 244 PQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN---TPTKIEK 299
           P F ++L      + T P  T  G   + + +KR   G+  ++  +  ++    P++I  
Sbjct: 246 PPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHILIKPSEIRS 305

Query: 300 HEA 302
            EA
Sbjct: 306 EEA 308


>gi|122070641|sp|Q145L3|SURA_BURXL RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 450

 Score = 36.2 bits (82), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 104/250 (41%), Gaps = 16/250 (6%)

Query: 42  IRTTINGEVITDGDISKRIALL--KLQKING------ELEKIAVQELIVETLKKQEIEKS 93
           I   +N  VIT  ++ +R+ L+  +L + N       +L +  + ++++E ++ Q+ ++ 
Sbjct: 41  IAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMDQLRQQVLNQMVLERIQLQKAKED 100

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF----KQYLAIQSIWPDVVK 149
           GIT D  TV     + A    L+ + + S ++ QG+    F    +  L +  +    V 
Sbjct: 101 GITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVPWTTFTSDARTELTLSRLREKEVD 160

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
           +   +    +   I + +     +T   +L + +    P N  +      +R   A  + 
Sbjct: 161 SKVTVSDAEVANYIASQRGPNAGLTSDLHL-QHIFLKAPLNASETDIEAAQRKAQALLAE 219

Query: 210 LRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKSQNNTTNPYV--TQKG 266
            +   +  KL K  S+  D S  G   ++  S L P+F       +    NP +  T  G
Sbjct: 220 AKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEFVKAASALRPGEVNPDLIRTSDG 279

Query: 267 VEYIAICDKR 276
            E + + D+R
Sbjct: 280 FEIVRLVDRR 289


>gi|261493819|ref|ZP_05990333.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495044|ref|ZP_05991511.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309286|gb|EEY10522.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310522|gb|EEY11711.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 314

 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 134/327 (40%), Gaps = 39/327 (11%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL+ + F + +  +   ++  + A   R+   +N   I    + +   +L  +K     
Sbjct: 1   MKLVKSLFAVAVATMS--LTQTAHAFEERVVALVNDTPIMQSQVQR---VLGKKKATETA 55

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++ A+ ++I + L +Q ++++G+      VN      A   G++       LD QGI   
Sbjct: 56  QRAAIDQVIDDMLVQQAMKEAGVKVSPAAVNQAVENVAIQNGITYGQLLDALDYQGITLE 115

Query: 133 HFK----QYLAIQSIWPDVVKNDFML---KYGNLEMEIPANKQ---KMKNITVREYLIRT 182
            FK    Q +A++ +    +     +   +   L  E+ A  +   K+K ++ +E+ I  
Sbjct: 116 QFKRNIAQQMAMEQVRHISISKSIQVAPQQVQALAKELMAKDKAAGKLKTVSGKEHRISH 175

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +L     N + N    + ++     S L    +  K+  + A+K H  S+  A      D
Sbjct: 176 ILLKT--NPILNDAQAKAKL-----SSLTADINSGKISFEEAAKAH--SVDYASGTDGGD 226

Query: 242 L--------HPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS--- 289
           L         P F N+  K   N  + P+ +Q G   + + D R+  G+    AY     
Sbjct: 227 LGFNFLEIYDPAFANVASKIKPNQISAPFKSQFGWHILKVTDTRN--GDRTEDAYHQRAY 284

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            Q    + E+   ++VK LR  A I Y
Sbjct: 285 QQLVNKQAEEASKDWVKALRKTANIQY 311


>gi|91781822|ref|YP_557028.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           xenovorans LB400]
 gi|91685776|gb|ABE28976.1| Putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           xenovorans LB400]
          Length = 453

 Score = 36.2 bits (82), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 104/250 (41%), Gaps = 16/250 (6%)

Query: 42  IRTTINGEVITDGDISKRIALL--KLQKING------ELEKIAVQELIVETLKKQEIEKS 93
           I   +N  VIT  ++ +R+ L+  +L + N       +L +  + ++++E ++ Q+ ++ 
Sbjct: 44  IAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMDQLRQQVLNQMVLERIQLQKAKED 103

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF----KQYLAIQSIWPDVVK 149
           GIT D  TV     + A    L+ + + S ++ QG+    F    +  L +  +    V 
Sbjct: 104 GITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVPWTTFTSDARTELTLSRLREKEVD 163

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
           +   +    +   I + +     +T   +L + +    P N  +      +R   A  + 
Sbjct: 164 SKVTVSDAEVANYIASQRGPNAGLTSDLHL-QHIFLKAPLNASETDIEAAQRKAQALLAE 222

Query: 210 LRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKSQNNTTNPYV--TQKG 266
            +   +  KL K  S+  D S  G   ++  S L P+F       +    NP +  T  G
Sbjct: 223 AKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEFVKAASALRPGEVNPDLIRTSDG 282

Query: 267 VEYIAICDKR 276
            E + + D+R
Sbjct: 283 FEIVRLVDRR 292


>gi|291279787|ref|YP_003496622.1| hypothetical protein DEFDS_1405 [Deferribacter desulfuricans SSM1]
 gi|290754489|dbj|BAI80866.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 512

 Score = 36.2 bits (82), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI---AVQELIVET 84
           V +  Y++ A + R++ ++    I DG  SK+    KL + N   +KI   A  E+IVE 
Sbjct: 397 VSLKVYENLAENVRLKNSVCRSAIIDGSFSKKEYFDKLDEKNINYKKILFTAPDEIIVER 456

Query: 85  LKKQEIEKS 93
           LKK+E +KS
Sbjct: 457 LKKRESKKS 465


>gi|42521061|ref|NP_966976.1| hypothetical protein WD1266 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410802|gb|AAS14910.1| hypothetical protein WD_1266 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 399

 Score = 36.2 bits (82), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 92/211 (43%), Gaps = 21/211 (9%)

Query: 37  AMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGELEKIAV-QELIVETLKKQEIE 91
           A    I   +NGE I++ DI KRI    +L   Q +N +  K  V +ELI E +   E +
Sbjct: 36  ATEIEIVADVNGEPISNLDIEKRINFINSLFGTQSVNQKEAKPQVLRELIDEIIIINEAQ 95

Query: 92  KSGITFDS----NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           +  I   +    N +  F  Q  +   L A +   +++K  I     ++ +  Q +W  +
Sbjct: 96  RLNIKLSNEELDNAIMLFLTQSFK---LKANEVDQYIEKHNIDLGILRKQIKCQLLWGKI 152

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN-----QGFVQK-R 201
           ++   +      + E+   K++ +     +YLI    F IPD K ++     +  V+K R
Sbjct: 153 IEVRIVPFINISDKEVDDVKRQTEK---PDYLITFQEFIIPDQKDKDVYGIAEDLVKKLR 209

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
             D  ES +++ K    L +   K+  V  G
Sbjct: 210 NSDNPESPIKMRKATVNLSQLKGKLKSVLEG 240


>gi|292490958|ref|YP_003526397.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosococcus
           halophilus Nc4]
 gi|291579553|gb|ADE14010.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosococcus
           halophilus Nc4]
          Length = 250

 Score = 35.8 bits (81), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 46  INGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYF 105
           I+ EVIT        A LK  K+ G  E++ ++E++ + LK    ++ G++  ++ +   
Sbjct: 7   IDDEVITAD------AFLKTLKLTGRFEEL-IEEMVRDKLKVHAAKRQGVSLTTDEIQER 59

Query: 106 FVQHARNTGLS-AEDFSSFLDKQGIGDNHFKQYL 138
             Q  R  GL  A+D + FLD  G+  + F+ ++
Sbjct: 60  ADQFRRVYGLHRAKDMNQFLDAIGVSLDDFENFI 93


>gi|326423746|ref|NP_759646.2| survival protein SurA [Vibrio vulnificus CMCP6]
 gi|121956501|sp|Q8DED4|SURA_VIBVU RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|319999108|gb|AAO09173.2| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Vibrio vulnificus CMCP6]
          Length = 428

 Score = 35.8 bits (81), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    F++
Sbjct: 70  VDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYAEFRE 129

Query: 137 YL 138
            +
Sbjct: 130 QI 131


>gi|320157503|ref|YP_004189882.1| survival protein SurA (Peptidyl-prolyl cis-trans isomerase SurA)
           [Vibrio vulnificus MO6-24/O]
 gi|319932815|gb|ADV87679.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Vibrio vulnificus MO6-24/O]
          Length = 432

 Score = 35.8 bits (81), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%)

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    F++
Sbjct: 74  VDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYAEFRE 133

Query: 137 YL 138
            +
Sbjct: 134 QI 135


>gi|260767121|ref|ZP_05876066.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio furnissii CIP
           102972]
 gi|260617876|gb|EEX43050.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio furnissii CIP
           102972]
 gi|315181264|gb|ADT88178.1| survival protein SurA [Vibrio furnissii NCTC 11218]
          Length = 431

 Score = 35.8 bits (81), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 15/132 (11%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE------ 71
           T   L+    + +V  +   M  R+   +N  VI   DI    ALL + K N +      
Sbjct: 7   TLLTLLGLMSIGLVQAQPVEMD-RVAVIVNNGVILQSDID--TALLSV-KANAKKNNRAL 62

Query: 72  -----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L +  V++LI++TL++QE E+ G+  D N +N      A+    +AE     +  
Sbjct: 63  PDEAVLREQVVEKLIIDTLQQQEAERIGVRIDDNRLNEAINDIAKENHQTAEQLRVSVAA 122

Query: 127 QGIGDNHFKQYL 138
           +G+    F++ +
Sbjct: 123 EGLTYPEFREQI 134


>gi|165975861|ref|YP_001651454.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|165875962|gb|ABY69010.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 316

 Score = 35.8 bits (81), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 62/130 (47%), Gaps = 5/130 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + + +     +K N E 
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQRALG----KKANSEA 56

Query: 73  -EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             K A++++I + L ++ ++++GI  +   V+      A   G++       LD QGI  
Sbjct: 57  NHKAALEQIIDDLLVQKAVKEAGIKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITL 116

Query: 132 NHFKQYLAIQ 141
             ++Q +A Q
Sbjct: 117 EQYRQQIAQQ 126


>gi|262172454|ref|ZP_06040132.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio mimicus MB-451]
 gi|261893530|gb|EEY39516.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio mimicus MB-451]
          Length = 431

 Score = 35.8 bits (81), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 61/134 (45%), Gaps = 8/134 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL------Q 66
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K       Q
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPQQLDSVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 67  KINGE--LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
            +  E  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYL 138
            ++G+    F++ +
Sbjct: 121 AQEGLTYPEFREQV 134


>gi|85374605|ref|YP_458667.1| peptidyl-prolyl isomerase [Erythrobacter litoralis HTCC2594]
 gi|84787688|gb|ABC63870.1| peptidyl-prolyl isomerase [Erythrobacter litoralis HTCC2594]
          Length = 473

 Score = 35.8 bits (81), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 46  INGEVITDGDISKRIALLKLQKINGEL---EKIAV-----QELIVETLKKQEIEKSGITF 97
           +NG VIT  DI  R AL+ +    GEL   E + V     + LI ETL+ QE     I  
Sbjct: 86  VNGSVITGTDIDHRTALV-VASAQGELAEEEMVRVRMQVLRNLIDETLQVQEAAAQEINI 144

Query: 98  DSNTVNYFFVQ-HARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            ++ VN  + Q  A+N G   +   ++L   G      K+ +  +  W  +++ + 
Sbjct: 145 TADEVNQRYAQLAAQNFGNQPDAMDAYLLSIGSSPASLKRQIQGELAWQRLLRRNI 200


Searching..................................................done


Results from round 2




>gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040073|gb|ACT56869.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 317

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 317/317 (100%), Positives = 317/317 (100%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60
           MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI
Sbjct: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI 60

Query: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
           ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF
Sbjct: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
           SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI
Sbjct: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES
Sbjct: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240

Query: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH 300
           DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH
Sbjct: 241 DLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKH 300

Query: 301 EAEYVKKLRSNAIIHYY 317
           EAEYVKKLRSNAIIHYY
Sbjct: 301 EAEYVKKLRSNAIIHYY 317


>gi|319408317|emb|CBI81970.1| conserved exported hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 308

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 79/305 (25%), Positives = 140/305 (45%), Gaps = 11/305 (3%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL 80
           +L +          S    + +  T+NG  IT+ DI +RIA LKLQ+  G+L   A  EL
Sbjct: 1   MLGVSSFTGAFFISSVFAQTTVAITVNGNPITNYDIQRRIAFLKLQQKQGDLSAQARNEL 60

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I E LK  EI++  I    N +N  F   A    ++ +  S  L++  + + HFK Y++ 
Sbjct: 61  IDEMLKNIEIQRLNIDVSDNEINSAFANFAEQNNMTVDQLSEMLNQTEVTEEHFKAYISG 120

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
           Q  W  +V   +  + G L  +  A+   K      +  EY ++ ++F IP ++      
Sbjct: 121 QMGWGRLVNARYQSEDGYLSEQEAAHRILKNGGIKPSTNEYTLQQIIFVIPAHR--RAEL 178

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NN 256
           + KR ++    R    + C+  +K    I DV++      LE  L   ++  ++ +    
Sbjct: 179 LTKRTQEINNFRAHF-RGCDNTKKQTRGILDVTVRNLGKFLEPQLPTDWEQAIRATPAGK 237

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT----PTKIEKHEAEYVKKLRSNA 312
            T P+ T  G+E +A+C  + +  +   +   S Q++    P K+E    +Y+K+LR  A
Sbjct: 238 MTQPHETPYGIEALAVCQIKKVSDDRVAQLMFSIQDSQKRTPQKLEALSEKYLKELRQRA 297

Query: 313 IIHYY 317
            I  +
Sbjct: 298 HIQNH 302


>gi|85716332|ref|ZP_01047305.1| hypothetical protein NB311A_19130 [Nitrobacter sp. Nb-311A]
 gi|85696848|gb|EAQ34733.1| hypothetical protein NB311A_19130 [Nitrobacter sp. Nb-311A]
          Length = 319

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 70/308 (22%), Positives = 136/308 (44%), Gaps = 8/308 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
            L   +  L +F  +  VS+ S   +  +   +NGE IT  DI +R  L+K+        
Sbjct: 5   SLFRPFSRLAVFAFLSFVSFNSPLSAQSVAVMVNGEPITTFDIEQRSRLIKISTHKSASR 64

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  + ELI E +K +E +K G+   S  ++  +       G+S E  +  L  QG+  + 
Sbjct: 65  QEVIDELIGEKVKIKEAKKFGVNPTSADIDRAYANMGARMGMSPEQLTKSLASQGVRPDT 124

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP----ANKQKMKNITVREYLIRTVLFSIPD 189
            K  L    +W  +V+  F       + ++      + +    I   EY +R V+  +P 
Sbjct: 125 IKARLRADLVWGSLVRGRFKESLLVSDRDVNEALKNSGEDQSKIEGVEYQMRPVVLIVPR 184

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
               +   ++ R  +A   R R+ + C    +    + + ++        +DL P  ++L
Sbjct: 185 GAAAS--VMEARRNEANSLRERV-QSCADAIRIVKAMRNATLRDRVTKTSADLPPPLRDL 241

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           L K+   + T P +T++G+E +A+C+K+    +   K  +  +    K EK    Y++ +
Sbjct: 242 LDKTPVGHLTPPEITRQGIEMVAVCEKKVTSVDTPKKREIREKMFADKYEKRSKSYLENI 301

Query: 309 RSNAIIHY 316
           R +A+I Y
Sbjct: 302 RRSAMIEY 309


>gi|90423813|ref|YP_532183.1| hypothetical protein RPC_2310 [Rhodopseudomonas palustris BisB18]
 gi|90105827|gb|ABD87864.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 320

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 71/304 (23%), Positives = 131/304 (43%), Gaps = 12/304 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI 75
           L     ++  C+ P +       +  +   +NGE IT+ DI +R  L+ L        + 
Sbjct: 25  LCCAVAMLAICLGPDL------HAQSVAVMVNGEPITNYDIEQRSKLMALSTHKSPSRQQ 78

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            + ELI E +K +E +K GI      ++  F        +SAE  +  L+ QGI     K
Sbjct: 79  VIDELINEKVKIREGKKFGIDPSVADIDGSFAGMGSRMRMSAEQLTKSLEGQGIRPETLK 138

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN--ITVREYLIRTVLFSIPDNKLQ 193
           Q +  + +W  +V+  F       E E+ A             EY +R ++  +P N   
Sbjct: 139 QRMRAEMVWTSLVRGRFKDSLLVGEKEVRAALGGDDKSSGESFEYQMRPIVLIVPRNAAP 198

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
           +    + R+K+AE  R R+ + C + +     + + +I        +D+    + +L K+
Sbjct: 199 S--ARELRMKEAEALRSRV-QSCAEADDLFKSMQNAAIRDTVTKTSADIPGVLREVLDKT 255

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
              + T P VT++GVE +A+C ++    +   K  +  +    K E     Y++ +R  A
Sbjct: 256 PIGHLTAPEVTKQGVEMVALCSRKPTTADTPKKREIRDKMFADKFEAKSKSYLRDVRKAA 315

Query: 313 IIHY 316
           +I Y
Sbjct: 316 MIEY 319


>gi|49474098|ref|YP_032140.1| hypothetical protein BQ04600 [Bartonella quintana str. Toulouse]
 gi|49239602|emb|CAF25959.1| hypothetical protein BQ04600 [Bartonella quintana str. Toulouse]
          Length = 324

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 135/312 (43%), Gaps = 11/312 (3%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
             + L     + +   +V           + I  T+NG  IT+ DI +R A LKLQ+  G
Sbjct: 13  RILALFCIAPLSVSNLLVSGFLISPVFAQTVIVVTVNGNPITNYDIQRRTAFLKLQQKQG 72

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A  ELI E +K  EI++  I    N V   F   A    ++ +  +  L +  I 
Sbjct: 73  NLAAQAKNELINEIVKNTEIKRRNIEVSDNEVESAFENFAMQNNMTVDQLNQILMQNDIT 132

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFSI 187
             HFK Y+  Q  W  +V   +  + G +  +       K      +  EY ++ ++F I
Sbjct: 133 VQHFKDYIRGQIGWGRLVNARYQAEIGMVSEQEAVRRILKNGGVKPSTNEYTLQQIIFVI 192

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           P+++      +++R ++A+  R    + C   +K A  I DV+I      LE  L  ++ 
Sbjct: 193 PEHR--RSEILERRQREAKSFRAHF-QGCANAQKQARGILDVTIRHLGKFLEPQLPREWG 249

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN----TPTKIEKHEA 302
             ++ +     T    T  G+E +A+C  + +  +   +   S Q+    +P K+E    
Sbjct: 250 QAVRATPVGKMTQLRETTDGIEALAVCKIKRVSDDYVARLIFSLQDNKEKSPQKLEILSE 309

Query: 303 EYVKKLRSNAII 314
           +Y+K+LR  A I
Sbjct: 310 KYLKELRQAAHI 321


>gi|316933705|ref|YP_004108687.1| SurA domain [Rhodopseudomonas palustris DX-1]
 gi|315601419|gb|ADU43954.1| SurA domain [Rhodopseudomonas palustris DX-1]
          Length = 308

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 71/308 (23%), Positives = 137/308 (44%), Gaps = 9/308 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSY-KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           KL      L++ C    +      + +  I   +NGE IT+ DI +R  L ++   N E 
Sbjct: 4   KLSLRIIGLVLCCAAATLGLGTGPSQAQSIVVMVNGEPITNFDIEQRSKLNRMSHKN-ES 62

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  + +LI E +K +E +K G+    + ++  F   A    +S    ++ L  QGI  +
Sbjct: 63  RQQVLDDLIDEKVKIKEGKKYGVNPSDSDIDSSFATMASRMRMSTAQMTNMLAAQGIRPD 122

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANK---QKMKNITVREYLIRTVLFSIPD 189
             K  +  + +W  +V+  F       E EI A        K +   EY +R ++  +  
Sbjct: 123 TLKSRIKAEMVWGSLVRGRFKDSLQVSEREIQAQLKGNDDSKAVESYEYQLRPIVMIVSR 182

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
               +   +  R K+AE+ R R+   C + ++    + + +I        +DL P  +++
Sbjct: 183 GSGSSS--LDTRRKEAEQIRGRI-TSCAEADRIFKAMPNAAIRGTVVKTSADLPPALRDV 239

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           L K+   + T P VT++GVE +A+C ++    +   K  +  +    K      +Y++++
Sbjct: 240 LDKTPVGHLTAPEVTKQGVEMVALCGRKQSTADTPRKREIREKLFGEKFLAKSKDYLQEV 299

Query: 309 RSNAIIHY 316
           R  A+I Y
Sbjct: 300 RKAAMIEY 307


>gi|315122192|ref|YP_004062681.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495594|gb|ADR52193.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 315

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 184/312 (58%), Positives = 241/312 (77%), Gaps = 5/312 (1%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           +S + F KLL    VL I C  P   Y+S A+SS+I  T+NGE ITDGDISKRIA LKL+
Sbjct: 7   SSFNGFSKLLAVCVVL-IACFYP---YESSAISSQISITVNGEAITDGDISKRIAFLKLR 62

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
           KING+L+KIA QELI E LKKQE E  GI  + N++NYFF Q+ARNTG+SAE+FS  L+ 
Sbjct: 63  KINGDLKKIAKQELIAEALKKQESEGFGIILNPNSMNYFFAQYARNTGISAEEFSDMLEH 122

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLF 185
            GIG+NHFKQYLAIQ  W ++V+N F++KY  L ME+P + K + KN+TVREYL++ ++F
Sbjct: 123 LGIGENHFKQYLAIQLAWDEIVRNTFIMKYRGLGMEMPPSIKGRGKNLTVREYLVKKIIF 182

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           S+P NK +N+ F+QKRI +AE+SR   P +CN++E+FAS +HDVS+   QY LESDL PQ
Sbjct: 183 SVPYNKHKNEDFIQKRIDEAEKSRFHFPTNCNRVEEFASAMHDVSVSNPQYFLESDLQPQ 242

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV 305
            + LLKK++NNTTN YVT+KGVEYIAIC+ RD+GGE+ALKAY + Q  P K++K++ EY+
Sbjct: 243 LKILLKKTKNNTTNTYVTEKGVEYIAICNIRDIGGELALKAYFNTQEIPKKMKKYDEEYM 302

Query: 306 KKLRSNAIIHYY 317
           K LR+NAII +Y
Sbjct: 303 KTLRANAIIQFY 314


>gi|319898728|ref|YP_004158821.1| Peptidyl-prolyl cis-trans isomerase [Bartonella clarridgeiae 73]
 gi|319402692|emb|CBI76238.1| Peptidyl-prolyl cis-trans isomerase [Bartonella clarridgeiae 73]
          Length = 319

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 87/315 (27%), Positives = 140/315 (44%), Gaps = 23/315 (7%)

Query: 20  FVLIIFCIVP----------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
            VL +FCI              + + +A +S +  T+NG  IT  DI +RIA LKLQ+  
Sbjct: 7   SVLALFCITSLSVSSLSVSTFFTSQVFAQTS-VVVTVNGNPITSYDIQRRIAFLKLQQKQ 65

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G L   A  ELI E LK  EI++  I    + V   F   A    ++ +  +  L +  +
Sbjct: 66  GNLAAQAKNELIDEALKNNEIKRRNIEVSKDEVESAFKNFALQNNMTVDQLNQMLAQTDV 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFS 186
              HFK Y+  Q  W  +V   +  + G L  +  A+   K      +  EY ++ ++F 
Sbjct: 126 TVEHFKTYILGQMGWGRLVNARYQAEGGVLTEQETAHRILKNGGVKPSTNEYTLQRIIFV 185

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KR K+A + R      C+  +  A  I DV+I      LE  L   +
Sbjct: 186 IPEHR--RSAILEKRKKEANKFRANF-HGCHNAQNQAKSILDVTIRHLGKFLEPQLPQNW 242

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKH 300
           +  +L       TN   TQ G+E +AIC  + +  +   +   S Q     + P  +E  
Sbjct: 243 EKAILATPAGKMTNFQETQYGIEALAICQIKRVSDDRVARLIFSIQDHQKKDIPQLLEAL 302

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 303 SEKYLKELRQTAHIQ 317


>gi|161618653|ref|YP_001592540.1| chaperone surA precursor [Brucella canis ATCC 23365]
 gi|260566737|ref|ZP_05837207.1| SurA domain-containing protein [Brucella suis bv. 4 str. 40]
 gi|161335464|gb|ABX61769.1| Chaperone surA precursor [Brucella canis ATCC 23365]
 gi|260156255|gb|EEW91335.1| SurA domain-containing protein [Brucella suis bv. 4 str. 40]
          Length = 318

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVTAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|121602042|ref|YP_988820.1| SurA domain-containing protein [Bartonella bacilliformis KC583]
 gi|120614219|gb|ABM44820.1| SurA domain protein [Bartonella bacilliformis KC583]
          Length = 325

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 82/314 (26%), Positives = 143/314 (45%), Gaps = 12/314 (3%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKS-WAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           + F+ L  T F+ +    + ++S    +A  +++  T+NG  IT+ DI +RIA LKLQ+ 
Sbjct: 12  NHFLTLFFTAFLGVSSLFINVLSISPVFAQQTKVALTVNGNAITNYDIQRRIAFLKLQQK 71

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
              L   A  ELI E LKK EI++  I    + V+  F   A    ++    S  L +  
Sbjct: 72  KENLSVQAKNELIDEMLKKIEIKQRNIDVSDSEVDAAFENFAVQNHMTINQLSEMLTQTN 131

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLF 185
           +   HFK Y+  Q  W  +V   +  + G L  +  A+   K   +  +  EY ++ ++F
Sbjct: 132 VTVKHFKDYIRGQIGWGRLVNARYQAEGGLLTEQEVAHKILKNGGQKPSTDEYTLQRIIF 191

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            IP ++      +QKR ++A   R      CN        I DV+I  +  +LE  L   
Sbjct: 192 VIPAHR--RSEILQKRTQEANSFREHF-NGCNNTRAQVKGILDVTIRSSVKILEPQLPQD 248

Query: 246 FQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL----SAQNTPTKIEKH 300
           ++  +L+      T    T  G+E  A+C  + +  +   +       S ++ P ++E  
Sbjct: 249 WKKFILETPAGKMTQVQETPNGIEAFAVCQIKRVSDDRVAQLLFSIQHSQEDIPQELETL 308

Query: 301 EAEYVKKLRSNAII 314
             +Y+K+L+  A I
Sbjct: 309 SEKYLKELQQAAHI 322


>gi|254718820|ref|ZP_05180631.1| Chaperone surA precursor [Brucella sp. 83/13]
 gi|265983805|ref|ZP_06096540.1| SurA domain-containing protein [Brucella sp. 83/13]
 gi|264662397|gb|EEZ32658.1| SurA domain-containing protein [Brucella sp. 83/13]
          Length = 318

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASLLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|256044377|ref|ZP_05447281.1| survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase surA) [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563729|ref|ZP_05834215.1| SurA domain-containing protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153745|gb|EEW88837.1| SurA domain-containing protein [Brucella melitensis bv. 1 str. 16M]
          Length = 318

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 83/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      VN  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSLGINISDKEVNDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|306838742|ref|ZP_07471576.1| Chaperone surA precursor [Brucella sp. NF 2653]
 gi|306406144|gb|EFM62389.1| Chaperone surA precursor [Brucella sp. NF 2653]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 2   FARPLIASLLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 61

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 62  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 121

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 122 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 181

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 182 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 239

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 240 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 299

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 300 LSKKYVQELREKATI 314


>gi|17987548|ref|NP_540182.1| survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase surA) [Brucella melitensis bv. 1 str. 16M]
 gi|265990795|ref|ZP_06103352.1| SurA domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17983251|gb|AAL52446.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Brucella melitensis bv. 1 str. 16M]
 gi|263001579|gb|EEZ14154.1| SurA domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 83/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 2   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 61

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      VN  +   A    ++    +  +++ G
Sbjct: 62  SGNLNQLARNELTEEMLKRIEMKSLGINISDKEVNDAYAGFASRNKMTLAQLNQVMNQSG 121

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 122 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 181

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 182 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 239

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 240 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 299

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 300 LSKKYVQELREKATI 314


>gi|319405490|emb|CBI79109.1| Peptidyl-prolyl cis-trans isomerase [Bartonella sp. AR 15-3]
          Length = 318

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 86/315 (27%), Positives = 144/315 (45%), Gaps = 13/315 (4%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +  + L    F+ +   I    + +++A +S +  T+NG  IT  DI +RIA LKLQ+  
Sbjct: 6   NSALALFCITFLSVSISISIFFTSQAFAQTS-VVVTVNGSAITSYDIQRRIAFLKLQQRQ 64

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G L   A  ELI ETLK  EI++  I    + +   F   A    ++ E  S  L +  +
Sbjct: 65  GNLAVQAKNELIDETLKNNEIKRRNIEVSKDELESAFENFATQNNMTVEQLSQMLTQTDV 124

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFS 186
              HFK Y+  Q  W  +V   +  + G L  +   +   K      +  EY ++ ++F 
Sbjct: 125 TVEHFKAYILGQMGWGRLVNARYQAEGGILTEQEAVHRILKNGGVKPSTNEYTLQQIIFV 184

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KRIK+A + R    + CN  +     I D++I      LE  L   +
Sbjct: 185 IPEHR--RSAILEKRIKEANQFRANF-RGCNSAKHQVKGILDITIRHLGKFLEPQLPRNW 241

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKH 300
           +  +L       TN   TQ+G+E IA+C  + +  +   +   S Q     + P  +E  
Sbjct: 242 EKAILATPAGKMTNLQETQRGIEAIAVCQIKRVSDDRVARLIFSIQDHQKKDIPQLLEAI 301

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 302 SEKYLKELRQTARIQ 316


>gi|23501571|ref|NP_697698.1| peptidyl-prolyl cis-trans isomerase [Brucella suis 1330]
 gi|62289646|ref|YP_221439.1| peptidyl-prolyl cis-trans isomerase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699574|ref|YP_414148.1| peptidyl-prolyl cis-trans isomerase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023896|ref|YP_001934664.1| peptidyl-prolyl cis-trans isomerase [Brucella abortus S19]
 gi|225852204|ref|YP_002732437.1| chaperone SurA [Brucella melitensis ATCC 23457]
 gi|237815137|ref|ZP_04594135.1| Chaperone surA precursor [Brucella abortus str. 2308 A]
 gi|254697090|ref|ZP_05158918.1| Chaperone surA precursor [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701467|ref|ZP_05163295.1| Chaperone surA precursor [Brucella suis bv. 5 str. 513]
 gi|254704014|ref|ZP_05165842.1| Chaperone surA precursor [Brucella suis bv. 3 str. 686]
 gi|254707612|ref|ZP_05169440.1| Chaperone surA precursor [Brucella pinnipedialis M163/99/10]
 gi|254709805|ref|ZP_05171616.1| Chaperone surA precursor [Brucella pinnipedialis B2/94]
 gi|254713809|ref|ZP_05175620.1| Chaperone surA precursor [Brucella ceti M644/93/1]
 gi|254717133|ref|ZP_05178944.1| Chaperone surA precursor [Brucella ceti M13/05/1]
 gi|254729986|ref|ZP_05188564.1| Chaperone surA precursor [Brucella abortus bv. 4 str. 292]
 gi|256031296|ref|ZP_05444910.1| Chaperone surA precursor [Brucella pinnipedialis M292/94/1]
 gi|256060809|ref|ZP_05450969.1| Chaperone surA precursor [Brucella neotomae 5K33]
 gi|256113220|ref|ZP_05454088.1| Chaperone surA precursor [Brucella melitensis bv. 3 str. Ether]
 gi|256159410|ref|ZP_05457188.1| Chaperone surA precursor [Brucella ceti M490/95/1]
 gi|256254704|ref|ZP_05460240.1| Chaperone surA precursor [Brucella ceti B1/94]
 gi|256257204|ref|ZP_05462740.1| Chaperone surA precursor [Brucella abortus bv. 9 str. C68]
 gi|256264288|ref|ZP_05466820.1| SurA domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369119|ref|YP_003106627.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella microti CCM
           4915]
 gi|260545602|ref|ZP_05821343.1| SurA domain-containing protein [Brucella abortus NCTC 8038]
 gi|260757664|ref|ZP_05870012.1| SurA domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260761491|ref|ZP_05873834.1| SurA domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883474|ref|ZP_05895088.1| SurA domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261218948|ref|ZP_05933229.1| SurA domain-containing protein [Brucella ceti M13/05/1]
 gi|261221884|ref|ZP_05936165.1| SurA domain-containing protein [Brucella ceti B1/94]
 gi|261315102|ref|ZP_05954299.1| SurA domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261317343|ref|ZP_05956540.1| SurA domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261321553|ref|ZP_05960750.1| SurA domain-containing protein [Brucella ceti M644/93/1]
 gi|261324801|ref|ZP_05963998.1| SurA domain-containing protein [Brucella neotomae 5K33]
 gi|261752010|ref|ZP_05995719.1| SurA domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261754669|ref|ZP_05998378.1| SurA domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|265988381|ref|ZP_06100938.1| SurA domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|265994631|ref|ZP_06107188.1| SurA domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997847|ref|ZP_06110404.1| SurA domain-containing protein [Brucella ceti M490/95/1]
 gi|294852046|ref|ZP_06792719.1| peptidyl-prolyl cis-trans isomerase [Brucella sp. NVSL 07-0026]
 gi|297248054|ref|ZP_06931772.1| peptidyl-prolyl cis-trans isomerase SurA [Brucella abortus bv. 5
           str. B3196]
 gi|306842051|ref|ZP_07474724.1| Chaperone surA precursor [Brucella sp. BO2]
 gi|23347483|gb|AAN29613.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella suis 1330]
 gi|62195778|gb|AAX74078.1| peptidyl-prolyl cis-trans isomerase, hypothetical [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615675|emb|CAJ10662.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella melitensis
           biovar Abortus 2308]
 gi|189019468|gb|ACD72190.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella abortus
           S19]
 gi|225640569|gb|ACO00483.1| Chaperone surA precursor [Brucella melitensis ATCC 23457]
 gi|237789974|gb|EEP64184.1| Chaperone surA precursor [Brucella abortus str. 2308 A]
 gi|255999279|gb|ACU47678.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella microti CCM
           4915]
 gi|260097009|gb|EEW80884.1| SurA domain-containing protein [Brucella abortus NCTC 8038]
 gi|260667982|gb|EEX54922.1| SurA domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260671923|gb|EEX58744.1| SurA domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260873002|gb|EEX80071.1| SurA domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|260920468|gb|EEX87121.1| SurA domain-containing protein [Brucella ceti B1/94]
 gi|260924037|gb|EEX90605.1| SurA domain-containing protein [Brucella ceti M13/05/1]
 gi|261294243|gb|EEX97739.1| SurA domain-containing protein [Brucella ceti M644/93/1]
 gi|261296566|gb|EEY00063.1| SurA domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261300781|gb|EEY04278.1| SurA domain-containing protein [Brucella neotomae 5K33]
 gi|261304128|gb|EEY07625.1| SurA domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261741763|gb|EEY29689.1| SurA domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261744422|gb|EEY32348.1| SurA domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|262552315|gb|EEZ08305.1| SurA domain-containing protein [Brucella ceti M490/95/1]
 gi|262765744|gb|EEZ11533.1| SurA domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094548|gb|EEZ18357.1| SurA domain-containing protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660578|gb|EEZ30839.1| SurA domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294820635|gb|EFG37634.1| peptidyl-prolyl cis-trans isomerase [Brucella sp. NVSL 07-0026]
 gi|297175223|gb|EFH34570.1| peptidyl-prolyl cis-trans isomerase SurA [Brucella abortus bv. 5
           str. B3196]
 gi|306287892|gb|EFM59312.1| Chaperone surA precursor [Brucella sp. BO2]
 gi|326408703|gb|ADZ65768.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella melitensis
           M28]
          Length = 318

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|306845285|ref|ZP_07477861.1| Chaperone surA precursor [Brucella sp. BO1]
 gi|306274444|gb|EFM56251.1| Chaperone surA precursor [Brucella sp. BO1]
 gi|326538427|gb|ADZ86642.1| chaperone surA precursor [Brucella melitensis M5-90]
          Length = 317

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 2   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 61

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 62  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 121

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 122 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 181

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 182 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 239

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 240 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 299

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 300 LSKKYVQELREKATI 314


>gi|163842954|ref|YP_001627358.1| chaperone surA precursor [Brucella suis ATCC 23445]
 gi|163673677|gb|ABY37788.1| Chaperone surA precursor [Brucella suis ATCC 23445]
          Length = 318

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 LPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|225627181|ref|ZP_03785219.1| Chaperone surA precursor [Brucella ceti str. Cudo]
 gi|260168435|ref|ZP_05755246.1| peptidyl-prolyl cis-trans isomerase, putative [Brucella sp. F5/99]
 gi|261757897|ref|ZP_06001606.1| SurA domain-containing protein [Brucella sp. F5/99]
 gi|225618016|gb|EEH15060.1| Chaperone surA precursor [Brucella ceti str. Cudo]
 gi|261737881|gb|EEY25877.1| SurA domain-containing protein [Brucella sp. F5/99]
          Length = 318

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSVEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|254688956|ref|ZP_05152210.1| Chaperone surA precursor [Brucella abortus bv. 6 str. 870]
 gi|260754445|ref|ZP_05866793.1| SurA domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260674553|gb|EEX61374.1| SurA domain-containing protein [Brucella abortus bv. 6 str. 870]
          Length = 318

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSKRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|148559269|ref|YP_001258666.1| putative peptidyl-prolyl cis-trans isomerase [Brucella ovis ATCC
           25840]
 gi|148370526|gb|ABQ60505.1| putative peptidyl-prolyl cis-trans isomerase [Brucella ovis ATCC
           25840]
          Length = 318

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 81/315 (25%), Positives = 149/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +    C+  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++   I      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRSINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|115525297|ref|YP_782208.1| hypothetical protein RPE_3295 [Rhodopseudomonas palustris BisA53]
 gi|115519244|gb|ABJ07228.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 305

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 69/304 (22%), Positives = 125/304 (41%), Gaps = 6/304 (1%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI 75
           L    +   F ++      +   +  +   +NGE IT  DI +R  L +L        + 
Sbjct: 4   LRLSRLCFAFALLLTTGLSTELRAQSVVVMVNGEPITSYDIDQRSKLTQLSTRKTPPRQE 63

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            ++ELI E +K +E +K GI      ++  F        +S E  +  L   GI  +  K
Sbjct: 64  VIEELINEKVKIKEGKKFGIDPSGADIDSSFANMGSRMRMSPEQLTQTLANSGIRPDTLK 123

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV--REYLIRTVLFSIPDNKLQ 193
             +  + +W  +V+  F       E +I A             EY +R V+  +P N   
Sbjct: 124 HRMRAEMVWTSLVRGRFKDSLLVGEKDIQAALGDSDKPAGESFEYQMRPVVLIVPRNAA- 182

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
                + R+K+AE  R R+ + C +       + + +I        +DL P  + LL K+
Sbjct: 183 -PASREARMKEAEALRARV-QTCEEANALFKSMPNAAIRATVSKTSADLPPSLRELLDKT 240

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
              + T P  T++GVE +A+C ++    +   K  +  +    K E     Y++ +R  A
Sbjct: 241 PIGHLTAPEATKQGVEMVALCSRKPTTADTPKKREIREKMFAEKFEAKSKAYLRDVRKAA 300

Query: 313 IIHY 316
           ++ Y
Sbjct: 301 MVEY 304


>gi|319407065|emb|CBI80702.1| Peptidyl-prolyl cis-trans isomerase [Bartonella sp. 1-1C]
          Length = 319

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 141/315 (44%), Gaps = 23/315 (7%)

Query: 20  FVLIIFCIVP----------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
             L +FCI              + +++A +S +  T+NG  IT+ DI +RIA LKLQ+  
Sbjct: 7   SALALFCITSLSVSSLSVSTFFTSQAFAQTS-VVVTVNGNAITNYDIQRRIAFLKLQQKQ 65

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G L   A  +LI E LK  EI++  I    + V   F   A    ++ +  +  L +  +
Sbjct: 66  GNLATQAKNDLIDEVLKNNEIKRRNIEVSKDEVENAFENFAAQNNMTVDQLNQMLTQTDV 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFS 186
              HFK Y+  Q  W  +V   +  + G +  +  +    K      +  EY ++ ++F 
Sbjct: 126 TVEHFKAYIWGQMGWGRLVNARYQAEGGVITEQEASQRILKNGGVKPSTNEYTLQQIIFV 185

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KR K+A + R    + CN  +  A  I D++I      LE  L   +
Sbjct: 186 IPEHRW--SAILEKRKKEANKFRANF-QGCNSAKNQAKGILDITIRHLGKFLEPQLPQNW 242

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-----NTPTKIEKH 300
           +  +L       TN   TQ G+E +A+C  + +  +   +   S Q     + P  +E  
Sbjct: 243 EKAILATPAGKMTNFQETQNGIEAVAVCQIKRVSDDRVARLIFSIQDHQKKDIPQLLEAL 302

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 303 SEKYLKELRQTARIQ 317


>gi|254693438|ref|ZP_05155266.1| Chaperone surA precursor [Brucella abortus bv. 3 str. Tulya]
 gi|261213691|ref|ZP_05927972.1| SurA domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915298|gb|EEX82159.1| SurA domain-containing protein [Brucella abortus bv. 3 str. Tulya]
          Length = 318

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 81/315 (25%), Positives = 149/315 (47%), Gaps = 14/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKI 68
           F + L    +     +  + +  + A +   S ++  ++G  IT+ DI  R+A LKLQ+ 
Sbjct: 3   FARPLIASMLGAAVFLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRK 62

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
           +G L ++A  EL  E LK+ E++  GI      V+  +   A    ++    +  +++ G
Sbjct: 63  SGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSG 122

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +   HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F 
Sbjct: 123 VTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFV 182

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  L  ++
Sbjct: 183 VPASK-RSPALLAKRRQEANALRARF-QNCDSTRQQAKGILDVTVRDLGRIIEPQLPGEW 240

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEK 299
              +K +  N TT P+ T+KGVE++A+C  R +  +   +   S +          K E+
Sbjct: 241 SKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQEKKAEE 300

Query: 300 HEAEYVKKLRSNAII 314
              +YV++LR  A I
Sbjct: 301 LSKKYVQELREKATI 315


>gi|240850229|ref|YP_002971622.1| peptidyl-prolyl cis-trans isomerase [Bartonella grahamii as4aup]
 gi|240267352|gb|ACS50940.1| peptidyl-prolyl cis-trans isomerase [Bartonella grahamii as4aup]
          Length = 324

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 76/313 (24%), Positives = 134/313 (42%), Gaps = 11/313 (3%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
             + L     + +   ++      +    + I  T+NG  IT+ DI +R+A L+LQ+  G
Sbjct: 13  RVLALFYITSLSVSSLLINGFLIPTVFAQTSIVVTVNGNPITNYDIQRRLAFLRLQQKQG 72

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A +ELI E LK  EI++  I   ++ V+  F   A    ++ +  +  L +  I 
Sbjct: 73  NLVAQAKKELIDEKLKNIEIKRRNIEVSNDEVDRAFENFATQNNMTIDQLNQILIQTEIT 132

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFSI 187
             HFK Y+  Q  W  +V   +  + G +  +       K      +  EY ++ ++F I
Sbjct: 133 VQHFKDYIRGQIGWGRLVSARYQAETGMISEQEAVRRILKNGGVKPSTNEYTLQRIVFVI 192

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF- 246
           P ++       ++R ++A   R    + C      A  I DV+I      LE  L   + 
Sbjct: 193 PAHR--RSEIFERRQREASNFRAHF-RGCANAHNQARGILDVTIRHLGKFLEPQLPNAWE 249

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN----TPTKIEKHEA 302
           Q +L       T    T  G+E IA+C  + +  +   +   S Q+    +P K+E+   
Sbjct: 250 QAILATPAGKMTKLQETSDGIEAIAVCKIKRVSDDYVARLIFSLQDSKKRSPQKLEELSD 309

Query: 303 EYVKKLRSNAIIH 315
           +Y+ +LR  A I 
Sbjct: 310 KYLGELRRVARIQ 322


>gi|163868025|ref|YP_001609229.1| peptidyl-prolyl cis-trans isomerase [Bartonella tribocorum CIP
           105476]
 gi|161017676|emb|CAK01234.1| Peptidyl-prolyl cis-trans isomerase [Bartonella tribocorum CIP
           105476]
          Length = 322

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 78/313 (24%), Positives = 135/313 (43%), Gaps = 11/313 (3%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
             + L     + +   ++      S    + I  T+NG  IT+ DI +R+A L+LQ+  G
Sbjct: 13  RLLALFCIASLGVSSLLINEFLISSAFAQTAIVVTVNGNPITNYDIQRRVAFLRLQQKQG 72

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L   A +ELI E LK  EI++  I   ++ VN  F   A    ++ +  +  L +  I 
Sbjct: 73  SLAAQAKKELIDEELKNIEIKRRNIEVSNDEVNRAFENFATQNNMTVDQLNQILIQNDIT 132

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFSI 187
             HFK Y+  Q  W  +V   +  + G +  +       K      +  EY ++ ++F I
Sbjct: 133 VQHFKDYIRGQIGWGRLVSARYQAQTGMVSEQEAVRRILKNGGVKPSTNEYTLQRIVFVI 192

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF- 246
           P ++      +++R ++A   R    + C      A  I DV+I      LE  L   + 
Sbjct: 193 PAHR--RSEILERRQREASNFRAHF-RGCANAHNQARGILDVTIRPLGKFLEPQLPSAWE 249

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT----PTKIEKHEA 302
           Q +L       T    T  G+E IA+C  + +  +   +   S Q+     P K+E+   
Sbjct: 250 QAILATPAGKMTKLQETSDGIEAIAVCKIKRISDDYVARLIFSLQDNKKRDPKKLEELSE 309

Query: 303 EYVKKLRSNAIIH 315
           +Y+++LR  A I 
Sbjct: 310 KYLEELRRVARIQ 322


>gi|153009931|ref|YP_001371146.1| SurA domain-containing protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561819|gb|ABS15317.1| SurA domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 319

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 83/312 (26%), Positives = 147/312 (47%), Gaps = 12/312 (3%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           F  +L+    L     V + ++ + A  S ++  ++G  IT+ DI  R+A LKLQ+  G 
Sbjct: 8   FASMLSAAVCLTTLGTVAVPAFAAGA-GSEVKVIVSGNAITNSDIQHRVAFLKLQRKGGN 66

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L ++A +EL  E LK+ E++   I      V+  +   A    +S    +  +++ G+  
Sbjct: 67  LSQVAKEELTDEMLKRIEMKSRSINITDQQVDEAYAGFASRNKMSLAQLNQLMNQSGVTP 126

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPD 189
           +HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++ V+F IP 
Sbjct: 127 DHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKDGGKKPVATEYRLQQVIFVIPA 186

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +K ++   + KR ++A   R R  + C+   + A  I DV++     ++E  L  ++   
Sbjct: 187 SK-RSPALLSKRKQEANALRSRF-QSCDATRQQAKGILDVTVRDLGRIIEQQLPNEWAKA 244

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------TKIEKHEA 302
           +K +    TT P  T+KGVE++A+C  R +  +   +   S +          K E+   
Sbjct: 245 VKATSVGGTTPPQETEKGVEFLAVCSTRQISDDRVAQLVFSMEGADSPAGQEKKAEQLSE 304

Query: 303 EYVKKLRSNAII 314
           +Y+K+LR  A I
Sbjct: 305 KYLKELREKATI 316


>gi|92117866|ref|YP_577595.1| hypothetical protein Nham_2343 [Nitrobacter hamburgensis X14]
 gi|91800760|gb|ABE63135.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 319

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 69/307 (22%), Positives = 135/307 (43%), Gaps = 8/307 (2%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           LL  +  L +F ++      +   +  +   +NGE IT  DI +R  L+++        +
Sbjct: 6   LLRAFCHLALFAVLSFACLNAPLHAQSVAVMVNGEPITSFDIEQRSRLIQISTHKTPTRQ 65

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             + ELI E +K +E +K G+   S  ++  +        +S E  +  L  QG+  +  
Sbjct: 66  QVIDELINEKVKVKEAKKFGVNPTSADIDQQYASMGARMRMSPEQLTKSLASQGVRPDTI 125

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ----KMKNITVREYLIRTVLFSIPDN 190
           K  L    +W  +V+  F       + ++    +            EY +R V+  +P  
Sbjct: 126 KARLKADLVWGSLVRGRFKDSLLVSDRDVNEALRNSGEDQSKTEGFEYQMRPVVLVVPRG 185

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
              +   ++ R K+A+  R R+ + C    +    + + +I +      +DL P  ++LL
Sbjct: 186 AAAS--VMESRRKEADALRERV-QSCADATRIFKAMRNATIRETVVKTSADLPPPIRDLL 242

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
            K+   + T P +T++GVE +AIC K+    +   K  +  +    K EK   +Y++ +R
Sbjct: 243 DKTPVGHLTPPEITRQGVEMVAICGKKATSVDTPKKKEIREKMFAEKYEKKSKDYLEDIR 302

Query: 310 SNAIIHY 316
            +A+I Y
Sbjct: 303 KSAMIEY 309


>gi|49475336|ref|YP_033377.1| hypothetical protein BH05420 [Bartonella henselae str. Houston-1]
 gi|49238142|emb|CAF27350.1| hypothetical protein BH05420 [Bartonella henselae str. Houston-1]
          Length = 322

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 81/309 (26%), Positives = 138/309 (44%), Gaps = 18/309 (5%)

Query: 21  VLIIFCIVPIV-------SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L +FCIVP+           S    + I  T+NG+ IT+ DI +R A L+LQ+  G L 
Sbjct: 14  ILTLFCIVPLSISNLLVSEIPSTFAQTVIVVTVNGKPITNYDIQRRAAFLRLQQKQGNLS 73

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A  ELI E LK  EI++  I   +N V   F   A    ++ +  +  L    I   H
Sbjct: 74  EQAKNELINEVLKNIEIKRRNIEVSNNEVESAFKNFAAQNNMTVDQLNQILIDNDITVQH 133

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFSIPDN 190
           FK Y+  Q  W  +V   +  + G +  +       K      +  EY ++ ++F IP +
Sbjct: 134 FKDYIRGQLGWGRLVNARYQAETGMISEQEAVRRILKNGGVKPSTNEYTLQRIIFVIPAH 193

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
           +       ++R ++A   R    + C    K A  I DV++      LE  L  +++  +
Sbjct: 194 R--RSEIFERRQREANNFRAHF-QGCANTSKQAKGILDVTVRNLGKFLEPQLPREWEQAI 250

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN----TPTKIEKHEAEYV 305
           + +     T    T  G+E IA+C  + +  +   +   S Q+    +P ++E    +Y+
Sbjct: 251 RITPAGKMTQLQETADGIEAIAVCKIKRVSDDYVARLIFSLQDNKQKSPQELEILSEKYL 310

Query: 306 KKLRSNAII 314
           K+LR  A I
Sbjct: 311 KELRQVARI 319


>gi|222085450|ref|YP_002543980.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium
           radiobacter K84]
 gi|221722898|gb|ACM26054.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium
           radiobacter K84]
          Length = 316

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 97/311 (31%), Positives = 164/311 (52%), Gaps = 10/311 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           ++ +      +I     + S      +S ++  +N  VIT GDI+KRI  LKLQ   G+L
Sbjct: 8   MRAVLFGAAALIMATFAMPSSDVAFAASEVKVVVNNSVITSGDIAKRINFLKLQHQKGDL 67

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K+A ++L+ ETLK+ EI +  ++  ++ V+  F + A +  +S +     LDK G+G +
Sbjct: 68  NKLAQEQLVDETLKRAEISRVRMSVSTSDVDSAFGRFAASNKMSPQQLGQILDKMGVGVD 127

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN---ITVREYLIRTVLFSIPD 189
           HFK Y+A+   WP VV   F    GN         +  +N       EY ++ ++F +P 
Sbjct: 128 HFKSYIAVSMSWPRVVNARFGSSGGNKLSNDDLVTRMTENKTKPVTTEYFLKQIVFVVPQ 187

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
            K      + +R  +AE SR + P  C++ + FA+ + DVS+     +L  DL   ++ L
Sbjct: 188 AK--RNAILNQRKSEAEASRAKFP-GCDQAKVFAATMRDVSVQDLGRVLAPDLPEIWKPL 244

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT----PTKIEKHEAEYV 305
           L++++ NTT P VT +GVEY+AIC +R +  ++A  A   A++        I  ++ +Y+
Sbjct: 245 LEQAKGNTTTPVVTDRGVEYVAICSQRQVNDDVAAAAVFRAEDIGKAGAQGISANDKKYM 304

Query: 306 KKLRSNAIIHY 316
            +LRS A I Y
Sbjct: 305 DELRSKAQILY 315


>gi|86357089|ref|YP_468981.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CFN 42]
 gi|86281191|gb|ABC90254.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CFN 42]
          Length = 314

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 89/316 (28%), Positives = 164/316 (51%), Gaps = 15/316 (4%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           D  K +T +       ++  ++  + A +S ++  +NG  IT GD++KR A L+LQ    
Sbjct: 3   DAKKAITAFLAGAAIALLTGLAGPALA-ASGVQAVVNGTAITSGDVAKRQAFLRLQHTKA 61

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
           +  K A ++LI ETLK+QE+ +  ++     V+  F + +    LS E  S  LD+ G+G
Sbjct: 62  DA-KTATEQLIDETLKRQEVARVHMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVG 120

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIP 188
            +HFK ++A+Q  WP VV   +         ++ +   +   +     EY+++ ++F IP
Sbjct: 121 VDHFKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIP 180

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
           + K        KR  +AE SR + P  C++ + FA+ + DVS+     +L  ++ P +++
Sbjct: 181 EAK--RGAITGKRKGEAEASRSKFP-GCDQAKTFAATMRDVSVRDLGRMLAPEIPPDWKS 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK--------IEKH 300
           L+++++ NTT   VT+KGVEY+AIC +R +  + A +     ++              ++
Sbjct: 238 LVEQAKGNTTGTRVTEKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENEN 297

Query: 301 EAEYVKKLRSNAIIHY 316
             +Y+ +LR  A I Y
Sbjct: 298 SKKYLDELRKKAQIAY 313


>gi|319404053|emb|CBI77641.1| Peptidyl-prolyl cis-trans isomerase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 319

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 82/315 (26%), Positives = 142/315 (45%), Gaps = 23/315 (7%)

Query: 20  FVLIIFCIVP----------IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
             L +FCI              + +++A +S +  T+NG  IT+ DI +RIA LKLQ+  
Sbjct: 7   SALALFCITSLSVSSLSVSTFFTSQAFAQTS-VVVTVNGSAITNYDIQRRIAFLKLQQKQ 65

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G L   A  +LI E LK  EI++  I   ++ V   F   A    ++ +  +  L +  +
Sbjct: 66  GNLATQAKNDLIDEVLKNNEIKRRNIEVSTDEVENAFENFAAQNNMTVDQLNQMLTQTDV 125

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN---KQKMKNITVREYLIRTVLFS 186
              HFK Y+  Q  W  +V   +  + G +  +  +    K      +  EY ++ ++F 
Sbjct: 126 TVEHFKAYILGQMGWARLVNARYQAEGGVITEQEASQRILKNGGVKPSTNEYTLQQIIFV 185

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+++      ++KR K+A + R    + CN  +  A  I D++I      LE  L   +
Sbjct: 186 IPEHR--RSAILEKRKKEANKFRANF-QGCNSAKNQAKGILDITIRHLGKFLEPQLPQNW 242

Query: 247 QN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-----TPTKIEKH 300
           +  +L       TN   TQ G+E +A+C  + +  +   +   S Q+      P  +E  
Sbjct: 243 EKAILATPAGKMTNFQETQNGIEAVAVCQIKRVSDDRVARLIFSIQDHQKKNIPQLLEAL 302

Query: 301 EAEYVKKLRSNAIIH 315
             +Y+K+LR  A I 
Sbjct: 303 SEKYLKELRQTARIQ 317


>gi|209885477|ref|YP_002289334.1| SurA N- domain family [Oligotropha carboxidovorans OM5]
 gi|209873673|gb|ACI93469.1| SurA N- domain family [Oligotropha carboxidovorans OM5]
          Length = 330

 Score =  285 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 74/308 (24%), Positives = 134/308 (43%), Gaps = 8/308 (2%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           + +  +   L     + +        +  I   +NGE IT  DI +R  L+ L       
Sbjct: 24  LSVFVSRIALAFAAFIILAVTAPSVQAQGIVVMVNGEPITTYDIEQRTKLITLTTRKAPT 83

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A+QELI + LK +E +K G+   ++ V+  F   A+   +S++  +  L  QG+  +
Sbjct: 84  RQQALQELIDDRLKIKEAKKFGVDLSASDVDSAFAGMAQRMRISSDQLAQVLQAQGVRPD 143

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ---KMKNITVREYLIRTVLFSIPD 189
             K  L   + W  +V+  F       E ++ A        +     EY +R ++  +P 
Sbjct: 144 TMKFRLKADTAWGALVRGRFKQSLLVGERDVQAAVGENPSGERTESYEYHMRPIVLFVPR 203

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
               + G V++R K+AE  R R+ + C +  +    +   SI        +DL P  + L
Sbjct: 204 G---SSGAVEQRKKEAEALRERI-QSCEEATRVFKSLRQASIRDTIVKTSADLPPNLREL 259

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           L K+     T P VT++G+E +A+C+++    +   K     +    K E     Y++ L
Sbjct: 260 LDKTPVGRMTAPEVTRQGIEMVALCNRQVTTADTPAKRAARDKLFAQKYEAKSKSYLEDL 319

Query: 309 RSNAIIHY 316
           R  A+I Y
Sbjct: 320 RKRAMIEY 327


>gi|75675872|ref|YP_318293.1| hypothetical protein Nwi_1680 [Nitrobacter winogradskyi Nb-255]
 gi|74420742|gb|ABA04941.1| conserved unknown protein [Nitrobacter winogradskyi Nb-255]
          Length = 314

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 74/307 (24%), Positives = 138/307 (44%), Gaps = 8/307 (2%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           L     +L +F  +  VS  S   +  I   +NGE IT  DI +R  L+K+        +
Sbjct: 6   LYRPSSLLAVFAFLTFVSMNSPLHAQSIAVMVNGEPITTLDIEQRSRLIKISTHKSPSRQ 65

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             + ELI E +K +E +K G+   S  ++  +       G+S E  +  L  QGI  +  
Sbjct: 66  EVIDELIDEKVKVKEAKKYGVNPTSTDIDRAYANMGARMGMSPEQLTKSLGSQGIRPDTI 125

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIP----ANKQKMKNITVREYLIRTVLFSIPDN 190
           K  L    +W  +V+  F       + ++      + +    I   EY +R V+  +P  
Sbjct: 126 KSRLKADLVWGSLVRGRFKESLLVSDRDVNEALKNSGEDQSKIEGVEYQMRPVVLIVPRG 185

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
              +   V+ R  +A   R R+ + C ++ +    + + ++ +      +DL P  ++LL
Sbjct: 186 ATAS--MVEARRNEANALRERV-QSCAEIIRTVKVMRNATLRETITKTSTDLPPPLRDLL 242

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
            K+   + T P +T++GVE +A+C K+    +   K  +  +    K EK    Y++++R
Sbjct: 243 DKTAVGHLTPPEMTRQGVEMVAVCGKKVTSVDTPKKKEIREKMFADKYEKRSKSYLERIR 302

Query: 310 SNAIIHY 316
            +A+I Y
Sbjct: 303 KSAMIEY 309


>gi|239831518|ref|ZP_04679847.1| Chaperone surA precursor [Ochrobactrum intermedium LMG 3301]
 gi|239823785|gb|EEQ95353.1| Chaperone surA precursor [Ochrobactrum intermedium LMG 3301]
          Length = 336

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 83/320 (25%), Positives = 147/320 (45%), Gaps = 12/320 (3%)

Query: 4   KVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL 63
           K+  +   F  +L+    L     V      +    S ++  ++G  IT+ DI  R+A L
Sbjct: 17  KMMIARPLFASMLSAAVCLTTLGTVAA-PAFAAGAGSEVKVIVSGNAITNSDIQHRVAFL 75

Query: 64  KLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
           KLQ+  G L ++A QEL  E LK+ E++  GI      V+  +   A    +S    +  
Sbjct: 76  KLQRKGGNLAQVAKQELTDEMLKRIEMKSRGIDISDRQVDEAYAGFATRNKMSLAQLNQL 135

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIR 181
           +++ G+  +HFK+Y+ +Q  W  +V   F       E E      K   K     EY ++
Sbjct: 136 MNQSGVTPDHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQRMLKDGGKKPVATEYRLQ 195

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD 241
            V+F +P +K ++   + KR ++A   R R  ++C+   + A  I DV++     ++E  
Sbjct: 196 QVIFVVPASK-RSPALLAKRKQEANALRSRF-QNCDATRQQAKGILDVTVRDLGRIIEQQ 253

Query: 242 LHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP------ 294
           L  ++   +K +    TT P  T+KGVE++A+C  R +  +   +   S +         
Sbjct: 254 LPNEWSKAIKSTSVGGTTPPQETEKGVEFLAVCSTRQVSDDRVAQLVFSMEGADSPAGQE 313

Query: 295 TKIEKHEAEYVKKLRSNAII 314
            K E+   +Y+ +LR  A I
Sbjct: 314 KKAEQLSEKYLGELREKAKI 333


>gi|86749597|ref|YP_486093.1| hypothetical protein RPB_2477 [Rhodopseudomonas palustris HaA2]
 gi|86572625|gb|ABD07182.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 309

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 72/309 (23%), Positives = 131/309 (42%), Gaps = 10/309 (3%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K     F   + C V   S    A +  +   +NGE IT+ DI +R  L KL        
Sbjct: 4   KFSFRIFAAALCCAVASWSGIGLARAQSVAVMVNGEPITNFDIEQRSKLDKLSN-QSRTR 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  + ELI E +K +E +K G+    + ++  F   +    +S +     L  QGI    
Sbjct: 63  QQVLDELIDEKVKIREGKKFGVNPSDSDIDSSFASMSSRMRMSPDQMVKMLAAQGIRPGT 122

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN-----KQKMKNITVREYLIRTVLFSIP 188
            K  +  + +W  +V+  F       E +I A                EY +R V+  + 
Sbjct: 123 LKSKIKAEMVWTSLVRGRFKDSLLVGEKDIQAQLAAKGGDDKSTTESFEYQMRPVVLIV- 181

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
            ++    G V+ R K+AE  R R+ + C   ++    + + +I        +DL P  + 
Sbjct: 182 -SRGSGAGAVEARRKEAEALRSRV-QSCADADRIFKALPNAAIRATVVKTSADLPPALRE 239

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
           +L K+     T P  T++GVE +A+C ++    +  +K  +  +    K +    +Y+++
Sbjct: 240 ILDKTPVGQMTAPEATKQGVEMVALCSRKPTTADTPMKREIREKMYAEKFQAKSKDYLRE 299

Query: 308 LRSNAIIHY 316
            R+ A+I Y
Sbjct: 300 SRNAAMIEY 308


>gi|299133711|ref|ZP_07026905.1| SurA domain protein [Afipia sp. 1NLS2]
 gi|298591547|gb|EFI51748.1| SurA domain protein [Afipia sp. 1NLS2]
          Length = 314

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 69/309 (22%), Positives = 134/309 (43%), Gaps = 7/309 (2%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
           F+ +  +   L +  ++ +++    A +  +   +NGE IT  DI +R  L+ L      
Sbjct: 6   FLSVFASRLALSLATLLTLLATAPSARAQAVVVMVNGEPITTYDIEQRAKLIALTTHKSA 65

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
             +  + +LI + LK +E +K GI    + ++  +    +  G+SA+  S  L  QG+  
Sbjct: 66  PRQEVINQLIDDRLKIKEAKKFGINMTPSEIDSSYAAMGQRMGMSADQLSKVLMAQGVRP 125

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK---MKNITVREYLIRTVLFSIP 188
              K  ++  + W  +V+  +       E ++ A        ++    EY +R V+  +P
Sbjct: 126 ETMKLRMSADTAWGALVRGRYKQSLMVSEHDVRAASGGDSSPQDTESYEYHLRPVVIFVP 185

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
                +   V++R K+AE  R R+ + C +       +   +I        +DL    + 
Sbjct: 186 RG--SSSAVVEQRKKEAEIIRDRV-QSCAEAATTFKSLRQGTIRDTIIKTSADLPANLRE 242

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
           LL K+   + T P VT++G+E + +CD++    +   K     +    K E     Y+  
Sbjct: 243 LLDKTPVGHMTPPEVTRQGIEMVVLCDRKVTSADTPAKRAARDKLFAQKYEAKSKSYLDD 302

Query: 308 LRSNAIIHY 316
           LR  A+I Y
Sbjct: 303 LRKAAMIEY 311


>gi|241203946|ref|YP_002975042.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857836|gb|ACS55503.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 89/316 (28%), Positives = 159/316 (50%), Gaps = 15/316 (4%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           D  K +T +       ++   +  + A +S ++  +NG  IT GD++KR A L+LQ    
Sbjct: 3   DAKKAITKFLAGAALALLTGFAGSALA-ASEVKAVVNGTAITSGDVAKRQAFLRLQHTKA 61

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
           +  K A ++LI E LK+QE+ +  ++     V+  F + +    LS E  S  LD+ G+G
Sbjct: 62  DA-KAAEEQLIDEALKRQEVTRVHMSVSQQDVDASFARFSSGNKLSPEQMSQILDRAGVG 120

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIP 188
            +HFK ++A+Q  WP VV   +         ++ +   +   +     EY+++ V+F IP
Sbjct: 121 VDHFKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQVIFVIP 180

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
             K        KR  +AE SR + P  C++ + FA+ + DVS+     +L  ++ P ++ 
Sbjct: 181 QAK--RGAITGKRKGEAEASRSKFP-GCDQAKVFAATMRDVSVRDLGRMLAPEIPPDWKP 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK--------IEKH 300
           L+++++ NTT   VT KGVEY+AIC +R +  + A +     ++              ++
Sbjct: 238 LVEQAKGNTTGTRVTDKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKGGKDASPENEN 297

Query: 301 EAEYVKKLRSNAIIHY 316
             +Y+ +LR  A I Y
Sbjct: 298 SKKYLDELRKKAQIAY 313


>gi|91977437|ref|YP_570096.1| hypothetical protein RPD_2969 [Rhodopseudomonas palustris BisB5]
 gi|91683893|gb|ABE40195.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 309

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 68/308 (22%), Positives = 133/308 (43%), Gaps = 10/308 (3%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K L     L +FC V +      A +  +   +NGE IT+ DI +R  L +L +      
Sbjct: 4   KFLFRILGLALFCTVTVGGGLGVATAQSVAVMVNGEPITNFDIEQRSKLDRLSRA-SRTR 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  + ELI E +K +E +K G++   + +   F   +    +S +  +  L  QGI    
Sbjct: 63  QQVLDELIDEKVKIREGKKYGVSPSDSDIESSFSTMSSRMRMSPDQMTKMLSAQGIRPET 122

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK-----MKNITVREYLIRTVLFSIP 188
            K  +  + +W  +V+  F       E +I A                EY +R V+  + 
Sbjct: 123 LKSKIKAEMVWASLVRGRFKDSLLVGEKDIQAQLGAKGGDEPATTESFEYQLRPVVLIV- 181

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
            ++  +   ++ R K+AE  R R+ + C   ++    + + +I        +DL    + 
Sbjct: 182 -SRGSDSSALEARRKEAESLRSRV-QSCADADRIFKALPNTAIRSTVVKTSADLPQALRE 239

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKK 307
           +L K+     T P  T++G+E +A+C ++    +   K  +  +    K +    EY+++
Sbjct: 240 ILDKTPVGQMTAPEATKQGIEMVALCSRKPTTADTPKKREIREKLFAEKFQAKSKEYLRE 299

Query: 308 LRSNAIIH 315
           +R+ A+I 
Sbjct: 300 VRNAAMIE 307


>gi|209548668|ref|YP_002280585.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534424|gb|ACI54359.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 89/316 (28%), Positives = 161/316 (50%), Gaps = 15/316 (4%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           D  K +T +       ++  V+  + A +S ++  +NG  IT GD++KR A ++LQ    
Sbjct: 3   DAKKAITKFLAGAALALLTGVAAPALA-ASEVKAVVNGTAITSGDVAKRQAFMRLQHTKA 61

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
           +  K A ++LI ETLK+QE+ +  ++     V+  F + +    LS E  S  LD+ G+G
Sbjct: 62  DA-KAAEEQLIDETLKRQEVSRVHMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVG 120

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIP 188
            +HFK ++A+Q  WP VV   +         ++ +   +   +     EY+++ ++F IP
Sbjct: 121 VDHFKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIP 180

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
             K        KR  +AE SR + P  C++ + FA+ + DVS+     +L  ++ P ++ 
Sbjct: 181 QAK--RNAITGKRKGEAEASRSKFP-GCDQAKVFAATMRDVSVRDLGRMLAPEIPPDWKP 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT--------KIEKH 300
           L+++++ NTT   VT KGVEY+AIC +R +  + A +     ++              ++
Sbjct: 238 LVEQAKGNTTGTRVTDKGVEYLAICSQRQVSDDQAAEMVFRQEDLGKAKGGKDASPENEN 297

Query: 301 EAEYVKKLRSNAIIHY 316
             +Y+ +LR  A I Y
Sbjct: 298 SKKYLDELRKKAQIAY 313


>gi|15888445|ref|NP_354126.1| hypothetical protein Atu1105 [Agrobacterium tumefaciens str. C58]
 gi|15156137|gb|AAK86911.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 315

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 86/293 (29%), Positives = 158/293 (53%), Gaps = 9/293 (3%)

Query: 28  VPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLK 86
           + +V Y   A + S ++  +N   IT+ DI++R+A LKLQ+ +G L + A ++L+ E LK
Sbjct: 23  MAVVPYAGQAFADSTVKIVVNKTPITNDDIARRVAFLKLQRQSGNLNEKAREQLVDEALK 82

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
           ++EI +  ++  +  V+  F + A N  +  E  +  L + G+G  HFK ++A+Q  WP 
Sbjct: 83  REEIARVKMSVSTQDVDAAFARFAGNNKMKPEQLTKVLAQAGVGAEHFKAFIAVQMSWPR 142

Query: 147 VVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
           +V   +  +      ++    K++ +     EY ++ V+F IP+ K        KR  +A
Sbjct: 143 LVNARYGARGKMSNQDLVTRLKERGEKPVTTEYFLQQVIFVIPEAK--RNAITGKRKAEA 200

Query: 206 EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQ 264
           E SR R P  C++   FA+ + DV+I     +L  +L   ++ L++K++   TT   VT+
Sbjct: 201 EASRKRYP-GCDQAMSFAATMRDVAIKDLGRILAPELPEDWKALVEKTKEGGTTGTRVTE 259

Query: 265 KGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIE---KHEAEYVKKLRSNAII 314
           KGVEY+AIC +R +  + A +    +++     +    +E +Y+++LR  A I
Sbjct: 260 KGVEYLAICKQRQVSDDYAAEMVFKSEDLMKAKDGENPNEKKYIEELRKKAQI 312


>gi|222148150|ref|YP_002549107.1| hypothetical protein Avi_1539 [Agrobacterium vitis S4]
 gi|221735138|gb|ACM36101.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 315

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 85/291 (29%), Positives = 150/291 (51%), Gaps = 8/291 (2%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQ 88
              +       + +   +N   IT+ D+++RIA LKL+   G++ K A QELI E LK+Q
Sbjct: 25  APATVTPALADTGVAVVVNKTAITNTDLARRIAFLKLRHETGDVAKKARQELIDEQLKRQ 84

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           EI + G++  +  V+  F + A +  LS +     LDK G+G  HFK Y+A+Q  WP +V
Sbjct: 85  EIARVGMSVSTMDVDQAFGRFAASNKLSTQQMGQILDKAGVGVEHFKAYIAVQMSWPRLV 144

Query: 149 KNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
              +  +      ++     +  +     EY ++ V+F +P  K        KR  +AE 
Sbjct: 145 NARYASRSKMSNQDMVTRLLENKQKPVTTEYTLKQVIFVVPVAK--RATLTAKRKAEAEA 202

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGV 267
           SR + P  C++   FA    DVSI     +++ +L   ++ L++ +   TT   VT++G+
Sbjct: 203 SRAKFP-GCDQAMDFAKNYLDVSIRDLGRVMKPELPDDWKPLIEGANGTTTGTRVTERGI 261

Query: 268 EYIAICDKRDLGGEIALKAYLSAQNTPT----KIEKHEAEYVKKLRSNAII 314
           EY+AIC+++ +  ++A +A   A++       K + +  +Y+ +LRS A I
Sbjct: 262 EYLAICNQKQVSDDLAAEAVFKAEDIGKEDKSKGDPNSEKYLTELRSKAQI 312


>gi|190891133|ref|YP_001977675.1| peptidyl-prolyl cis-trans isomerase [Rhizobium etli CIAT 652]
 gi|218517103|ref|ZP_03513943.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli 8C-3]
 gi|190696412|gb|ACE90497.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CIAT 652]
          Length = 314

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 87/318 (27%), Positives = 162/318 (50%), Gaps = 15/318 (4%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           ++D  K +T +       ++  ++  + A +S ++  +NG  IT GD++KR A L+LQ  
Sbjct: 1   MTDAKKAITAFLAGAALALLTGLAGPALA-ASEVQAVVNGTAITSGDVAKRQAFLRLQHT 59

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
             +  K A ++LI ETLK+QE+ +  ++     V+  F + +    LS    S  LD+ G
Sbjct: 60  AADA-KTAKEQLIDETLKRQEVARVHMSVSQQDVDASFARFSAGNKLSVAQMSQILDRAG 118

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +G +HFK ++A+Q  WP VV   +         ++ +   +   +     EY+++ ++F 
Sbjct: 119 VGVDHFKGFIAVQMSWPRVVNARYGSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFV 178

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+ K        KR  +AE SR + P  C++ + FA+ + DV++     +L  ++ P +
Sbjct: 179 IPEAK--RGAITGKRKGEAEASRSKFP-GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDW 235

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK--------IE 298
           + L+++++ NTT   VT KGVEY+AIC +R +  + A +     ++              
Sbjct: 236 KPLVEQAKGNTTGTRVTDKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPEN 295

Query: 299 KHEAEYVKKLRSNAIIHY 316
            +  +Y+ +LR  A I Y
Sbjct: 296 DNSKKYLDELRKKAQIAY 313


>gi|218661101|ref|ZP_03517031.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli IE4771]
          Length = 295

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 84/294 (28%), Positives = 150/294 (51%), Gaps = 14/294 (4%)

Query: 33  YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEK 92
                 +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +
Sbjct: 5   AGPALAASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVAR 63

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
             ++     V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +
Sbjct: 64  VRMSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARY 123

Query: 153 MLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                    ++ +   +   +     EY+++ ++F IP  K        KR  +AE SR 
Sbjct: 124 GSTSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAK--RAAITGKRKGEAEASRS 181

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYI 270
           + P  C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+
Sbjct: 182 KFP-GCDQSKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYL 240

Query: 271 AICDKRDLGGEIALKAYLSAQNTPTK--------IEKHEAEYVKKLRSNAIIHY 316
           AIC +R +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 241 AICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSKKYLDELRKKAQIAY 294


>gi|327188010|gb|EGE55240.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli CNPAF512]
          Length = 314

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 87/318 (27%), Positives = 163/318 (51%), Gaps = 15/318 (4%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           ++D  K +T +       ++  ++  + A +S ++  +NG  IT GD++KR A L+LQ  
Sbjct: 1   MTDAKKAITAFLAGAALALLTGLAGPALA-ASEVQAVVNGTAITSGDVAKRQAFLRLQHT 59

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
             +  K A ++LI ETLK+QE+ +  ++     V+  F + +    LS    S  LD+ G
Sbjct: 60  AADA-KTAKEQLIDETLKRQEVARVHMSVSQQDVDASFARFSAGNKLSVAQMSQILDRAG 118

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFS 186
           +G +HFK ++A+Q  WP VV   +         ++ +   +   +     EY+++ ++F 
Sbjct: 119 VGVDHFKGFIAVQMSWPRVVNARYGSTTRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFV 178

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           IP+ K        KR  +AE SR + P  C++ + FA+ + DV++     +L  ++ P +
Sbjct: 179 IPEAK--RGAITGKRKGEAEASRSKFP-GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDW 235

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK--------IE 298
           + L+++++ NTT   VT KGVEY+AIC +R +  + A +     ++              
Sbjct: 236 KPLVEQAKGNTTGTRVTDKGVEYLAICSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPEN 295

Query: 299 KHEAEYVKKLRSNAIIHY 316
           ++  +Y+ +LR  A I Y
Sbjct: 296 ENSKKYLDELRKKAQIAY 313


>gi|116251332|ref|YP_767170.1| hypothetical protein RL1566 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255980|emb|CAK07061.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 314

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 85/287 (29%), Positives = 148/287 (51%), Gaps = 14/287 (4%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDS 99
           S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI E LK+QE+ +  ++   
Sbjct: 31  SEVKAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAEEQLIDEALKRQEVARVRMSVSQ 89

Query: 100 NTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNL 159
             V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +       
Sbjct: 90  QDVDASFARFSSGNKLSPEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGSTSRLS 149

Query: 160 EMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
             ++ +   +   +     EY+++ ++F IP  K        KR  +AE SR + P  C+
Sbjct: 150 NYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAK--RGAITGKRKGEAEASRSKFP-GCD 206

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
           + + FA+ + DVS+     LL  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R 
Sbjct: 207 QAKVFAATMRDVSVRDLGRLLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQ 266

Query: 278 LGGEIALKAYLSAQNTPTK--------IEKHEAEYVKKLRSNAIIHY 316
           +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 267 VSDDQAAEMVFRQEDLDKSKAGKDASPENENSKKYLDELRKKAQIAY 313


>gi|218671035|ref|ZP_03520706.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli GR56]
          Length = 314

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 84/292 (28%), Positives = 148/292 (50%), Gaps = 14/292 (4%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSG 94
               +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  
Sbjct: 26  PALAASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVR 84

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           ++     V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +  
Sbjct: 85  MSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGS 144

Query: 155 KYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                  ++ +   +   +     EY+++ ++F IP  K        KR  +AE SR + 
Sbjct: 145 TSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAK--RAAITGKRKGEAEASRSKF 202

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAI 272
           P  C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AI
Sbjct: 203 P-GCDQAKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAI 261

Query: 273 CDKRDLGGEIALKAYLSAQNTPTKIEKH--------EAEYVKKLRSNAIIHY 316
           C +R +  + A +     ++                  +Y+ +LR  A I Y
Sbjct: 262 CSQRQVSDDQAAEMVFRQEDLDKSKAAKNGPPENENSKKYLDELRKKAQIAY 313


>gi|218461597|ref|ZP_03501688.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli Kim 5]
          Length = 313

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 84/292 (28%), Positives = 150/292 (51%), Gaps = 14/292 (4%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSG 94
               +S ++  +NG  IT GD++KR A L+LQ    +  K A ++LI ETLK+QE+ +  
Sbjct: 25  PALAASEVQAVVNGTAITSGDVAKRQAFLRLQHTKADA-KTAKEQLIDETLKRQEVARVR 83

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           ++     V+  F + +    LS E  S  LD+ G+G +HFK ++A+Q  WP VV   +  
Sbjct: 84  MSVSQQDVDASFARFSAGNKLSVEQMSQILDRAGVGVDHFKGFIAVQMSWPRVVNARYGS 143

Query: 155 KYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
                  ++ +   +   +     EY+++ ++F IP  K        KR  +AE SR + 
Sbjct: 144 TSRLSNYDLVSRMMQNNKQKPVTTEYMLQQIIFVIPQAK--RAAITGKRKGEAEASRSKF 201

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAI 272
           P  C++ + FA+ + DV++     +L  ++ P ++ L+++++ NTT   VT KGVEY+AI
Sbjct: 202 P-GCDQSKVFAATMRDVAVRDLGRMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAI 260

Query: 273 CDKRDLGGEIALKAYLSAQNTPTKIE--------KHEAEYVKKLRSNAIIHY 316
           C +R +  + A +     ++              ++  +Y+ +LR  A I Y
Sbjct: 261 CSQRQVSDDQAAEMVFRQEDLDKSKAGKNGPPENENSKKYLDELRKKAQIAY 312


>gi|13476523|ref|NP_108093.1| hypothetical protein mll7863 [Mesorhizobium loti MAFF303099]
 gi|14027284|dbj|BAB54238.1| mll7863 [Mesorhizobium loti MAFF303099]
          Length = 310

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 78/307 (25%), Positives = 142/307 (46%), Gaps = 14/307 (4%)

Query: 15  LLTTYFVLIIFCI-VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           L +  F L++    V +      A +S I+  +N   IT GDI+ R A LKLQ+  G+  
Sbjct: 8   LFSAGFALLVAATSVSMTVMTPPAFASEIKYVVNDIPITTGDIAHRAAFLKLQRKKGD-- 65

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A QE+I +TL+  E  + GI      V   + + A N  +        ++K G+G +H
Sbjct: 66  --AAQEMIDQTLRLAEARRLGIRISDAQVEAAYQRFATNNKMQLGQLDGVMEKSGVGKDH 123

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ----KMKNITVREYLIRTVLFSIPD 189
           FK+++  Q  W   +   +    G    E  A ++         +  EY+++ V+F +P 
Sbjct: 124 FKEFIRAQMAWNQALSARYRSGEGGSVTEQDAVRRMLDKGGAKPSATEYMLQQVIFVVPA 183

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +  +    + KR ++A+  R R    CN   +FA  + DV++     +L   L P +   
Sbjct: 184 S--ERSATLAKRKREADAMRARF-NGCNTTREFAKGLIDVTVRDLGRVLAPQLPPDWAEQ 240

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK-IEKHEAEYVKK 307
           +K ++    T    T++GVE+I IC  R++  +   +    ++ +  K  +    +YV +
Sbjct: 241 IKATKVGGATVTRETERGVEFIGICSSREVSDDKTAQMVFQSEGSNDKAADDLSKKYVDE 300

Query: 308 LRSNAII 314
           L++ A I
Sbjct: 301 LKAKARI 307


>gi|150395986|ref|YP_001326453.1| SurA domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150027501|gb|ABR59618.1| SurA domain [Sinorhizobium medicae WSM419]
          Length = 315

 Score =  269 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 161/312 (51%), Gaps = 11/312 (3%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +  +++L+   +     +    +  + A +S +   +NG VIT GD++KR+A L+LQ+ +
Sbjct: 5   NSIVRVLSAIALAGALSLATGTATTATAAASSVEVVVNGTVITSGDVAKRVAFLRLQRQS 64

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G     A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     L++ G+
Sbjct: 65  GGA-AEAKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFASGNKLSPEQLGKILEQAGV 123

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFM--LKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G +HFKQY+A+Q  WP VV   +    +    ++     +         EY ++ V+F I
Sbjct: 124 GIDHFKQYIAVQMSWPRVVNFRYGNASRLSGGDLVKRMMQGGGNKPVTTEYFLQQVIFVI 183

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           P++K        KR  +A  SR + P  C+  + FA+   DVSI     +L   L   ++
Sbjct: 184 PESK--RGAITAKRQAEANASRSKFP-GCDTSKAFAANYRDVSIRSLGRILAQQLPEDWK 240

Query: 248 NLLKKSQNNTTN-PYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK----IEKHEA 302
            L++K+ ++ T    VT+KGVEY+AIC KR +  + A +    A++   K     + + A
Sbjct: 241 PLVEKAGDSMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSGGEDPNSA 300

Query: 303 EYVKKLRSNAII 314
           +Y+++LRS A I
Sbjct: 301 KYLEELRSKAQI 312


>gi|260466949|ref|ZP_05813131.1| SurA domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259029246|gb|EEW30540.1| SurA domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 307

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 76/307 (24%), Positives = 144/307 (46%), Gaps = 14/307 (4%)

Query: 15  LLTTYFVLIIFCI-VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           L +  F L++    V +      A +S I+  +N   IT GDI+ R A LKLQ+  G+  
Sbjct: 5   LFSAGFALLVAATSVSMTVMTPPAFASEIKYVVNNVPITTGDIAHRAAFLKLQRKKGD-- 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A QE+I +TL+  E  + GI      V   + + A +  +     +  ++K G+G +H
Sbjct: 63  --AAQEMIDQTLRLAEARRLGIRISDAQVEAAYQRFATSNKMQLSQLNGVMEKSGVGKDH 120

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ----KMKNITVREYLIRTVLFSIPD 189
           FK+++  Q  W   +   +    G    E  A ++         +  EY+++ V+F +P 
Sbjct: 121 FKEFIRAQMAWNQALGARYRSGEGGSVTEQDAVRRMLDKGGAKPSATEYMLQQVIFVVPA 180

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +  +    + KR ++A+  R R    C    +FA  + DV++     +L   L P +   
Sbjct: 181 S--ERSATLAKRKREADAMRARF-NGCTTTREFAKGLIDVTVRDLGRVLAPQLPPDWAEQ 237

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKI-EKHEAEYVKK 307
           +K ++    T    T++GVE+I IC  R++  +   +    ++ +  K  ++   +YV++
Sbjct: 238 IKATKVGGATVTRETERGVEFIGICSSREVSDDKTAQMVFQSEGSSDKNADELSKKYVEE 297

Query: 308 LRSNAII 314
           L++ A I
Sbjct: 298 LKAKAHI 304


>gi|15964904|ref|NP_385257.1| hypothetical protein SMc00581 [Sinorhizobium meliloti 1021]
 gi|15074083|emb|CAC45730.1| Hypothetical protein SMc00581 [Sinorhizobium meliloti 1021]
          Length = 316

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 95/312 (30%), Positives = 157/312 (50%), Gaps = 12/312 (3%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +  ++LL+   +     +       + A +S +   +N  VIT GD++KR+A LKLQ+ +
Sbjct: 7   NAIVRLLSAVALAGALSVAAGTVTTAMA-ASTVEVVVNSTVITSGDVAKRVAFLKLQRQS 65

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G     A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     LD+ G+
Sbjct: 66  GGA-AEAKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFAAGNKLSPEQLGKILDQAGV 124

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSI 187
           G +HFKQY+A+Q  WP VV   +         ++     +         EY ++ V+F I
Sbjct: 125 GVDHFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMQGGGNKPVTTEYFLQQVIFVI 184

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           P++K        KR  +A  SR + P  C+  + FA+   DVSI     +L   L   ++
Sbjct: 185 PESK--RGAITAKRQAEANASRSQFP-GCDTSKAFAANYRDVSIRSLGRILAQQLPEDWK 241

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK----HEA 302
            L++K+    TT   VT+KGVEY+AIC KR +  + A +    A++   K  +    + A
Sbjct: 242 PLVEKAGDGMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSEGEDPNSA 301

Query: 303 EYVKKLRSNAII 314
           +Y+++LRS A I
Sbjct: 302 KYLEELRSKAQI 313


>gi|307300974|ref|ZP_07580743.1| SurA domain protein [Sinorhizobium meliloti BL225C]
 gi|307317709|ref|ZP_07597147.1| SurA domain protein [Sinorhizobium meliloti AK83]
 gi|306896471|gb|EFN27219.1| SurA domain protein [Sinorhizobium meliloti AK83]
 gi|306903929|gb|EFN34515.1| SurA domain protein [Sinorhizobium meliloti BL225C]
          Length = 315

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 95/312 (30%), Positives = 157/312 (50%), Gaps = 12/312 (3%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +  ++LL+   +     +       + A +S +   +N  VIT GD++KR+A LKLQ+ +
Sbjct: 6   NAIVRLLSAVALAGALSVAAGTVTTAMA-ASTVEVVVNSTVITSGDVAKRVAFLKLQRQS 64

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G     A Q+L+ E LK+ EI +   +  ++ V+  F + A    LS E     LD+ G+
Sbjct: 65  GGA-AEAKQQLVDEVLKRAEIARVQQSVSTDEVDAAFARFAAGNKLSPEQLGKILDQAGV 123

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSI 187
           G +HFKQY+A+Q  WP VV   +         ++     +         EY ++ V+F I
Sbjct: 124 GVDHFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMQGGGNKPVTTEYFLQQVIFVI 183

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           P++K        KR  +A  SR + P  C+  + FA+   DVSI     +L   L   ++
Sbjct: 184 PESK--RGAITAKRQAEANASRSQFP-GCDTSKAFAANYRDVSIRSLGRILAQQLPEDWK 240

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK----HEA 302
            L++K+    TT   VT+KGVEY+AIC KR +  + A +    A++   K  +    + A
Sbjct: 241 PLVEKAGDGMTTGTRVTEKGVEYLAICKKRQVNDDAAAEIVFRAEDLGKKKSEGEDPNSA 300

Query: 303 EYVKKLRSNAII 314
           +Y+++LRS A I
Sbjct: 301 KYLEELRSKAQI 312


>gi|227821473|ref|YP_002825443.1| putative survival protein SurA, probable peptidyl-prolyl cis-trans
           isomerase protein [Sinorhizobium fredii NGR234]
 gi|227340472|gb|ACP24690.1| putative survival protein SurA, probable peptidyl-prolyl cis-trans
           isomerase protein [Sinorhizobium fredii NGR234]
          Length = 312

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 93/309 (30%), Positives = 153/309 (49%), Gaps = 11/309 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           I ++     L +  ++ I S  +   +S ++  +N  VIT GDI+KR+A L+LQ+  G  
Sbjct: 5   ISIVRALSALAVAGVLSIASGAAVQAASGVKVIVNSTVITSGDIAKRVAFLRLQRQGGGA 64

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
              A ++L+ E LK+ EI +   +  +  V+  + + A    LS E     LD+ G+G  
Sbjct: 65  -AEAEKQLVDEVLKRAEIARVQQSVSTQEVDAAYARFAAGNKLSTEQLGKILDQSGVGIE 123

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPDN 190
           HFKQY+A+Q  WP VV   +         ++     +         EY ++ V+F IP++
Sbjct: 124 HFKQYIAVQMSWPRVVNFRYGSASRLSGGDLVKRMMEGGGNKPVTTEYFLQQVIFVIPES 183

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
           K        KR  +A  SR + P  C   + FA+   DVSI     +L   L   ++ L+
Sbjct: 184 K--RGAITAKRQAEANASRSQFP-GCETSKAFAANYRDVSIRSLGRVLAQQLPEDWKPLV 240

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK----IEKHEAEYV 305
           +K+    TT   VT+KGVEY+AIC KR +  + A +    A++   K     + +  +Y+
Sbjct: 241 EKAGDGTTTGTRVTEKGVEYLAICKKRQVNDDAAAEVVFRAEDIGKKKAGGEDPNSEKYL 300

Query: 306 KKLRSNAII 314
           ++LRS A I
Sbjct: 301 EELRSKAQI 309


>gi|148255225|ref|YP_001239810.1| hypothetical protein BBta_3828 [Bradyrhizobium sp. BTAi1]
 gi|146407398|gb|ABQ35904.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 312

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 62/310 (20%), Positives = 133/310 (42%), Gaps = 12/310 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKS---WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
            ++    +  C + +++  +    A +  I   +NG+ ITD DI +R+ L  L     + 
Sbjct: 5   FSSRLRALAICSLAVLASGAGLIPAQAQSIVVMVNGDPITDYDIEQRMKLNFLSTRKQQS 64

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  + ELI + +K +E +K G+   ++ V+  F        L+AE  +  L+ QG+   
Sbjct: 65  RQEVINELIDDKVKIKEGKKFGVEPTASDVDQSFAGMGSRMRLNAEQLTKSLESQGVRPE 124

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLE-----MEIPANKQKMKNITVREYLIRTVLFSI 187
             K  +  + +W  +V+  +  +    +         A     +     EY ++ ++  +
Sbjct: 125 TLKARIKAEIVWTSLVRGRYKERLLVSDKDVAAAVAAAGGDSDQQGQAFEYKMQPIVLIV 184

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
            ++   NQ  ++ R K+AE  R R+ + C           +  I +      +D+ P  +
Sbjct: 185 SNS--SNQAVMEARHKEAEALRARV-QTCADANNVFKTTANAVIKEIVVKTSADIPPNLR 241

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVK 306
            LL  +   + T P  T++G++ +A+C +     +   K  +  +    K E     Y++
Sbjct: 242 KLLDDTPIGHLTPPEATKQGIQMVALCARTPTTVDTPKKRQIREEMYTKKYEATSKAYLQ 301

Query: 307 KLRSNAIIHY 316
           ++R  A+I Y
Sbjct: 302 EVRKAAMIEY 311


>gi|39936127|ref|NP_948403.1| hypothetical protein RPA3064 [Rhodopseudomonas palustris CGA009]
 gi|192291845|ref|YP_001992450.1| SurA domain [Rhodopseudomonas palustris TIE-1]
 gi|39649981|emb|CAE28505.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
 gi|192285594|gb|ACF01975.1| SurA domain [Rhodopseudomonas palustris TIE-1]
          Length = 308

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 64/287 (22%), Positives = 132/287 (45%), Gaps = 8/287 (2%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKS 93
            +   +  +   +NGE IT+ DI +R  L ++     +  +  +++LI E +K +E +K 
Sbjct: 25  TTQGQAQSVVVMVNGEPITNFDIDQRSKLNRMSH-KADSRQQVLEDLIDEKVKIKEAKKY 83

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
           G+    + ++  F   A    +S    ++ L  QGI  +  K  +  + +W  +V+  F 
Sbjct: 84  GVNPSDSDIDSSFSTMASRMRMSTAQMTNMLAAQGIRPDTLKSRIRAEMVWASLVRGRFK 143

Query: 154 LKYGNLEMEIPANKQKM---KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                 E E+ A  +     K +   EY +R V+  +    +     +  R K+AE+ R 
Sbjct: 144 DSLQVSEREVQAQLKGGDDTKAVESFEYQLRPVVMIVSRGSVSES--LDARRKEAEQLRG 201

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEY 269
           R+   C + ++    + + +I        +DL P  + +L K+   + T P VT++G+E 
Sbjct: 202 RIS-SCAEADRVFKAMPNAAIRGIVIKTSADLPPALREILDKTPVGHLTPPEVTKQGIEM 260

Query: 270 IAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +A+C+++    +   K  +  +    K +    EY++++R  A+I Y
Sbjct: 261 VALCERKQSTADTPRKREIREKLFGEKFQAKSKEYLQEVRKAAMIEY 307


>gi|110634111|ref|YP_674319.1| putative survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Mesorhizobium sp. BNC1]
 gi|110285095|gb|ABG63154.1| putative survival protein surA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Chelativorans sp. BNC1]
          Length = 312

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 73/288 (25%), Positives = 138/288 (47%), Gaps = 7/288 (2%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEI 90
            +      ++ IR  +N   IT  DI +R ALL+L +  G + ++A +E+I +TL++QE+
Sbjct: 25  AATILPVDATEIRYVVNDRPITSFDIERRAALLRLMQRKGNVNELAAEEMIDQTLRQQEM 84

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
            +SG+      V+  +   A +  ++       L + G+G  HFK+++  Q  W  V+++
Sbjct: 85  ARSGVNITQAMVDESYRNFAGSNNMTVAQLDQILGQAGVGKEHFKEFIRTQIGWGRVMQS 144

Query: 151 DFMLKYGNLEMEIPAN--KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
                    E ++     +Q  +  T  EY+++ V+F +P    Q    + KR ++A+  
Sbjct: 145 RSRSGTILSEQDVVQKMLQQGGQKPTATEYMLQQVIFVVP--AAQRGQLLAKRKREAQAM 202

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGV 267
           R R    C    +FA  + DV++     +L  +L P++++ +  +   N T    T++GV
Sbjct: 203 RDRF-NGCANTVQFAKGLIDVTVRDMGRVLAPELPPEWKDQISNTRPGNATPIRETERGV 261

Query: 268 EYIAICDKRDLGGEIALKAYLS-AQNTPTKIEKHEAEYVKKLRSNAII 314
           E+I IC  R++  +   +      Q      E    EY+ +LR  A I
Sbjct: 262 EFIGICSAREVSDDHVARMVFQSQQAGDGSFEDAAKEYMAELRKKARI 309


>gi|146340301|ref|YP_001205349.1| hypothetical protein BRADO3324 [Bradyrhizobium sp. ORS278]
 gi|146193107|emb|CAL77118.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 287

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 64/286 (22%), Positives = 126/286 (44%), Gaps = 9/286 (3%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT 96
           A +  I   +NG+ ITD DI +R  L  L     +  +  + ELI + +K +E +K G+ 
Sbjct: 4   AHAQSIVVMVNGDPITDYDIEQRSKLNFLSTHKQQSRQEVLNELIDDKVKIKEGKKFGVE 63

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
             S+ ++  F        L+AE  +  L+ QG+     KQ +  + +W  +V+  +  + 
Sbjct: 64  PSSSDIDQSFAGMGSRMRLNAEQLTRSLESQGVRPETLKQRIKAEIVWTSLVRGRYKERL 123

Query: 157 GNLE-----MEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
              +         A     +     EY ++ V+  +P++   NQG ++ R K+AE  R R
Sbjct: 124 FVSDKDVAAAVAAAGGDTGQQGQSFEYKMQPVVLIVPNS--SNQGAMEIRQKEAEALRGR 181

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYI 270
           + + C      +    +  + +      +D+ P  + LL  +   + T P  T++G++ +
Sbjct: 182 V-QSCADANNISRTTANAVVKEIVVKTSADIPPNLRKLLDDTPIGHLTPPEATKQGIQMV 240

Query: 271 AICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           A+C +     +      +  Q    K E     Y++++R  A+I Y
Sbjct: 241 ALCARTPTTVDTPKAREIKEQMYAKKYEATSKAYLQEVRKAAMIEY 286


>gi|90419499|ref|ZP_01227409.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336436|gb|EAS50177.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 346

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 82/302 (27%), Positives = 141/302 (46%), Gaps = 8/302 (2%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAV 77
            + +          +  S   +S I+  +NG  IT   I +R A L+L+++ G   + A 
Sbjct: 45  AFVLAGSAAATLPATTVSVQAASEIKAVVNGMPITSYQIRQRAAFLQLRRVGGNATQKAT 104

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
            ELI E LKKQEI + GI      V+  F + A    L+ E     L + G   + FK Y
Sbjct: 105 DELIDEALKKQEIGRRGIAIPDEAVDEAFGRFAAENKLTREQLGQVLSRAGFSSDGFKDY 164

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANK--QKMKNITVREYLIRTVLFSIPDNKLQNQ 195
           + +Q  W   V+ +        E ++      Q  +  +  EY ++ V+F IPD   Q  
Sbjct: 165 IRVQMGWGQAVQANMRSTERLSEQDVVQRMLAQGGEKPSTTEYTLQQVIFVIPD--AQRS 222

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ- 254
             + +R ++AE  R R  + C    +FA  + DV++     + + +L P+++  ++ +  
Sbjct: 223 ALMAQRKREAESMRSRF-QSCESTYEFAKGLRDVTVRDLGRVAQPELPPRWKKDIQATSV 281

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAE--YVKKLRSNA 312
             TT    T++GVE+IA+C+ R++  + A      A+      E+ E +  Y+KKLR  A
Sbjct: 282 GRTTPAQATERGVEFIAVCNTRNISDDKAAALVFQAREMEKLGEQAEPDAAYLKKLRDRA 341

Query: 313 II 314
            I
Sbjct: 342 QI 343


>gi|325292484|ref|YP_004278348.1| survival protein surA precursor / peptidyl-prolyl cis-trans
           isomerase SurA [Agrobacterium sp. H13-3]
 gi|325060337|gb|ADY64028.1| putative survival protein surA precursor / peptidyl-prolyl
           cis-trans isomerase SurA [Agrobacterium sp. H13-3]
          Length = 315

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 85/293 (29%), Positives = 158/293 (53%), Gaps = 9/293 (3%)

Query: 28  VPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLK 86
           + +  + S A + S ++  +N   IT+ DI++R+A LKLQ+ +G L + A ++L+ E LK
Sbjct: 23  MAVAPFASQAFADSTVKIVVNKTPITNDDIARRVAFLKLQRQSGNLAEKAREQLVDEALK 82

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
           ++EI +  ++  +  V+  F + A N  ++ +  +  L K G+G +HFK ++A+Q  WP 
Sbjct: 83  REEIGRVKMSVSTQEVDAAFARFAANNKMNPQQLTQILSKAGVGADHFKAFIAVQMSWPR 142

Query: 147 VVKNDFMLKYGNLEMEIPANKQ-KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
           +V   +  +      ++    + +       EY ++ V+F IP++K        KR  +A
Sbjct: 143 LVNARYGARGKMSNQDLVTRLRERGDKPVTTEYFLQQVIFVIPESK--RNAITGKRKAEA 200

Query: 206 EESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQ 264
           E SR R P  C++   FA+ + DV+I     +L  +L  +++ L++K++   TT   VT+
Sbjct: 201 EASRKRYP-GCDQAMTFAATMRDVAIKDLGRILAPELPEEWKPLVEKTKEGGTTGTRVTE 259

Query: 265 KGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEK-HEAEYVKKLRSNAII 314
           KGVEY+AIC +R +  + A +    ++        E  +E +Y+ +LR  A I
Sbjct: 260 KGVEYLAICKQRQVSDDYAAEMVFKSEDLMKAKGGENPNEKKYMDELRKKAQI 312


>gi|319784426|ref|YP_004143902.1| SurA domain [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170314|gb|ADV13852.1| SurA domain [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 309

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 75/309 (24%), Positives = 142/309 (45%), Gaps = 16/309 (5%)

Query: 15  LLTTYFVLIIFCI-VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           L +  F L++    V I      A +S I+  +N   +T GDI+ R A LKLQ+  G+  
Sbjct: 5   LFSAGFALLVAATSVSITVMAPPAFASEIKYVVNDIPVTTGDIAHRAAFLKLQRKKGD-- 62

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
             A QE+I +TL+  E ++ GI      V+  + + A +  +        ++K G+  +H
Sbjct: 63  --AGQEMIDQTLRMAEAKRLGIRISDAQVDAAYQRFASSNKMQLSQLDGVMEKSGVTKSH 120

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYG---NLEMEIPAN--KQKMKNITVREYLIRTVLFSIP 188
           FK+++  Q  W   +   +    G     E ++     ++     +  EY+++ V+F +P
Sbjct: 121 FKEFIRAQMAWNQALSARYRSGDGTGAVSEQDLVRKMLEKGGAKPSATEYMLQQVIFVVP 180

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN 248
               +    + KR ++A+  R R    CN   +FA  + DV++     +L   L P +  
Sbjct: 181 --AAERSATLGKRKREADAMRARF-NGCNTTREFAKGLIDVTVRDLGRVLAPQLPPDWAE 237

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTP--TKIEKHEAEYV 305
            +K ++    T    T++GVE+I IC  R++  +   +    A+ +      +    +YV
Sbjct: 238 QIKATKVGGATVTRETERGVEFIGICSSREVSDDKVAQMAFQAEGSGGDKDADALSKKYV 297

Query: 306 KKLRSNAII 314
            +L++ A I
Sbjct: 298 DELKAKARI 306


>gi|27379215|ref|NP_770744.1| hypothetical protein bll4104 [Bradyrhizobium japonicum USDA 110]
 gi|27352366|dbj|BAC49369.1| bll4104 [Bradyrhizobium japonicum USDA 110]
          Length = 313

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 62/287 (21%), Positives = 127/287 (44%), Gaps = 8/287 (2%)

Query: 35  SWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSG 94
           + + +  I   +NG+ ITD DI +R  L  L        +  + ELI + +K +E +K G
Sbjct: 27  TPSRAQNIVVMVNGDPITDFDIDQRSKLDLLTTQKTPSRQEVINELIDDRVKLKEGKKYG 86

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           +    + +N  F   A+   ++ +  +  L+ +G+     K  +  + +W  +V+  F  
Sbjct: 87  VDPGVSDINQSFEGMAQRMRITTDQLTKSLEVKGVRPETLKARMKSEMVWTSLVRGRFKE 146

Query: 155 KYGNLEMEIPANKQKMK----NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
           K    E ++    Q        I   EY ++ ++  +P     +  F + R+K+AE+ R 
Sbjct: 147 KLMVGERDVAQAVQAQAGDKLQIEGTEYKMQPIVLIVPRG--SSPAFQETRMKEAEQYRS 204

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEY 269
           R+   C +         + +I ++     ++L    + +L  +   + T P VT+ G+E 
Sbjct: 205 RV-ASCEEANSLFRSTPNATIRESVTKTTAELPEALRKVLDDTPIGHLTAPEVTKAGIEM 263

Query: 270 IAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + +C ++    +   K  +  +    K EK +  Y+ +LR  A+I Y
Sbjct: 264 VVLCSRKPTMIDTPKKREVREKMYQEKYEKTQKAYLDELRKAAMIEY 310


>gi|254473455|ref|ZP_05086852.1| SurA N-terminal domain family protein [Pseudovibrio sp. JE062]
 gi|211957571|gb|EEA92774.1| SurA N-terminal domain family protein [Pseudovibrio sp. JE062]
          Length = 313

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 80/311 (25%), Positives = 139/311 (44%), Gaps = 16/311 (5%)

Query: 18  TYFVLIIFCIVPIVS-----YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--NG 70
           T F   +F    I++       S   +S+I   +NG  IT  ++ +R  L+ L     + 
Sbjct: 4   TRFCASLFVAASILAPVGPMLTSAEAASKIVAVVNGRPITSYELQQRSKLISLTTRAPSS 63

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
             ++ A  ELI E LK  E ++ G++   + V+  F   A+   +S   F   L + G+ 
Sbjct: 64  IAKRKAKDELIDEALKLAEAKRVGVSISDSKVDDAFATIAQRVKMSPSQFKQALSQSGVN 123

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN-----ITVREYLIRTVLF 185
               K  L  +  W +VV   F       E ++ A  Q  +N      T  EY ++ ++F
Sbjct: 124 PRTLKSRLRAEISWSEVVMQRFRATVRINESDVIAALQGRENKDDSGATSVEYDLQRIIF 183

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            IP N   ++ F  KR+ + ++ R R    C +  + AS +++V +      LE+DL P 
Sbjct: 184 VIPKN--SSKTFKNKRVSEMKKLRARF-TSCEEGTRLASGLNEVVVRPIGKRLETDLPPA 240

Query: 246 F-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           F + L + S    T P     G E IA+C K  +  +   ++ +  +    K ++    Y
Sbjct: 241 FVKKLNEISIGRVTAPTPVDSGFEMIALCGKETINSDATARSTIEGELRNKKGQQLSRRY 300

Query: 305 VKKLRSNAIIH 315
           ++ LRSNA+I 
Sbjct: 301 LRDLRSNAVIE 311


>gi|163759133|ref|ZP_02166219.1| hypothetical protein HPDFL43_05195 [Hoeflea phototrophica DFL-43]
 gi|162283537|gb|EDQ33822.1| hypothetical protein HPDFL43_05195 [Hoeflea phototrophica DFL-43]
          Length = 283

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 145/281 (51%), Gaps = 6/281 (2%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITF 97
            +S I+  +N + IT  DI++R+A L+LQ+  G L+  A ++LI E+LK QE  +     
Sbjct: 2   AASEIKIVVNKQAITSVDIARRVAFLRLQRTGGNLQAKAREQLIEESLKYQEALRIRAVV 61

Query: 98  DSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
               ++  + +  ++  LS +  +  L++ G+   HFK ++ +Q  WP VV+       G
Sbjct: 62  SQAQIDASYARFGKSNNLSVKQLNQVLNQAGVTPQHFKDFIRVQMSWPRVVQALEGTSGG 121

Query: 158 NLEMEIPANK---QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
            +  +   +K   +     +  EY+++ V+F +P NK  N   +  R ++AE+ R R  +
Sbjct: 122 GMSTQDLVSKMLERGDDKPSTTEYILQQVIFVVPSNKRSN-ATLNARKREAEQLRGRY-Q 179

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
            C       + + DV++     +++  L P ++ L++K++   TT   +T +GVE+I IC
Sbjct: 180 GCENAAAAVTGLRDVTLRNLGRIMQPQLPPDWKPLIEKTEAGATTPTRITDRGVEFIVIC 239

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             + +  + A +    A+N+     +   +++ KLR +A+I
Sbjct: 240 SSKTVSDDRAAELVFRAENSDAGDSETAKKHLAKLRESAVI 280


>gi|158425946|ref|YP_001527238.1| hypothetical protein AZC_4322 [Azorhizobium caulinodans ORS 571]
 gi|158332835|dbj|BAF90320.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 302

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 61/305 (20%), Positives = 136/305 (44%), Gaps = 8/305 (2%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           + + +   ++ C + +         +++   ++G+ IT  D+++R+ L +L +     +K
Sbjct: 1   MTSAFRRFLLVCALALPVLAPGVALAQVLVMVSGQPITSNDVAQRMKLHQLIENKSPPQK 60

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
             ++ELI E +K  +  +  I  D + VN  F   A  +G +A+  ++   + G+    F
Sbjct: 61  QVLEELIDEKIKVLQAARFSIEADEDDVNRMFSNIAERSGRTADQLTASFAQSGLKVQTF 120

Query: 135 KQYLAIQSIWPDVVKNDF-MLKYGNLEMEIPANKQKMKNI-TVREYLIRTVLFSIPDNKL 192
           K  L    +W   V+    ++   + ++    NKQ   +  T  EY++R ++  +     
Sbjct: 121 KDKLRADYVWGQYVRARAPVVNIRDSDVIAALNKQGNADAFTATEYVLRPIILVVGGG-- 178

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK 252
                   R+ +A   R +    C+   +    + +  +      L S++  + + +L K
Sbjct: 179 --SNAYGSRLAEANALRAKF-NGCDAGLQMIKGMKETVVRSPINRLSSEIPEKMRAVLDK 235

Query: 253 SQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++    T P V+Q GVE  A+C+KR + GE + K  +  + +  + ++     + +LR  
Sbjct: 236 TEVGRLTPPEVSQSGVETFAVCEKRTVKGESSKKRDIKDELSNAQFQEQSKRMMAELRKT 295

Query: 312 AIIHY 316
            +I Y
Sbjct: 296 MLIQY 300


>gi|154246774|ref|YP_001417732.1| putative peptidyl-prolyl cis-trans isomerase SurA [Xanthobacter
           autotrophicus Py2]
 gi|154160859|gb|ABS68075.1| putative peptidyl-prolyl cis-trans isomerase SurA [Xanthobacter
           autotrophicus Py2]
          Length = 303

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 67/283 (23%), Positives = 130/283 (45%), Gaps = 7/283 (2%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
            A + +I   +NG+ IT  D+S+R  + ++ +      + A+++LI E +K Q+  +  +
Sbjct: 23  PAQAQQIIVMVNGDPITTFDVSQRQLMHQMIERKSVSAQQALEDLIDERIKIQQAIRLKM 82

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM-L 154
             +   V+  +   A  +G + E  +    +QG+ D  FKQ L    +W   V+     +
Sbjct: 83  EVEQKDVDRLYASVAERSGRTPEQLTEGFKQQGLNDRTFKQKLFADYVWGQYVRARSGTV 142

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
              + ++     K+    +   EY +  ++F +P N          R+ +A   R R   
Sbjct: 143 NVRDADVVAALQKRGETQMIATEYTLMPIVFVVPRNAGNYAA----RLAEANALRGRF-T 197

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
           DC+   +    + +V +      L S++ PQ + +L K++    T P V Q GVE  AIC
Sbjct: 198 DCDAGAQTVKSLKEVVVRPKVTRLSSEMPPQLRQILDKTEIGRLTPPEVAQSGVETFAIC 257

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            KR++ GE A K  +  + +  +      +++ +LR  ++I Y
Sbjct: 258 GKREVRGESAQKKEIKDELSNAQFAAESKKFMAELRKQSLIEY 300


>gi|307946740|ref|ZP_07662075.1| SurA N- domain family [Roseibium sp. TrichSKD4]
 gi|307770404|gb|EFO29630.1| SurA N- domain family [Roseibium sp. TrichSKD4]
          Length = 291

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 72/293 (24%), Positives = 130/293 (44%), Gaps = 9/293 (3%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--ELEKIAVQELIVETLKK 87
           +  +     S+ I+  +NG+ IT  DI++R  L++L + +      + A +ELI + L+ 
Sbjct: 1   MGGFGLTPASAGIKVVVNGKPITTYDINQRAKLIRLIQRSSVAASRREAEKELIDDRLRL 60

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           +E  + G+      VN  +   ARN  L+    ++ L + G+     K  L  Q  +   
Sbjct: 61  EEASRIGVKISEAEVNNAYANIARNVKLTPAKLTAGLRQSGVNPQTLKDRLKAQLAFQQS 120

Query: 148 VKNDFMLKYGNLEMEIPANKQK---MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
           V+  F  +    E +I    +K          EY ++ V+  +P  K  ++GF  KR+ +
Sbjct: 121 VRRRFNSQVDVDESDIINALRKSDDENKNISVEYNLQRVIVVVP--KKSSKGFRNKRLAE 178

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH-PQFQNLLKKSQNNTTNPYVT 263
           +   R +    C+       K  +V +      LE++L  P  + + K +    T+P  T
Sbjct: 179 SNSIR-KAVTACDSAGAVFGKYSEVVVQPIGRRLETELPEPMRKEISKTTPGKLTSPRKT 237

Query: 264 QKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + G E IA+C KR++  +IA +  L  +    + E     Y+  LR  A I Y
Sbjct: 238 EVGFEMIAVCGKREIASDIAARTELENELRAKEGEALTRRYLMDLRRRASIVY 290


>gi|298291093|ref|YP_003693032.1| SurA domain protein [Starkeya novella DSM 506]
 gi|296927604|gb|ADH88413.1| SurA domain protein [Starkeya novella DSM 506]
          Length = 326

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 64/311 (20%), Positives = 126/311 (40%), Gaps = 9/311 (2%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
             +      V  +     + ++   A +  I   + G+ IT  D+++RI L +L +    
Sbjct: 18  IAERAARTLVAGMVAACALAAFPGAASAQGILVMVQGQPITSFDVAQRIKLAQLTERLSL 77

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
            +K A+++LI E LK    E+ G+T D + +   F + A  +G + +  +  L + G+  
Sbjct: 78  SQKQALEDLIDERLKIITAERGGVTADKDEIEKMFARMANRSGRTPDQLTQALTQSGLDA 137

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK-----MKNITVREYLIRTVLFS 186
              K  +    +W   V+  +       + ++ A  Q       K     EY IR V+  
Sbjct: 138 RMLKTKMRADYVWNSYVRGRYSSAATVRDSDVFAALQTKGEDLTKAQRTTEYTIRQVVLV 197

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           +   +  N     +R+ +A   R      C+        + +  +        +D+    
Sbjct: 198 V--GRTANPAQRSQRMAEANSLRKSF-TSCDGGVATVRGMREAVVRDPVIRTSADMSEGV 254

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV 305
           + ++  +     T P VT+ G+E +AIC +R++ GE A K  + A     + E      +
Sbjct: 255 RKVMDSTPVGQLTPPEVTRAGIEMVAICARREVVGESAQKREVRADLETKQFEAVSKRLL 314

Query: 306 KKLRSNAIIHY 316
            + R  A+I Y
Sbjct: 315 AEARKGAMIQY 325


>gi|114704782|ref|ZP_01437690.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Fulvimarina pelagi HTCC2506]
 gi|114539567|gb|EAU42687.1| survival protein sura precursor (peptidyl-prolyl cis-trans
           isomerase sura) [Fulvimarina pelagi HTCC2506]
          Length = 308

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 70/274 (25%), Positives = 123/274 (44%), Gaps = 9/274 (3%)

Query: 47  NGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFF 106
           NG  +T   I +R A LKL+++ G   + A  ELI E LK+QEI++ G+      VN  +
Sbjct: 35  NGMPVTTYQIRQRAAFLKLRRVGGNTTQKATDELIDEALKRQEIQRQGVNIPDEEVNAAY 94

Query: 107 VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN 166
           +  A+   LS    +  L   G     FK Y+ +Q  W          +    E +    
Sbjct: 95  LNFAKGNNLSEAQLAEVLGSAGFSPQAFKDYIRVQMGWGQAASRRIQREERLTEQDAVQR 154

Query: 167 K--QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
              Q  +  +  EY ++ V+F IP+   Q    +  R ++A+  R R  + C+    FA 
Sbjct: 155 MLAQGGEKPSTTEYTLQQVIFVIPNG--QRGAMLANRKREAQAMRQRF-QSCDSTLAFAQ 211

Query: 225 KIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
            + DV++     + + +L   ++ ++++ S    T    T +GVE+I +C+ R +  + A
Sbjct: 212 GLRDVTVRDLGRVAQPELPSLWKEDVMQTSPGRATPTKETDRGVEFIGVCNARQISDDRA 271

Query: 284 LKAYLSAQNT---PTKIEKHEAEYVKKLRSNAII 314
            +    A++           +A  +KKLR  A I
Sbjct: 272 AQMVFQARDMESLNGDGSGADAALLKKLRDEAQI 305


>gi|328544014|ref|YP_004304123.1| SurA N-terminal domain family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413758|gb|ADZ70821.1| SurA N-terminal domain family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 307

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 66/285 (23%), Positives = 135/285 (47%), Gaps = 9/285 (3%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALLKLQKING--ELEKIAVQELIVETLKKQEIEKSGI 95
             + I+  +N + IT  DI++R  L+ L +        ++A +EL+ + LK +E ++ GI
Sbjct: 25  AQTSIKVVVNEQAITSYDIAQRARLITLTQRKSGETARRMAQEELVDDVLKLKEAQRIGI 84

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
           +     V+  F   A+   +S  + ++ L + G+  +  +  L  +  W   V   F  +
Sbjct: 85  SVSKGDVDDAFASIAQRVKMSPANLAAALRQSGVDPDTLRARLRAEVAWSRAVGQRFRAQ 144

Query: 156 YGNLEMEIPANKQKMK---NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRL 212
               + ++ A  QK +        E+ +R V+F +P     + G   +R ++A++ R   
Sbjct: 145 VKVSDSDVIAALQKSEDKNKNLSIEFELRQVIFVVPQKA--SSGLKAQRKREADQFRKEF 202

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIA 271
              C      A  +++V +    + LE++L P  ++ + K++    T P  T +G+E IA
Sbjct: 203 -TSCETGAAQARTLNEVVVRAIGHRLETELPPALRDTIVKTEVGRLTPPEQTSRGLEMIA 261

Query: 272 ICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +C KR++  +IA +  +  +    + E+    Y+++LR  A I Y
Sbjct: 262 VCGKREIQSDIAARTAIEDELRQKEGEQMSRRYLQELRRRATIEY 306


>gi|254503520|ref|ZP_05115671.1| SurA N-terminal domain family [Labrenzia alexandrii DFL-11]
 gi|222439591|gb|EEE46270.1| SurA N-terminal domain family [Labrenzia alexandrii DFL-11]
          Length = 314

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 73/286 (25%), Positives = 128/286 (44%), Gaps = 9/286 (3%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIAL--LKLQKINGELEKIAVQELIVETLKKQEIEKSG 94
           +  + I+  +N   ITD DI++R  L  L L+K      + AVQELI + +K  E  + G
Sbjct: 31  SADAAIKVIVNDVPITDYDITQRARLITLTLRKSASVARREAVQELIDDQVKVGEATRMG 90

Query: 95  ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFML 154
           ++   + V+  +   ARN  L+    +  L + G+     K+ L  Q IW  +V+  F  
Sbjct: 91  MSVSDSEVDNAYANIARNVKLTPARLTQALGQGGVRAETLKKRLRAQLIWGKLVRARFSG 150

Query: 155 KYGNLEMEIPANKQK---MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
                E +I A  +K       T  EY ++ V+  +P N   + GF  +R ++  + R +
Sbjct: 151 GVDVDESDIIAALRKTDEEDRATSIEYDLQRVIVVVPKN--SSNGFKSQRRREIAQMR-K 207

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYI 270
               C  +     +  +V +      LE+++ P   + +KK      T+P  T  G E I
Sbjct: 208 AVSSCEDMGSVLGQYKEVVVQPIGRRLETEIPPNIIDQVKKLGPGKLTDPNPTPVGFEMI 267

Query: 271 AICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           AIC KR++  +IA++  L  +    + E      +   +  + I Y
Sbjct: 268 AICGKREIQSDIAMRTKLENELRAKEGESQARRLLMDAKRRSTIIY 313


>gi|148827655|ref|YP_001292408.1| thymidylate kinase [Haemophilus influenzae PittGG]
 gi|148718897|gb|ABR00025.1| thymidylate kinase [Haemophilus influenzae PittGG]
          Length = 311

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 5   VLRSFLLATLGC----VAFTSMAQAAERVVATVDGIPILESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V         G    E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIGVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF  + +K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQIVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATKDWVKALRKRANIQYF 309


>gi|68249060|ref|YP_248172.1| survival protein SurA-like protein [Haemophilus influenzae
           86-028NP]
 gi|68057259|gb|AAX87512.1| survival protein SurA homolog [Haemophilus influenzae 86-028NP]
          Length = 313

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 72/320 (22%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 7   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPILESQVRANMG------KKGD-R 55

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ I++SG+  D   ++      A   GL+   F   LD QGI  N 
Sbjct: 56  QSALDKIIDDLLVQKAIQESGVKIDPREIDRVVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 234 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 291

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 292 QDATNDWVKALRKRANIQYF 311


>gi|260582276|ref|ZP_05850069.1| stationary-phase survival protein SurA [Haemophilus influenzae
           NT127]
 gi|260094644|gb|EEW78539.1| stationary-phase survival protein SurA [Haemophilus influenzae
           NT127]
          Length = 313

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 7   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPILESQVRANMG------KKGD-R 55

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 56  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTRAEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 291

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 292 QDATNDWVKALRKRANIQYF 311


>gi|319775614|ref|YP_004138102.1| survival protein SurA [Haemophilus influenzae F3047]
 gi|317450205|emb|CBY86421.1| survival protein SurA homolog [Haemophilus influenzae F3047]
          Length = 311

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 5   VLRSFLLAALGC----VAFASMAQAGERVVATVDGIPILESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|301169179|emb|CBW28776.1| survival protein SurA homolog [Haemophilus influenzae 10810]
          Length = 311

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 5   VLRSFLLAALGC----VAFASMAQAGERVVATVDGIPILESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|329122338|ref|ZP_08250925.1| peptidyl-prolyl cis-trans isomerase [Haemophilus aegyptius ATCC
           11116]
 gi|327473620|gb|EGF19039.1| peptidyl-prolyl cis-trans isomerase [Haemophilus aegyptius ATCC
           11116]
          Length = 313

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 7   VLRSFLLAALGC----VAFASMAQAGERVVATVDGIPILESQVRANMG------KKGD-R 55

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 56  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 291

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 292 QDATNDWVKALRKRANIQYF 311


>gi|16272406|ref|NP_438619.1| stationary-phase survival protein SurA [Haemophilus influenzae Rd
           KW20]
 gi|260580479|ref|ZP_05848307.1| stationary-phase survival protein SurA [Haemophilus influenzae
           RdAW]
 gi|1174486|sp|P44721|SURA_HAEIN RecName: Full=Chaperone surA homolog; Flags: Precursor
 gi|1573432|gb|AAC22116.1| stationary phase survival protein SurA, putative [Haemophilus
           influenzae Rd KW20]
 gi|260092821|gb|EEW76756.1| stationary-phase survival protein SurA [Haemophilus influenzae
           RdAW]
          Length = 313

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 70/320 (21%), Positives = 134/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+  
Sbjct: 7   VLRSFLLATLGC----VAFTSMAQAEERVVATVDGIPVLESQVRANMG------KKGD-R 55

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 56  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 291

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 292 QDATNDWVKALRKRANIQYF 311


>gi|229846544|ref|ZP_04466652.1| stationary-phase survival protein SurA [Haemophilus influenzae
           7P49H1]
 gi|229810637|gb|EEP46355.1| stationary-phase survival protein SurA [Haemophilus influenzae
           7P49H1]
          Length = 311

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+  
Sbjct: 5   ILKSFLLATLGC----VAFASMAQAEERVVATVDGIPVLESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVVKSKQGVVSAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|309972385|gb|ADO95586.1| Putative survival protein SurA-like protein [Haemophilus influenzae
           R2846]
          Length = 313

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 71/320 (22%), Positives = 132/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  I +  +   +         G+  
Sbjct: 7   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPILESQVRANMG------KKGD-R 55

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ I++SG+  D   ++      A   GL+   F   LD QGI  N 
Sbjct: 56  QSALDKIIDDLLVQKAIQESGVKIDPREIDRVVEDTAARNGLTYGQFLDALDYQGISLNT 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 116 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLDEAKSQGTAQKVTGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +    D  G++  +AY      +   T++
Sbjct: 234 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVSD--GDLTAEAYTQKAYERLVNTQL 291

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 292 QDATNDWVKALRKRANIQYF 311


>gi|145630363|ref|ZP_01786144.1| stationary-phase survival protein SurA [Haemophilus influenzae
           R3021]
 gi|144984098|gb|EDJ91535.1| stationary-phase survival protein SurA [Haemophilus influenzae
           R3021]
          Length = 311

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+  
Sbjct: 5   VLRSFLLATLGC----VAFTSMAQAEERVVATVDGIPVLESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNT 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|148825262|ref|YP_001290015.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittEE]
 gi|148715422|gb|ABQ97632.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittEE]
          Length = 311

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+  
Sbjct: 5   ILKSFLLATLGC----VAFTSMAQAEERVVATVDGIPVLESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|304392008|ref|ZP_07373950.1| survival protein SurA [Ahrensia sp. R2A130]
 gi|303296237|gb|EFL90595.1| survival protein SurA [Ahrensia sp. R2A130]
          Length = 343

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 70/298 (23%), Positives = 120/298 (40%), Gaps = 14/298 (4%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKK 87
            P V+  +    +RI   +N   IT  DI++R   ++L+++ G    IA  ELI E +K 
Sbjct: 48  APKVATINKRGGTRIAVLVNETPITSTDIARRAKFVRLRRMKGNATTIATNELIDEAIKM 107

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
           +E  +         V+  +   A+N  L+       L + G     FK Y+     W   
Sbjct: 108 KEARRINAVASDAEVSSAYAGFAKNNKLTQPQLGQVLSRSGTTVRGFKDYIRASLSWQRA 167

Query: 148 VKNDFMLKYGNLEMEIPANKQ-------KMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
           V +    +           K          +     EY ++ ++F +P +K    G +  
Sbjct: 168 VGSRMRAEASGRGGLGEKAKGPRFLSSAGTQGAKEGEYTLQQIVFVVPSDKR---GQLSA 224

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           R   A + R R+   C    + A  + DVS+     LL+S L PQ+   ++  S+   T 
Sbjct: 225 RRAQANQFRTRM-NGCTNALELAKSLRDVSVRDRGRLLDSQLPPQWAKEIRALSEGGVTR 283

Query: 260 PYVTQKGVEYIAICDKRDLGGEI--ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              T KGVE +A+C KR++               N   +  + E +Y+ +L+  A I 
Sbjct: 284 TKDTDKGVEMLALCRKREVRASTSSTSADLFGGANFAEQQSETEKKYLAELKERATIQ 341


>gi|319898023|ref|YP_004136220.1| survival protein sura homolog [Haemophilus influenzae F3031]
 gi|317433529|emb|CBY81912.1| survival protein SurA homolog [Haemophilus influenzae F3031]
          Length = 311

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+  
Sbjct: 5   ILKSFLLATLGC----VAFASMAQAEERVVATVDGIPVLESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVMKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATKDWVKALRKRANIQYF 309


>gi|145632724|ref|ZP_01788458.1| thymidylate kinase [Haemophilus influenzae 3655]
 gi|145634545|ref|ZP_01790254.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittAA]
 gi|229844382|ref|ZP_04464522.1| stationary-phase survival protein SurA [Haemophilus influenzae
           6P18H1]
 gi|144986919|gb|EDJ93471.1| thymidylate kinase [Haemophilus influenzae 3655]
 gi|145268090|gb|EDK08085.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittAA]
 gi|229812631|gb|EEP48320.1| stationary-phase survival protein SurA [Haemophilus influenzae
           6P18H1]
          Length = 311

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 32/320 (10%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           +L ++ +  + C    V++ S A +  R+  T++G  + +  +   +         G+  
Sbjct: 5   ILKSFLLATLGC----VAFASMAQAEERVVATVDGIPVLESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +  +EY +R +
Sbjct: 114 FRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|113461696|ref|YP_719765.1| peptidyl-prolyl cis-trans isomerase, PPIC-type [Haemophilus somnus
           129PT]
 gi|112823739|gb|ABI25828.1| peptidyl-prolyl cis-trans isomerase, PPIC-type [Haemophilus somnus
           129PT]
          Length = 314

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 66/315 (20%), Positives = 130/315 (41%), Gaps = 24/315 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
           F  ++F I+ ++S    A +  R+  T++G  I +  +     +L  +  N E  +IA+ 
Sbjct: 6   FKAVLFSIIGLLSITITAQAAERVVATVDGNPILESQVK---KVLGKRANNEENRQIALN 62

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            +I + L ++ I++ GI      V+      A   GL+   F   LD QGI    ++Q +
Sbjct: 63  SIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQNGLTFGQFLDVLDYQGINYQAYRQQI 122

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIP----------ANKQKMKNITVREYLIRTVLFSIP 188
           A Q +  +V              EI             + K K +T  EY +R +L  + 
Sbjct: 123 AYQILISEVRNQAIGSSVNVTREEIQDLGLKLFKQAKKQGKEKKVTAPEYNVRHILLKLN 182

Query: 189 D--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
              N  Q +  + +   D   +++       K  K    +     G   ++      P+F
Sbjct: 183 PLLNDAQAKAKLTQIRADILANKITFADAALKYSKDY--LSGADGGSLGFMFPEAYVPEF 240

Query: 247 QNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA---QNTPTKIEKHEA 302
             +++ S +   + P+ T+ G   + + D R+   +I  +AY+     Q    ++++   
Sbjct: 241 AKVIRASKKGVISTPFKTEFGWHILEVTDIRN--ADITREAYMQEAYQQIVNQQLQEASG 298

Query: 303 EYVKKLRSNAIIHYY 317
           +++K LR  A I Y+
Sbjct: 299 DWIKALRKRAHIQYF 313


>gi|170718609|ref|YP_001783810.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haemophilus somnus
           2336]
 gi|168826738|gb|ACA32109.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Haemophilus somnus
           2336]
          Length = 321

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 66/315 (20%), Positives = 130/315 (41%), Gaps = 24/315 (7%)

Query: 20  FVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
           F  ++F I+ ++S    A +  R+  T++G  I +  +     +L  +  N E  +IA+ 
Sbjct: 13  FKAVLFSIIGLLSITITAQAAERVVATVDGNPILESQVK---KVLGKRANNEENRQIALN 69

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            +I + L ++ I++ GI      V+      A   GL+   F   LD QGI    ++Q +
Sbjct: 70  SIIDDLLVQKAIQELGIKVAPAHVDSVIENIAAQNGLTFGQFLDVLDYQGINYQAYRQQI 129

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIP----------ANKQKMKNITVREYLIRTVLFSIP 188
           A Q +  +V              EI             + K K +T  EY +R +L  + 
Sbjct: 130 AYQILISEVRNQAIGSSVNVTREEIQDLGLKLFKQAKKQGKEKKVTAPEYNVRHILLKLN 189

Query: 189 D--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF 246
              N  Q +  + +   D   +++       K  K    +     G   ++      P+F
Sbjct: 190 PLLNDAQAKAKLTQIRADILANKITFADAALKYSKDY--LSGADGGSLGFMFPEAYVPEF 247

Query: 247 QNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA---QNTPTKIEKHEA 302
             +++ S +   + P+ T+ G   + + D R+   +I  +AY+     Q    ++++   
Sbjct: 248 AKVIRTSKKGVISTPFKTEFGWHILEVTDIRN--ADITREAYMQEAYQQIVNQQLQEASG 305

Query: 303 EYVKKLRSNAIIHYY 317
           +++K LR  A I Y+
Sbjct: 306 DWIKALRKRAHIQYF 320


>gi|145638627|ref|ZP_01794236.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittII]
 gi|145272222|gb|EDK12130.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittII]
          Length = 311

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 71/320 (22%), Positives = 129/320 (40%), Gaps = 29/320 (9%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K +   F+L     V  VS        R+  T++G  + +  +   +         G+  
Sbjct: 3   KFVLRSFLLAALGCVAFVSMA--QAEERVVATVDGIPVLESQVRANMG------KKGD-R 53

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 54  QSAIDKIIDDILVQKAVQESGVKIDPREIDHVVEDTAARNGLTYGQFLDALDYQGISLNA 113

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 114 FRQQIANQMMMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVTGKEYEVRHI 173

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 174 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 231

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 232 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGTRD--GDLTSEAYTQKAYERLVNTQL 289

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 290 QDATNDWVKALRKRANIQYF 309


>gi|309750126|gb|ADO80110.1| Putative survival protein SurA-like protein [Haemophilus influenzae
           R2866]
          Length = 313

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 71/320 (22%), Positives = 129/320 (40%), Gaps = 29/320 (9%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           K +   F+L     V  VS        R+  T++G  + +  +   +         G+  
Sbjct: 5   KFVLRSFLLAALGCVAFVSMA--QAEERVVATVDGIPVLESQVRANMG------KKGD-R 55

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           + A+ ++I + L ++ +++SG+  D   +++     A   GL+   F   LD QGI  N 
Sbjct: 56  QSAIDKIIDDILVQKAVQESGVKIDPREIDHVVEDTAARNGLTYGQFLDALDYQGISLNA 115

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTV 183
           F+Q +A Q +   V              E+ A  QKM          + +T +EY +R +
Sbjct: 116 FRQQIANQMMMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKVTGKEYEVRHI 175

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESD 241
           L  +  N L N    +K++       +             SK  +   + G   Y     
Sbjct: 176 LLKL--NPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPET 233

Query: 242 LHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKI 297
             PQF Q ++K  Q   + P+ T+ G   + +   RD  G++  +AY      +   T++
Sbjct: 234 YAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGTRD--GDLTSEAYTQKAYERLVNTQL 291

Query: 298 EKHEAEYVKKLRSNAIIHYY 317
           +    ++VK LR  A I Y+
Sbjct: 292 QDATNDWVKALRKRANIQYF 311


>gi|182677646|ref|YP_001831792.1| hypothetical protein Bind_0653 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633529|gb|ACB94303.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 306

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 68/287 (23%), Positives = 135/287 (47%), Gaps = 6/287 (2%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQE 89
           +V   +   +  I  +ING+ IT+ D+ +R+ +L++ +      + A++ L  + L+  E
Sbjct: 21  VVVGSTDVQAQTIIASINGDPITNIDVDERMKMLRVLRKPAT-REAAMESLYTDRLETHE 79

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
             + G+      +    V+ A+   +  E   + L   G+  +HFK +      +  +V 
Sbjct: 80  AARYGVKPKDADIGQEIVRVAQEMKVQPEALIAALQNAGVSPDHFKAHFGADLAFGALVG 139

Query: 150 N-DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
             +  ++    E+     +Q  K     EY +R V+FS+P+N       +  R ++AE+ 
Sbjct: 140 ALNKGVEASETEVRKELARQGGKAAAGTEYTLRQVIFSLPNNVA--PAAINARGQEAEQL 197

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGV 267
           R R   DC   EK    ++DV+I        +++    +NLL K+   + T P  +  G+
Sbjct: 198 RQRF-ADCESGEKMVFALNDVTIRDPIRRTSTEISEGLRNLLDKTPVGHLTPPQRSSAGL 256

Query: 268 EYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           E IA+C K     + AL+  +S +   T++    A+ +K++R +A+I
Sbjct: 257 EMIAVCRKGAALDDTALRQQISQKILATRLSADRAKRLKEMRDHAVI 303


>gi|145636275|ref|ZP_01791944.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittHH]
 gi|145270440|gb|EDK10374.1| stationary-phase survival protein SurA [Haemophilus influenzae
           PittHH]
          Length = 290

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 64/298 (21%), Positives = 120/298 (40%), Gaps = 27/298 (9%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
                R+  T++G  + +  +   +         G+  + A+ ++I + L ++ +++SG+
Sbjct: 2   AQAEERVVATVDGIPVLESQVRANMG------KKGD-RQSAIDKIIDDILVQKAVQESGV 54

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
             D   +++     A   GL+   F   LD QGI  N F+Q +A Q +   V        
Sbjct: 55  KIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQQIANQMVMGAVRNKAIQES 114

Query: 156 YGNLEMEIPANKQKM----------KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
                 E+ A  QKM          + +  +EY +R +L  +  N L N    +K++   
Sbjct: 115 IDVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLKL--NPLLNDAQAKKQLAKI 172

Query: 206 EESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYV 262
               +             SK  +   + G   Y       PQF Q ++K  Q   + P+ 
Sbjct: 173 RSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYAPQFAQTVVKSKQGVISAPFK 232

Query: 263 TQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           T+ G   + +   RD  G++  +AY      +   T+++    ++VK LR  A I Y+
Sbjct: 233 TEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQLQDATNDWVKALRKRANIQYF 288


>gi|217978373|ref|YP_002362520.1| hypothetical protein Msil_2224 [Methylocella silvestris BL2]
 gi|217503749|gb|ACK51158.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 315

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 63/281 (22%), Positives = 126/281 (44%), Gaps = 6/281 (2%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
              +  I  +ING+ IT+ DI +R+ LL++ +      + A++ L  + L+  E EK G+
Sbjct: 34  PVHAQAIVASINGDPITNIDIDQRMKLLRVLRKPAT-REAAIESLFRDRLQIHEAEKYGV 92

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN-DFML 154
                 ++   V+ A    L  +   S L   G+ ++ FK Y      +  +V+  +  +
Sbjct: 93  NPRDADISQQIVKTATEMNLQPQALLSALQAAGVSEDQFKSYFRANLAFTVLVQALNKGV 152

Query: 155 KYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
           +    ++     KQ  K      Y ++ ++F++P         +  R K+AE+ R R   
Sbjct: 153 EASETQVRAELEKQGGKAAAGTSYTVQQIIFTLPIGTT--PAILAARSKEAEQLRSRF-T 209

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
           DC    + A  ++DV++         +L  Q + LL K+     T P  +  G+E +A+C
Sbjct: 210 DCKSGAEMARTLNDVTVRDQLTRSSHELGEQLRQLLDKTAIGRLTPPQRSTSGLEMVAVC 269

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            +     + A++  ++ +     I++     +K+LR  A+I
Sbjct: 270 ARGPAKDDTAIRQTIAQKLLAAHIQEDGERRLKELRDRAVI 310


>gi|301155190|emb|CBW14654.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 310

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 59/317 (18%), Positives = 126/317 (39%), Gaps = 27/317 (8%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
            +    ++F ++ + ++       R+  T+NG  I    ++  +            ++ A
Sbjct: 3   KSMLKSLLFAMIGLFTFSQVQAEERVVATVNGTPILQSQVNAVMG-------KKGSQRAA 55

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ I++SG+  +   VN      A   GL+   F   LD QGI  N FKQ
Sbjct: 56  LDKIIDDMLTEKAIKESGVKVNQAEVNRIVEDIAAKNGLTYGQFLDALDYQGISLNAFKQ 115

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            ++ Q +   V          V  + +   G   ++    K   + +  +EY +R +L  
Sbjct: 116 QISRQMLMAGVRNHAIQNSVDVTREQVDALGKQMLDEAKAKGTAQKVMGKEYEVRHILLK 175

Query: 187 IPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           +    N  Q +  +++   +    ++       K  K    +   + G   Y        
Sbjct: 176 LNPLLNDAQAKAELERIRSEIISGKMTFADAALKYSKDY--LSGANGGSLGYAFPEAYVG 233

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKH 300
            F  +++ +     + P+ ++ G   + +   RD  G+    AY      Q   +++++ 
Sbjct: 234 PFAKMVETTPQGTISAPFKSEFGWHILEVTGTRD--GDKTEDAYRQKAYEQIVNSQLQEA 291

Query: 301 EAEYVKKLRSNAIIHYY 317
             ++VK LR NA I Y+
Sbjct: 292 TKDWVKALRKNADIQYF 308


>gi|260912727|ref|ZP_05919213.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Pasteurella
           dagmatis ATCC 43325]
 gi|260633105|gb|EEX51270.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Pasteurella
           dagmatis ATCC 43325]
          Length = 311

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 67/312 (21%), Positives = 128/312 (41%), Gaps = 28/312 (8%)

Query: 23  IIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           I F +V + +  +   +  R+  T+NG  + +  +             G   + A+ + I
Sbjct: 10  IFFALVGLFAISTTTQAAERVVATVNGIPVLESQVKANSG------KKGN-RQAALDKAI 62

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L +Q I+ SG+  +   V+      A   GL+   F   LD QGI  N ++Q +A Q
Sbjct: 63  DDILVQQAIQNSGVKVNYAQVDQIIEGIAAQNGLTYGQFLDALDYQGISYNTYRQQIANQ 122

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRTVLFSIPD-- 189
            +  +V              ++ A           K   K ++ ++Y +R +L  +    
Sbjct: 123 LLMTEVRNQAIGQSIDVTREQVEALGKQLLQEAKEKGTEKKVSGKQYEVRHILLKLNPLL 182

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLESDLHPQFQN 248
           N  Q +  + +   D    ++       K  K + S  +  S+G A    E+ + P  + 
Sbjct: 183 NDTQAKAQLSQIRADIMAGKMTFADAALKYSKDYLSGANGGSLGFA--FPETYVGPFQKT 240

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYV 305
           ++   Q   + P+ T+ G   + + + RD  G+  L AY      Q   ++++  E ++V
Sbjct: 241 VITSKQGVISAPFKTEFGWHILEVTNTRD--GDRTLDAYRQQAYEQLINSQVKDAEKDWV 298

Query: 306 KKLRSNAIIHYY 317
           K LR NA I Y+
Sbjct: 299 KALRKNADIQYF 310


>gi|325576844|ref|ZP_08147459.1| peptidyl-prolyl cis-trans isomerase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325161050|gb|EGC73168.1| peptidyl-prolyl cis-trans isomerase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 310

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 58/317 (18%), Positives = 126/317 (39%), Gaps = 27/317 (8%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
            +    ++F ++ + ++       R+  T+NG  I    ++  +            ++ A
Sbjct: 3   KSMLKSLLFAMIGLFTFSQAQAEERVVATVNGTPILQSQVNAVMG-------KKGSQRAA 55

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           + ++I + L ++ I++SG+  +   VN      A   GL+   F   LD QGI  N FKQ
Sbjct: 56  LDKIIDDMLTEKAIKESGVKVNQAEVNRIVEDIAAKNGLTYGQFLDALDYQGISLNAFKQ 115

Query: 137 YLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
            ++ Q +   V          V  + +   G   ++    K   + +  +EY +R +L  
Sbjct: 116 QISRQMLMAGVRNHAIQNSVDVTREQVEALGKQMLDEAKAKGTAQKVMGKEYEVRHILLK 175

Query: 187 IPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           +    +  Q +  +++   +    ++       K  K    +   + G   Y        
Sbjct: 176 LNPLLDDAQAKAELERIRSEIILGKMTFADAALKYSKDY--LSGANGGSLGYAFPEAYVG 233

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKH 300
            F  +++ +     + P+ ++ G   + +   RD  G+    AY      Q   +++++ 
Sbjct: 234 PFAKMVETTPQGTVSAPFKSEFGWHILEVTGSRD--GDKTEDAYRQKAYEQIVNSQLQEA 291

Query: 301 EAEYVKKLRSNAIIHYY 317
             ++VK LR NA I Y+
Sbjct: 292 TKDWVKALRKNADIQYF 308


>gi|149914655|ref|ZP_01903185.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           AzwK-3b]
 gi|149811448|gb|EDM71283.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           AzwK-3b]
          Length = 411

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 107/270 (39%), Gaps = 8/270 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKING 70
           + L    +  +          + A +  +      +N + IT  +I +R  +L L +  G
Sbjct: 3   QFLAALALPAVMATSMSWGIAAPASAQNLFAPVVKVNDQAITGYEIQQRARMLTLFRSPG 62

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
              ++A ++LI E LK      +G+  +   +     + A    ++AE+F   L+  G+ 
Sbjct: 63  NPVELAREQLIEERLKVDAARAAGLVLEDADIRVGMEEFASRANMTAEEFIGALEGAGVS 122

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
           +  +++++     W ++V+  F  +    + ++   +  +   +    L+  ++  I   
Sbjct: 123 EQSYREFVRAGMTWRELVRARFAPRVSVSDADLERARAALTEDSGVRVLLSEIIMPITPQ 182

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-L 249
             +       RI + +     +P    + E++++       G+  ++  ++L PQ +  +
Sbjct: 183 DAEEVQDRAARISELDS----IPAFSAEAERYSASATAARGGRLDWMSITNLPPQLRPVI 238

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
           L     + ++P   +  V    + D  +  
Sbjct: 239 LALGPGDVSDPLPIEGAVALFQLRDIEETD 268


>gi|152978410|ref|YP_001344039.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Actinobacillus
           succinogenes 130Z]
 gi|150840133|gb|ABR74104.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Actinobacillus
           succinogenes 130Z]
          Length = 317

 Score =  199 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 57/316 (18%), Positives = 120/316 (37%), Gaps = 22/316 (6%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIALLKLQKINGELEK 74
                I    + +    S A +    ++  T+NGE I +  + + +     +       +
Sbjct: 4   GSLKAIALAAMGLFVISSGAQAVKVEQVVATVNGEPILESQLQRVMG---KRANTESNRR 60

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
           +AV ++I + L ++ +++SG+  +   VN      A   GL+       LD QGI  + F
Sbjct: 61  VAVDKIIDDMLVQKAVKESGVKVNPAQVNQIVHNIADQNGLTYGQLLDALDYQGISLSQF 120

Query: 135 KQYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           K  ++ Q +  +V          V  + + +     ++        K IT  +Y  R +L
Sbjct: 121 KANISNQILMAEVRNRSIGKGVDVSREQVEELSRKMLQQAKAGGNPKAITATQYKARHIL 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDL 242
             +    L N    + ++               +  K  SK  +   + G   +    + 
Sbjct: 181 LKL--TPLLNDAQAKAQLTQIRADIQSGKTTFAEAAKNYSKDYLSGANGGDLGFAFPENY 238

Query: 243 HPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKH 300
            P+F  ++    Q   + P+ T+ G   + + D R     ++A +          ++ ++
Sbjct: 239 VPEFAKMMTTAKQGVISAPFKTEFGWHILEVTDTRQGDITDVAYRQKAYETLVNEQLREY 298

Query: 301 EAEYVKKLRSNAIIHY 316
             ++VK LR +A I Y
Sbjct: 299 SKDWVKALRKHAEIKY 314


>gi|259419301|ref|ZP_05743218.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Silicibacter sp.
           TrichCH4B]
 gi|259345523|gb|EEW57377.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Silicibacter sp.
           TrichCH4B]
          Length = 425

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 54/274 (19%), Positives = 108/274 (39%), Gaps = 8/274 (2%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI-NGELEKI 75
                L +   +P     +  + S +  T+N +VIT  ++ +R   L +     G+  + 
Sbjct: 24  AGGLALAVALTLPAADVGAQGLFSPV-ITVNEDVITTYELQQRARFLTVLGSVQGDPLET 82

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
           A  +LI + LK+Q + + G+T   + +     + A+   LS E+F S L + G+     +
Sbjct: 83  ARNDLIEDRLKRQVMREVGLTLSEDEITEGMRELAQRANLSLEEFLSGLRQAGVDPETVR 142

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
            + +    W + ++  F+ +    E EI          +V+  L   +L    +N  Q Q
Sbjct: 143 DFTSAGLGWREYIRGRFLAQARPSEAEIDRAMGTAGTGSVQVLLSEIILPLTQENAAQIQ 202

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQ 254
               +  +   E+            +F++     + G+  ++  S L PQ Q  +L    
Sbjct: 203 ELATQISELKNEAAF-----TASAAQFSASDSSANGGRLPWMSLSRLPPQLQEVVLGLEP 257

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
              T P   Q  +    +   R++ G  A  A +
Sbjct: 258 GQITQPLPMQGAIAIFRMRGLREVDGRSASFAAI 291


>gi|52424684|ref|YP_087821.1| SurA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306736|gb|AAU37236.1| SurA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 353

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 56/311 (18%), Positives = 113/311 (36%), Gaps = 23/311 (7%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           L++  I       +     ++  T++G  I +  + +    L  Q  N      A+ ++I
Sbjct: 47  LLLVMIGMFAVSVNVQAVEQVVATVDGTPILESQLKR---ALGKQANNATNRAKALDKII 103

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L ++ ++++ +      ++      A    ++       LD QGIG   F+  +  Q
Sbjct: 104 DDMLVQKAVKEANVHISEGQLDKIVENIAAQNNMTYGQLLDALDYQGIGITKFRNNIRNQ 163

Query: 142 SIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
            +  +V          V  + +       +E    + K   +T  EY +R +L  +  N 
Sbjct: 164 LMMAEVRNRSIGKNIDVTREQVETLSKQMLEQAKTQGKKAQVTGTEYQVRHILLKL--NP 221

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQFQNL 249
           L N    + ++                  K  SK  +   + G   Y       P F  +
Sbjct: 222 LLNDAQAKAQLNQICSDIQSGKTTFAAAAKDYSKDYLSGANGGDLGYAFPEIYDPAFGQV 281

Query: 250 LKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYV 305
           +K + +   + P+ TQ G   + + D R   G++   AY           +++    ++V
Sbjct: 282 IKATKKGVISAPFKTQFGWHILEVTDTRQ--GDMTEAAYRQKAYETLVNQQLQDDAKDWV 339

Query: 306 KKLRSNAIIHY 316
           K LR  A I Y
Sbjct: 340 KALRKGAEIKY 350


>gi|15603073|ref|NP_246145.1| hypothetical protein PM1208 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721561|gb|AAK03292.1| SurA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 311

 Score =  198 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 61/308 (19%), Positives = 117/308 (37%), Gaps = 28/308 (9%)

Query: 26  CIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVET 84
            I+ +  Y S A +  R+  T+NG  + +  + K +             ++A+ ++I + 
Sbjct: 13  AILGLFIYVSTAQAAERVVATVNGVPVLESQVKKNMG-------KKGQYQVALDKVIDDI 65

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           L +Q I+ SGI  +   V+      A   GL+       LD QGI  N ++Q +A Q + 
Sbjct: 66  LVQQAIQNSGIKVNYAQVDQIIEGIAAQNGLTYGQLLDALDYQGISYNAYRQQIANQILM 125

Query: 145 PDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            ++              ++ A               K I+  +Y +R +L  +  N L N
Sbjct: 126 GEIRNQAIGQSIDVTREQVEALSNQLLNQAKQAGTEKKISAPQYEVRHILLKL--NPLLN 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQFQN-LLK 251
               + ++       +             SK  +   + G   +         FQ  +L 
Sbjct: 184 DAQAKAQLTQIRADIIAGKMSFADAALHYSKDYLSGANGGSLGFAFPEAYVGAFQKAILT 243

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYVKKL 308
             +   + P+ T+ G   + + + R+  G+  +  Y      Q    +++  E ++VK L
Sbjct: 244 TKKGVISAPFKTEFGWHILEVTNTRE--GDKTIDVYRQKAYEQLVNQQVKDVEKDWVKAL 301

Query: 309 RSNAIIHY 316
           R NA I Y
Sbjct: 302 RKNAEIRY 309


>gi|332288953|ref|YP_004419805.1| peptidyl-prolyl cis-trans isomerase SurA [Gallibacterium anatis
           UMN179]
 gi|330431849|gb|AEC16908.1| peptidyl-prolyl cis-trans isomerase SurA [Gallibacterium anatis
           UMN179]
          Length = 313

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/312 (22%), Positives = 130/312 (41%), Gaps = 26/312 (8%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ 78
            F+L++ C+   ++   +A+  ++  T+NG  I +  + +    L  +         A+ 
Sbjct: 7   KFLLLVGCLS--LATTGYAVE-KVVATVNGTPILNSQVKQ---ALGKRADTAANRAAALD 60

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
           ++I + L ++ I+ + I+     +     Q A   GL+   F   LD QGIG+  F+Q +
Sbjct: 61  DVIDDMLVQKAIKDAKISVSQQQIQQIMHQIANENGLTYGQFLDALDYQGIGEAKFRQQI 120

Query: 139 AIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIP 188
           A Q I   V          V  + + K G         K  +K +   +YL+  +L    
Sbjct: 121 AHQIIMGQVRNKAISESISVSREQIEKLGKQMYNEAKQKGTLKTVKSPQYLVSHILIKT- 179

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQF 246
            N L N    +K++       +          K  SK  +   + G   +       P+F
Sbjct: 180 -NPLLNDAQAKKQLSSLRSDIIAGKTTFAAAAKTYSKDYLSGANGGSLDWNFPEVYEPEF 238

Query: 247 QNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEA 302
           Q+++K S +   + P+ T+ G   + + DKRD  G+   +AY+     Q    +  +   
Sbjct: 239 QSMVKNSKKGVISQPFKTKYGWHILEVVDKRD--GDKTKEAYMQKAYQQVVNQQAMEASK 296

Query: 303 EYVKKLRSNAII 314
           ++VK LR +A I
Sbjct: 297 DWVKTLRKSADI 308


>gi|83952309|ref|ZP_00961041.1| PPIC-type PPIASE domain [Roseovarius nubinhibens ISM]
 gi|83837315|gb|EAP76612.1| PPIC-type PPIASE domain [Roseovarius nubinhibens ISM]
          Length = 441

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 48/270 (17%), Positives = 103/270 (38%), Gaps = 6/270 (2%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKING 70
             K   T  V ++  + P+ +    A S      T+N   IT  +I +R   L+L +  G
Sbjct: 14  IAKFFQTSAVALVLGLTPLTAAPVIAQSKFEAVITVNNAPITQFEIEQRARFLRLLRAPG 73

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
           +   +A ++LI + LK Q   +SGI  +   +     + A    LS  +    L  +G+ 
Sbjct: 74  DPIALAREQLIEDRLKLQAARQSGIEVNEEQIAAGMDRFASQANLSGAEMVKLLASEGVY 133

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
           +  F+ ++     W D+ +  F  +    E ++   +  +      E L+  ++      
Sbjct: 134 EETFRAFIIAGVSWSDLTRARFAPRVSISEDDLERARAAVGKGGGVEVLMSELIIPYTPQ 193

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NL 249
             +      +RI +             +  ++++     S G+  +   ++L    +  +
Sbjct: 194 TQEQVEATARRISEG----ASESSFAAEARRYSATRTAPSGGRLPWTPLNELPGGLRGII 249

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
           L  +  + T+P   Q  V    + D R+  
Sbjct: 250 LGLAPGDVTDPLPLQGAVALFQLRDIRETD 279


>gi|145628832|ref|ZP_01784632.1| thymidylate kinase [Haemophilus influenzae 22.1-21]
 gi|144979302|gb|EDJ88988.1| thymidylate kinase [Haemophilus influenzae 22.1-21]
          Length = 246

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 101/247 (40%), Gaps = 20/247 (8%)

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
           ++ +++SG+  D   +++     A   GL+   F   LD QGI  N F+Q +A Q +   
Sbjct: 2   QKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDALDYQGISLNTFRQQIANQMVMGA 61

Query: 147 VVKNDFMLKYGNLEMEIPANKQKM----------KNITVREYLIRTVLFSIPDNKLQNQG 196
           V         G    E+ A  QKM          + +  +EY +R +L  +  N L N  
Sbjct: 62  VRNKAIQESIGVTREEVVALGQKMLEEAKEKGTAQKVMGKEYEVRHILLKL--NPLLNDA 119

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQF-QNLLKKS 253
             +K++       +             SK  +   + G   Y       PQF Q ++K  
Sbjct: 120 QAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPETYAPQFAQTVVKSK 179

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYVKKLRS 310
           Q   + P+ T+ G   + +   RD  G++  +AY      +   T+++    ++VK LR 
Sbjct: 180 QGVISAPFKTEFGWHILEVTGVRD--GDLTAEAYTQKAYERLVNTQLQDATNDWVKALRK 237

Query: 311 NAIIHYY 317
            A I Y+
Sbjct: 238 RANIQYF 244


>gi|254487361|ref|ZP_05100566.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           GAI101]
 gi|214044230|gb|EEB84868.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter sp.
           GAI101]
          Length = 411

 Score =  189 bits (480), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 44/263 (16%), Positives = 101/263 (38%), Gaps = 10/263 (3%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           L +    P+ +   +A  +R    +N  V+T+ ++ +R   L+L    G     A+  LI
Sbjct: 21  LALMTATPLAAQNLFAPVAR----VNESVVTEFEVQQRQRFLQLLNAPGATRDGALTSLI 76

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            E L+ + + ++GI      +     + A    LS  +F+S L++ G+    F+ ++   
Sbjct: 77  DERLRNEAVAEAGIALTPEGIEDSLTEFAARANLSTAEFTSALERSGVAKETFRDFVVNS 136

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKR 201
             W ++++  +  +    + EI       +   VR  L   ++ + P +  +     ++ 
Sbjct: 137 VGWRELIRARYNARVQITDAEINRALGATRGGGVRVLLSEIIIPAPPKDAARVNALAEQI 196

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNP 260
            +    +            ++++       G+ ++   S L P  Q  +L  +    T P
Sbjct: 197 AQSRSAAEFSGF-----ASRYSATASRGRGGRLEWQDLSSLPPSLQPLILGLAPGEVTAP 251

Query: 261 YVTQKGVEYIAICDKRDLGGEIA 283
                 V    + D ++ G    
Sbjct: 252 LPIPNAVALFQLRDIQETGAATP 274



 Score = 36.2 bits (82), Expect = 6.7,   Method: Composition-based stats.
 Identities = 16/119 (13%), Positives = 44/119 (36%), Gaps = 5/119 (4%)

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNT 257
           +  +  A+  R R+   CN L   A       + +      +++       L K      
Sbjct: 292 EAALAQAQTLRGRVDT-CNDLYGVAKGQP-AEVLERVTKAPAEIPQDIAIELSKLDPGEV 349

Query: 258 TNPYVTQKG--VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           +       G  + ++ +CD+     +   +  ++      ++  +  + +++LR++A I
Sbjct: 350 STALTRANGQTLMFLMMCDRTSASNQDTSRTDVANALRQERLSGYADQLLEQLRADARI 408


>gi|83942391|ref|ZP_00954852.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. EE-36]
 gi|83846484|gb|EAP84360.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. EE-36]
          Length = 405

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 42/278 (15%), Positives = 102/278 (36%), Gaps = 10/278 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +        L +    P+ +   +A        +N  V+T+ ++ +R   L++    G  
Sbjct: 6   LTRSIAVLGLGLMTAAPVSAQNLFAP----VAKVNESVVTEFEVQQRQRFLEVLNAPGAT 61

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A+  LI E L+ + + ++GI      +     + A    LS E+F+  L + G+   
Sbjct: 62  REGALTSLIDERLRNEAVAEAGIELTPQGIEDSLAEFASRADLSTEEFTQALGQSGVSRE 121

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            F+ ++     W ++V+  +  +    + EI     + +   VR  +   ++ + P    
Sbjct: 122 TFRDFVVNSVGWRELVRARYASRVQITDAEINRALGETQGSGVRVLVSEIIIPAPPQQAA 181

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLK 251
           +     ++  +    +        N   ++++       G+  +   +DL P  Q  +L 
Sbjct: 182 RVNALAEQISQSKSTAEF-----SNYASRYSATASRGRGGRLPWQNLTDLPPSLQPLILN 236

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS 289
            +    T+P      V    + D  +        + + 
Sbjct: 237 LAPGEVTDPLPIPNAVALFQLRDIEETSVAAPTYSEIE 274


>gi|83953611|ref|ZP_00962332.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83841556|gb|EAP80725.1| PPIC-type PPIASE domain protein [Sulfitobacter sp. NAS-14.1]
          Length = 405

 Score =  188 bits (478), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 42/278 (15%), Positives = 102/278 (36%), Gaps = 10/278 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +        L +    P+ +   +A        +N  V+T+ ++ +R   L++    G  
Sbjct: 6   LTRSIAVLGLGLMTAAPVSAQNLFAP----VAKVNESVVTEFEVQQRQRFLEVLNAPGAT 61

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A+  LI E L+ + + ++GI      +     + A    LS E+F+  L + G+   
Sbjct: 62  REGALTSLIDERLRNEAVAEAGIELTPQGIEDSLAEFASRADLSTEEFTQALGQSGVSRE 121

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            F+ ++     W ++V+  +  +    + EI     + +   VR  +   ++ + P    
Sbjct: 122 TFRDFVVNSVGWRELVRARYASRVQITDAEINRALGETQGSGVRVLVSEIIIPAPPQQAA 181

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLK 251
           +     ++  +    +        N   ++++       G+  +   +DL P  Q  +L 
Sbjct: 182 RVNALAEQISQSKSTAEF-----SNYASRYSATASRGRGGRLPWQNLTDLPPSLQPLILN 236

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS 289
            +    T+P      V    + D  +        + + 
Sbjct: 237 LAPGEVTDPLPIPNAVALFQLRDIEETSVTAPTYSEIE 274


>gi|315635080|ref|ZP_07890360.1| peptidyl-prolyl cis-trans isomerase [Aggregatibacter segnis ATCC
           33393]
 gi|315476201|gb|EFU66953.1| peptidyl-prolyl cis-trans isomerase [Aggregatibacter segnis ATCC
           33393]
          Length = 307

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/311 (17%), Positives = 116/311 (37%), Gaps = 28/311 (9%)

Query: 23  IIFCIVPIVSYKSWAMSSR-IRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           ++F  +  +++ + A +   +  T+NG  + +  +   +             + A+ ++I
Sbjct: 6   VLFVALGFLAFIANAQAEEKVVATVNGVPVLESQVKSAL-------TKKSNRQAALDKVI 58

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L  Q +++SG++ ++  V+      A   GL+       LD QGI    ++Q +A Q
Sbjct: 59  DDILVAQAVKESGVSVNNAQVDQIIEGIAAQNGLTFGQLLDALDYQGISYAAYRQQIAQQ 118

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRTVLFSIPDNK 191
            +  +V              ++ A           K  +  +T  +Y +R +L  +  N 
Sbjct: 119 LMMSEVRNRAISQSVDVSREQVEALAKKMLAEAKAKGNVAKLTDTQYEVRHILLKL--NP 176

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQFQNL 249
           L N    + +++      L             SK  +   + G   Y         F   
Sbjct: 177 LLNDAQAKAQLEQIRADILAGKTTFADAALKYSKDYLSGANGGSLGYAFPEMYVGPFNKA 236

Query: 250 LKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYV 305
           ++ + Q   + P+ T+ G   + + + R    +    AY      Q    +++    ++V
Sbjct: 237 VRTTKQGVISAPFKTEFGWHILEVTNTRQ--ADRTEDAYRQKAYEQIVNQQLQDSARDWV 294

Query: 306 KKLRSNAIIHY 316
           + LR  A I Y
Sbjct: 295 QALRKRANIKY 305


>gi|126728790|ref|ZP_01744605.1| PPIC-type PPIASE domain [Sagittula stellata E-37]
 gi|126710720|gb|EBA09771.1| PPIC-type PPIASE domain [Sagittula stellata E-37]
          Length = 412

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 99/237 (41%), Gaps = 6/237 (2%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
              +N +VIT  ++ +R  +L++ +  G+L K+A ++LI + L+ Q    +GI      +
Sbjct: 35  AVIVNEQVITGYELEQRKRMLQVMRAPGDLNKVAREQLIDDRLRLQAARDAGIQPSPEEL 94

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
                + A    L+ E F+  L + G+ +  ++ ++     W  +V+  F  +    E E
Sbjct: 95  LDGMEEFASRASLTREQFTQALAQAGVDEETYRDFVRAGLSWRMLVQQRFAGRANVSEDE 154

Query: 163 IPANKQKMKNITVRE-YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           +       +N T     L+  ++  +P  + +      +RI   +++         +  +
Sbjct: 155 VDRALSSGQNGTSTVRVLLSEIIMPMPPGQEEVVRERAQRIAQLDDT----GAFSAQARR 210

Query: 222 FASKIHDVSIGKAQYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRD 277
           F++     + G+  +   S+L P  Q + L  +    ++P   Q  +    +    +
Sbjct: 211 FSATASRGAGGQLPWRSLSELPPPLQPIVLGLAPGEVSDPIPLQGAMALFQLRAIEE 267


>gi|251793857|ref|YP_003008589.1| SurA [Aggregatibacter aphrophilus NJ8700]
 gi|247535256|gb|ACS98502.1| SurA [Aggregatibacter aphrophilus NJ8700]
          Length = 308

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 53/311 (17%), Positives = 116/311 (37%), Gaps = 27/311 (8%)

Query: 23  IIFCIVPIVS-YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           + F  V I++   +     ++  T+NG  + +  +                 + A+ ++I
Sbjct: 6   VFFSAVGILALVANVQAEEKVVATVNGIPVLESQVQ------SALNKKTNNRQAALNKVI 59

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L  Q +++SG+  ++  V+      A   GL+       LD QGI    ++Q +A Q
Sbjct: 60  DDILVDQAVQESGVKVNNAQVDKIIEGIAAQNGLTFGQLLDALDYQGISYRAYRQQIAQQ 119

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRTVLFSIPD-- 189
            +  +V  +           ++ A          +K  +  ++  +Y +R +L  +    
Sbjct: 120 VMMSEVRNHAISQSVDISREQVEALAKKMLDEAKSKGSVAKVSDTQYEVRHILLKLNPLL 179

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           N  Q +  +++   D    ++       K  K    +   + G   Y         F   
Sbjct: 180 NDAQAKAQLEQIRADIIAGKMTFADAALKYSKDY--LSGANGGSLGYAFPEMYVGPFNQA 237

Query: 250 LKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIEKHEAEYV 305
           ++ + Q   + P+ T+ G   + + + R   G+    AY      Q    +++    ++V
Sbjct: 238 IRTTKQGVISAPFKTEFGWHILEVTNTRQ--GDRTEDAYRQKAYEQIVNQQLQDSARDWV 295

Query: 306 KKLRSNAIIHY 316
           + LR  A I Y
Sbjct: 296 QALRKRADIKY 306


>gi|293391019|ref|ZP_06635353.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951553|gb|EFE01672.1| chaperone/peptidyl-prolyl cis-trans isomerase SurA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 310

 Score =  187 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 49/318 (15%), Positives = 110/318 (34%), Gaps = 27/318 (8%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSR-IRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +      ++F  +      +   +   +  T+NG  I +  +   I             +
Sbjct: 1   MKMNLKFVLFAAIGFFVLAAHVHAEEKVVATVNGIPILESQVQSAI------NKKTNDRQ 54

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A+ ++I + L  Q +++S +  ++  ++      A   GL+       LD QGI    +
Sbjct: 55  AALNKVIDDILVDQAVKESDVKVNNAQIDQIIEGIAAQNGLTFGQLLDALDYQGISYRAY 114

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRTVL 184
           +Q +A Q +  +V  +           ++ A           K  +  I+  +Y +R +L
Sbjct: 115 RQQIAQQVMMSEVRNHAISQSVDVSREQVEALAKKMLDEAKAKGSVAQISDTQYEVRHIL 174

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDL 242
             +  N L N    + +++      +             SK  +   + G   Y      
Sbjct: 175 LKL--NPLLNDAQAKAQLEQIRADIIAGKTTFADAALKYSKDYLSGANGGSLGYAFPEMY 232

Query: 243 HPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIE 298
              F   ++ +     + P+ T+ G   + + + R    +    AY      Q    +++
Sbjct: 233 VGPFNQAVRTTKPGVISAPFRTEFGWHILEVTNTRQ--ADRTEDAYRQKAYEQIVNQQLQ 290

Query: 299 KHEAEYVKKLRSNAIIHY 316
               ++V+ LR    I Y
Sbjct: 291 DSARDWVQALRKRVDIKY 308


>gi|261867180|ref|YP_003255102.1| SurA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412512|gb|ACX81883.1| SurA [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 310

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 50/318 (15%), Positives = 112/318 (35%), Gaps = 27/318 (8%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSR-IRTTINGEVITDGDISKRIALLKLQKINGELEK 74
           +      ++F  +      +   +   +  T+NG  I +  +   I             +
Sbjct: 1   MKMNLKSVLFAAIGFFVLAAHVHAEEKVVATVNGIPILESQVQSAI------NKKTNDRQ 54

Query: 75  IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
            A+ ++I + L  Q +++S +  ++  ++      A   GL+       LD QGI    +
Sbjct: 55  AALNKVIDDILVDQAVKESDVKVNNAQIDQIIEGIAAQNGLTFGQLLDALDYQGISYRAY 114

Query: 135 KQYLAIQSIWPDV----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVL 184
           +Q +A Q +  +V          V  + +       ++    K  +  I+  +Y +R +L
Sbjct: 115 RQQIAQQVMMSEVRNHAISQSVDVSREQVEVLAKKMLDEAKAKGSVAQISDTQYEVRHIL 174

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDL 242
             +  N L N    + +++      +             SK  +   + G   Y      
Sbjct: 175 LKL--NPLLNDAQAKAQLEQIRADIIVGKTTFADAALKYSKDYLSGANGGSLGYAFPEMY 232

Query: 243 HPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTKIE 298
              F   ++ +     + P+ T+ G   + + + R    +    AY      Q    +++
Sbjct: 233 VGPFNQAVRTTKPGVISAPFKTEFGWHILEVTNTRQ--ADRTEDAYRQKAYEQIVNQQLQ 290

Query: 299 KHEAEYVKKLRSNAIIHY 316
               ++V+ LR  A I Y
Sbjct: 291 DSALDWVQALRKRADIKY 308


>gi|163743160|ref|ZP_02150542.1| PPIC-type PPIASE domain [Phaeobacter gallaeciensis 2.10]
 gi|161383577|gb|EDQ07964.1| PPIC-type PPIASE domain [Phaeobacter gallaeciensis 2.10]
          Length = 421

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 50/260 (19%), Positives = 105/260 (40%), Gaps = 12/260 (4%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F   P  +   +A +     T+N  V+T+ ++ +R   L L +  G+ +K A ++LI+
Sbjct: 32  VMFGPAPAAAQGLFAPA----VTVNDAVVTNYELQQRARFLTLLRDPGDPQKKAREDLIL 87

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + LK   + ++GI      +     + A    LS ++F + L + G+     + +  +  
Sbjct: 88  DRLKLDVLAQAGIEPTEEEIVEGMTELAGRANLSLQEFLNVLGQNGVAPETLRDFTRVGI 147

Query: 143 IWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
            W + V   ++ +    E EI        +  V   L   ++     N  Q +   Q+  
Sbjct: 148 AWREYVAARYLAQARPSEEEIDRAMGLAGSGGVEVLLSELIMPINAQNAAQVEEVAQQ-- 205

Query: 203 KDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNP 260
                SR+      ++   ++++     S G+  ++  ++L PQ Q  +L       T P
Sbjct: 206 ----VSRITTTAAFSQAAQQYSATATRQSGGRLPWMPLTNLPPQLQQVVLGLRPGEVTAP 261

Query: 261 YVTQKGVEYIAICDKRDLGG 280
                 V    + D R+  G
Sbjct: 262 LPLDGAVALFQLRDLRETSG 281


>gi|163739707|ref|ZP_02147115.1| leucyl aminopeptidase [Phaeobacter gallaeciensis BS107]
 gi|161386937|gb|EDQ11298.1| putative chaperone surA [Phaeobacter gallaeciensis BS107]
          Length = 421

 Score =  187 bits (474), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 50/260 (19%), Positives = 105/260 (40%), Gaps = 12/260 (4%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIV 82
           ++F   P  +   +A +     T+N  V+T+ ++ +R   L L +  G+ +K A ++LI+
Sbjct: 32  VMFGPAPAAAQGLFAPA----VTVNDAVVTNYELQQRARFLTLLRDPGDPQKKAREDLIL 87

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + LK   + ++GI      +     + A    LS ++F + L + G+     + +  +  
Sbjct: 88  DRLKLDVLAQAGIEPTEEEIVEGMTELAGRANLSLQEFLNVLGQNGVAPETLRDFTRVGI 147

Query: 143 IWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
            W + V   ++ +    E EI        +  V   L   ++     N  Q +   Q+  
Sbjct: 148 AWREYVAARYLAQARPSEEEIDRAMGLAGSGGVEVLLSELIMPINAQNAAQVEEIAQQ-- 205

Query: 203 KDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNP 260
                SR+      ++   ++++     S G+  ++  ++L PQ Q  +L       T P
Sbjct: 206 ----VSRITTTGAFSQAAQQYSATATRQSGGRLPWMPLTNLPPQLQQVVLGLRPGEVTAP 261

Query: 261 YVTQKGVEYIAICDKRDLGG 280
                 V    + D R+  G
Sbjct: 262 LPLDGAVALFQLRDLRETSG 281


>gi|86138690|ref|ZP_01057263.1| PPIC-type PPIASE domain protein [Roseobacter sp. MED193]
 gi|85824750|gb|EAQ44952.1| PPIC-type PPIASE domain protein [Roseobacter sp. MED193]
          Length = 396

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 46/270 (17%), Positives = 100/270 (37%), Gaps = 7/270 (2%)

Query: 22  LIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL 80
           + +   +   +    A        T++   IT  ++++R   + + +  G+ E +A QEL
Sbjct: 1   MTLGFALSTTAVPLAAQGLFSPAVTVDNAAITYYELNQRALFMGVLRTPGDPEVMARQEL 60

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I + LK  E+ K GI+     +     + A    LS  +F + L + GI     + +  +
Sbjct: 61  IKDRLKLAELAKVGISPSEEEITAGMTELASRANLSLNEFLTVLKQNGIDPETVRDFTKV 120

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
              W + +   F+ +    E EI     +  +  V+  L   ++     N  Q +    +
Sbjct: 121 GIGWREYIGARFLSRARPTEAEIDRAMGQAGSGGVQVLLSELIVPINEQNAQQVEALTDQ 180

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTN 259
             +             +   ++++     + G+  ++  + L PQ Q  +L       T 
Sbjct: 181 VGQL-----TSFAAFSSAATQYSASDSRNNGGRLPWMNLTKLPPQLQPVVLALDPGEITE 235

Query: 260 PYVTQKGVEYIAICDKRDLGGEIALKAYLS 289
           P   Q  V    +   R++ G     + + 
Sbjct: 236 PLPLQGAVAMFQMRGVREVTGSRQRYSAIE 265


>gi|254362982|ref|ZP_04979046.1| peptidylprolyl isomerase [Mannheimia haemolytica PHL213]
 gi|153094638|gb|EDN75442.1| peptidylprolyl isomerase [Mannheimia haemolytica PHL213]
          Length = 314

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 61/320 (19%), Positives = 118/320 (36%), Gaps = 25/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL+ + F + +  +   ++  + A   R+   +N   I    + +   +L  +K     
Sbjct: 1   MKLVKSLFAVAVATMS--LTQTAHAFEERVVALVNDTPIMQSQVQR---VLGKKKATETA 55

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++ A+ ++I + L +Q ++++G+      VN      A   G++       LD QGI   
Sbjct: 56  QRAAIDQVIDDMLVQQAMKEAGVKVSPAAVNQAVENVAIQNGITYGQLLDALDYQGITLE 115

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRT 182
            FK+ +A Q     V              ++ A             K+K ++ +E+ I  
Sbjct: 116 QFKRNIAQQMAMEQVRHISISKSIQVAPQQVQALAKELMAKDKAAGKLKTVSGKEHRISH 175

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLES 240
           +L     N + N    + ++               +  K  S         G   +    
Sbjct: 176 ILLKT--NPILNDAQAKAKLSSLTTDINSGKISFEEAAKTHSVDYASGADGGDLGFNFLE 233

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F N+  K   N  + P+ +Q G   + + D R+  G+    AY      Q    +
Sbjct: 234 IYDPAFANVASKIKPNQISAPFKSQFGWHILKVTDTRN--GDRTEDAYHQRAYQQLVNKQ 291

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            E+   ++VK LR  A I Y
Sbjct: 292 AEEASKDWVKALRKTANIQY 311


>gi|261493819|ref|ZP_05990333.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495044|ref|ZP_05991511.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309286|gb|EEY10522.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310522|gb|EEY11711.1| peptidylprolyl isomerase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 314

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 61/320 (19%), Positives = 118/320 (36%), Gaps = 25/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL+ + F + +  +   ++  + A   R+   +N   I    + +   +L  +K     
Sbjct: 1   MKLVKSLFAVAVATMS--LTQTAHAFEERVVALVNDTPIMQSQVQR---VLGKKKATETA 55

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++ A+ ++I + L +Q ++++G+      VN      A   G++       LD QGI   
Sbjct: 56  QRAAIDQVIDDMLVQQAMKEAGVKVSPAAVNQAVENVAIQNGITYGQLLDALDYQGITLE 115

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA----------NKQKMKNITVREYLIRT 182
            FK+ +A Q     V              ++ A             K+K ++ +E+ I  
Sbjct: 116 QFKRNIAQQMAMEQVRHISISKSIQVAPQQVQALAKELMAKDKAAGKLKTVSGKEHRISH 175

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLES 240
           +L     N + N    + ++               +  K  S         G   +    
Sbjct: 176 ILLKT--NPILNDAQAKAKLSSLTADINSGKISFEEAAKAHSVDYASGTDGGDLGFNFLE 233

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F N+  K   N  + P+ +Q G   + + D R+  G+    AY      Q    +
Sbjct: 234 IYDPAFANVASKIKPNQISAPFKSQFGWHILKVTDTRN--GDRTEDAYHQRAYQQLVNKQ 291

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            E+   ++VK LR  A I Y
Sbjct: 292 AEEASKDWVKALRKTANIQY 311


>gi|56697307|ref|YP_167673.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Ruegeria pomeroyi DSS-3]
 gi|56679044|gb|AAV95710.1| PPIC-type PPIASE domain [Ruegeria pomeroyi DSS-3]
          Length = 412

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 112/309 (36%), Gaps = 11/309 (3%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL 65
            T+LS  +  +     L +      V+ +S          +N  VIT  ++ +RI L+++
Sbjct: 5   LTTLSRCLARMMGAAALTLTLAGGPVAAQSLF---SPAIRVNQGVITHFELEQRIRLMEV 61

Query: 66  QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
            +I G+ +K A + LI E LK Q +E++GI      V       A    LS ++F + L 
Sbjct: 62  LRIPGDPQKDARRSLIEEALKMQAVEEAGIEVAPEDVQLGIDDFAARARLSTDEFLAALA 121

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
            +G+     + +++ Q  W D V   F+ +      EI           ++  L   ++ 
Sbjct: 122 NEGVSAETVRDFVSKQMAWRDYVSARFLARARPTPDEIDRALGLGGGGGLQVLLSEIIIP 181

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
             P    Q     Q+       +        +   + ++     + G+  ++  + L P 
Sbjct: 182 ITPQTVDQVDEVAQQI-----AALTSYEAFSSAAIQVSAAETRENGGRMPWIPLAQLPPA 236

Query: 246 FQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL--SAQNTPTKIEKHEA 302
            Q  +L+      ++P      V    +   R+        A +  +A            
Sbjct: 237 LQPVILELEPGEISDPITLPNAVALFQMRGLREAAVGTPRYAAIDYAAYRMAGGRSPETL 296

Query: 303 EYVKKLRSN 311
           +   +LR  
Sbjct: 297 KAATELRQR 305


>gi|254464586|ref|ZP_05077997.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacterales
           bacterium Y4I]
 gi|206685494|gb|EDZ45976.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacterales
           bacterium Y4I]
          Length = 305

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 97/258 (37%), Gaps = 10/258 (3%)

Query: 28  VPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKK 87
           +P  +   +A +     T+N +VIT  ++ +R       ++ G+  + A +ELI + LK 
Sbjct: 31  LPAGAQNLFAPA----ITVNDQVITRYELEQRARFQAALRVPGDPLETAREELINDRLKL 86

Query: 88  QEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV 147
             ++++GI      +     + A    LS  +F + L +QG+     + +  +   W + 
Sbjct: 87  MVLKQAGIELSEEDITAGMEELAGRANLSLNEFLTVLQQQGVAPQTLRDFTKVGLGWREY 146

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
            +  F+ +      EI          +V+  L   ++     N  Q +  V++  K    
Sbjct: 147 TRARFLSRARPTPEEIDRAMGTSGTGSVQVLLSEFIVPLNDQNAAQVEELVEQVAKLKG- 205

Query: 208 SRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKG 266
                        ++++       G+  ++  + L PQ Q  +L       + P   Q  
Sbjct: 206 ----YDSFSAAATQYSAAGSRGDGGRLPWMPLTKLPPQLQEVVLALQPGEISEPLPLQGA 261

Query: 267 VEYIAICDKRDLGGEIAL 284
           V    +   R++ G    
Sbjct: 262 VALFQMRGLREVEGAAPR 279


>gi|114766150|ref|ZP_01445154.1| PPIC-type PPIASE domain [Pelagibaca bermudensis HTCC2601]
 gi|114541610|gb|EAU44652.1| PPIC-type PPIASE domain [Roseovarius sp. HTCC2601]
          Length = 408

 Score =  183 bits (464), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 47/268 (17%), Positives = 105/268 (39%), Gaps = 6/268 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGEL 72
             L     L     + +    + A +      T++  VIT  +I +R  ++ L    G +
Sbjct: 4   ARLLRALTLTAGLALTVTPGTAPAQNLFAPAITVDEMVITGYEIEQRRRMMTLLNAPGNV 63

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +++ ++LI + L+ +    +GI      +     + A    LS E F + L++ G+ + 
Sbjct: 64  NELSREQLIDDRLRLKAARAAGIEPSEQDILDGMDEFAGRADLSREQFVAVLNQGGVDEE 123

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            F+ ++   + W D+V+  F  +      E+          +    L+  ++  I     
Sbjct: 124 TFRDFVRAGTAWRDLVRAQFASRTQVTPEEVDRALASGGGSSDVRVLLSEIIMPI---NA 180

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLK 251
           QN   VQ R +   +          +  ++++     + G+  +   ++L PQ ++ +L 
Sbjct: 181 QNAESVQARAERISQMTST-ADFSAQARQYSATATRDNGGRLPWRDLTELPPQIRSLVLG 239

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLG 279
            +    T+P   Q  V    + D  + G
Sbjct: 240 LAPGEVTDPLPIQGAVALFQLRDIEETG 267



 Score = 41.2 bits (95), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 43/116 (37%), Gaps = 5/116 (4%)

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNP 260
           +  A     R+ + C+ L   A    +  +     L  +++       L K      +  
Sbjct: 292 LAQARVLAERIDR-CDDLYAVAKGQPEEVL-DRGALPPAEIPTDIAYELSKLDPGEVSTA 349

Query: 261 YVTQKG--VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
               +G  + ++ +C +     E A ++ +       ++ +    Y+ +LR+NA I
Sbjct: 350 LTRAEGQTLVFLMLCGRTAAVAEDADRSQVEIGLRNRRLSEVSDSYLAQLRANARI 405


>gi|240949661|ref|ZP_04753996.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor
           NM305]
 gi|240295919|gb|EER46595.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor
           NM305]
          Length = 317

 Score =  182 bits (462), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 66/320 (20%), Positives = 117/320 (36%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +K  +   +L+ F     +S   +A   R+  T++G +I +  +++    L  +      
Sbjct: 1   MKFTSAKSLLVAFVATLGLSQSLFAAEERVVATVDGNMIMESQVAR---ALGKKANTEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++ +I E L ++ I++SG+  D   V+    + A   GL+       LD QGI  N
Sbjct: 58  RKAALESIIDEMLVQKAIQQSGVKVDYRRVDQAIEEIAARNGLTYGQLLDALDYQGISLN 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ----------KMKNITVREYLIRT 182
            ++Q +A Q +   V              E+ A  Q          K+K ++  E  I  
Sbjct: 118 QYRQQIAQQMMMEAVRHQSIGKSIQVNPEEVRAQAQALMAKDKAAGKLKAVSGTEPRISH 177

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQY-LLE 239
           +L       + N    + ++               +  K  S   +     G   +  L+
Sbjct: 178 ILIKT--TPVLNDAQAKAKLNSIIADIKAGKTTFEEAAKANSVDYVSAADGGDLGFNFLD 235

Query: 240 SDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
                      K  Q   T P+ +Q G   + + D R   G+    AY      Q    +
Sbjct: 236 IYDPAFANAAAKAKQGQITAPFKSQFGWHILKVTDSRQ--GDRTEDAYAQRAYEQLANQQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            E    ++VK LR  A I Y
Sbjct: 294 AEAASKDWVKALRKTANIQY 313


>gi|254476481|ref|ZP_05089867.1| ppic-type ppiase domain protein [Ruegeria sp. R11]
 gi|214030724|gb|EEB71559.1| ppic-type ppiase domain protein [Ruegeria sp. R11]
          Length = 421

 Score =  181 bits (460), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 97/255 (38%), Gaps = 8/255 (3%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIE 91
           +  S         T+N  V+T+ ++ +R   L L +  G+  + A ++LI + LK + + 
Sbjct: 37  AVGSAQGLFSPAVTVNDSVVTNYELQQRARFLALLREPGDPLEKAREDLIEDRLKLEVLA 96

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           ++GI      V     + A    LS ++F + L + G+     + +  +   W   V + 
Sbjct: 97  QAGIDPTDEEVTAGMTELAGRANLSLQEFLNVLRENGVDPQTLRDFSRVGIAWRGYVGSR 156

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
           ++ +    E EI        +  V   L   ++     N  Q +   Q+       +++ 
Sbjct: 157 YIGQARPSEEEIDRAMGLSGSGGVEVLLSELIMPINAQNAPQVEEVAQQ------VAQMN 210

Query: 212 LPKDCNKLEKFASKIHD-VSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEY 269
                ++     S      + G+  ++  ++L PQ Q  +L+ S    T P      V  
Sbjct: 211 TTAAFSQAATQFSAARTRENGGRLPWMPLTNLPPQLQQVVLELSPGEVTAPIPLDNAVAL 270

Query: 270 IAICDKRDLGGEIAL 284
             + D R+  G    
Sbjct: 271 FQMRDLRESAGSAPR 285


>gi|149201836|ref|ZP_01878810.1| PPIC-type PPIASE domain [Roseovarius sp. TM1035]
 gi|149144884|gb|EDM32913.1| PPIC-type PPIASE domain [Roseovarius sp. TM1035]
          Length = 414

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 34/275 (12%), Positives = 102/275 (37%), Gaps = 7/275 (2%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKL 65
           ++   + L     L +  ++        A +  +   +  +N + IT  ++ +R  LL L
Sbjct: 1   MTPIFRRLIAALTLAVTGLLVWPLSGGMAQAQNLFSPQIYVNDQAITGYELQQRARLLTL 60

Query: 66  QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
            +  G+ +++A ++LI E +K      SG+  + + V     + A    ++A+   + L 
Sbjct: 61  FRAPGDPQRLAREQLIEERIKIDAARASGLVLEEDLVRDGMEEFAGRANMTADQLIAALG 120

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
             G+    F++++     W ++ +  F  +    E ++    + +        L+  ++ 
Sbjct: 121 DSGVSQESFREFVRAGITWRELTRARFAARVSVSEDDLERATRALTGGAAVRVLLSEIIL 180

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
            +           ++ +  +               + ++       G+  ++  S+L   
Sbjct: 181 PV---TSLEDAEAKQALAASIAESTSEGAFAEAARRHSAAPSSSRGGRMDWVALSELPAG 237

Query: 246 FQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
            + + L  +    ++P   +  +    + D  ++ 
Sbjct: 238 LRPIVLGLAPGEVSDPLPLEGALALFYMRDIEEMT 272


>gi|85706339|ref|ZP_01037433.1| PPIC-type PPIASE domain protein [Roseovarius sp. 217]
 gi|85669112|gb|EAQ23979.1| PPIC-type PPIASE domain protein [Roseovarius sp. 217]
          Length = 420

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 35/278 (12%), Positives = 101/278 (36%), Gaps = 7/278 (2%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIAL 62
            T ++  ++       L    +  +    S   +  +      +N + IT  ++ +R  +
Sbjct: 4   LTRMTPILRRTLAALTLAAIGLTGLPGGVSPVQAQNLFAPAIHVNDQAITGYELQQRARM 63

Query: 63  LKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
           L L +  G+  ++A ++LI E +K       G+  + + V     + A    ++A+   S
Sbjct: 64  LTLFRAPGDPRRLAREQLIEERIKLDAARAVGLVVEDDMVRTGMEEFAGRANMTADQLIS 123

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            L++ G+    F++++     W ++ +  F  +    E ++    + +        L+  
Sbjct: 124 SLEEAGVSQQSFREFVRAGITWRELTRAQFASRVSVSEDDLERATRALTGGAAVRVLLSE 183

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           ++  +           ++ +                  ++++       G+ +++  SDL
Sbjct: 184 IILPV---TSLGDAEAKQALATQIAEADSEGDFAAAARQYSAAPSAGRGGRMEWVALSDL 240

Query: 243 HPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
               + + L  +    ++P     G+    + D  +  
Sbjct: 241 PAGLRPIVLGLAPGEVSDPLPIDGGLALFYMRDIEETS 278



 Score = 36.9 bits (84), Expect = 4.3,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 46/149 (30%), Gaps = 11/149 (7%)

Query: 170 MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV 229
             ++   EY    + ++             +R      +       C+ L   A      
Sbjct: 276 ETSVAAPEY--SAIEYAAYYISGGRSAEALQRAAQVRAA----VDTCDDLYGVAKGQPPE 329

Query: 230 SIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKG--VEYIAICDKRD-LGGEIALK 285
            + +       ++       L +     T+       G  + ++ +C +   L GE    
Sbjct: 330 VL-ERGSKAPEEIPQDIAAALSQLDPGETSASVTRSNGQTLVFLMLCGRSPKLDGEAPSV 388

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             LS      +IE     Y+++LR+ A I
Sbjct: 389 EDLSNFIRNQRIESFANGYLEQLRAEARI 417


>gi|332558337|ref|ZP_08412659.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides WS8N]
 gi|332276049|gb|EGJ21364.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides WS8N]
          Length = 405

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 102/273 (37%), Gaps = 9/273 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKIN 69
           +K   ++ + ++       +    A++  +   R  +N  VIT+ +  +R+  L +    
Sbjct: 1   MKTFVSHCLALVVAAGLTFTSAPGALAQNLFAPRLVVNDRVITNYEFEQRVRFLTILGAT 60

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G++EK A+  LI + ++    E++G+      +     + A    LSAE F++ L K G+
Sbjct: 61  GDVEKQAMDALIEDKIRFDAAEQAGLKATEEQIKEGMEEFAGRANLSAEQFAAELGKAGV 120

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               F+ ++    IW ++++  F       E  I     +  +      L+  ++   P 
Sbjct: 121 AVETFRDFVHAGLIWRELMRAKFGAVARPTETAIDRAITRQTSRASIRLLLSEIIIPAPP 180

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
            +      +   I+      +R      +  +  S        G+  ++   +L P    
Sbjct: 181 GQEAEAQALAAEIRRN----VRGEGAFAEAARTYSASSSAERGGRIDWVPLQNLPPTLGP 236

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
            LL  S    ++P      V    +  + +   
Sbjct: 237 MLLTLSPGQVSDPVKIPNAVALFQLRGRDESSA 269



 Score = 37.7 bits (86), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 34/103 (33%), Gaps = 2/103 (1%)

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNPYVTQKGVEYIA 271
             DC+ L        +  + +   L  + +       L        ++  +       + 
Sbjct: 301 ADDCDDLYTVMQGAPEQQLRRT-TLPLAQVPQDVALELAGLDAGEVSSSALPGGTRRVLM 359

Query: 272 ICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           +C +R +  E   +  L+       I      Y+  LR+NAII
Sbjct: 360 LCARRPVSAEPIDRGRLAQALANQSISASADAYMADLRANAII 402


>gi|126736394|ref|ZP_01752136.1| PPIC-type PPIASE domain [Roseobacter sp. CCS2]
 gi|126714215|gb|EBA11084.1| PPIC-type PPIASE domain [Roseobacter sp. CCS2]
          Length = 383

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 105/239 (43%), Gaps = 8/239 (3%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
             T+N  VIT  ++S+RI LL++ +  G+L + A   LI + LK+QE+ + G++   + +
Sbjct: 9   VITVNDRVITQYELSQRIRLLEVFRTPGDLNEAARNALIEDRLKQQELARFGVSVPEDAL 68

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
                + A    +S   F+  L + GI  +  + ++ +  +W D +++ F  +    + +
Sbjct: 69  QQAMEEFAGRANMSLPQFTRVLAQDGIDISTLRDFVEVGILWRDFIRSRFNRQITITDAD 128

Query: 163 IP-ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           +  A  Q+    +  E L+  ++ + P  +         +I     SR+R   +     +
Sbjct: 129 VERAIVQQGNTTSQLEVLLNEIIIAPPPGREAAAAQAADQI-----SRMRSFAEFEAAAR 183

Query: 222 FASKIHD-VSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDL 278
             S +    + G+  +   S+  PQ ++ +L   +   T+P      +    +   R+ 
Sbjct: 184 QVSALPSRENGGRLDWTPVSNFPPQIRSIILDLDRGEVTDPIEIPNAIALFQLRGTREA 242


>gi|126462315|ref|YP_001043429.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126103979|gb|ABN76657.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 435

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 103/273 (37%), Gaps = 9/273 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKIN 69
           +K   ++ + ++       +    A++  +   R  +N  VIT+ +  +R+  L +    
Sbjct: 31  MKTFVSHCLALVVAAGLTFTSAPGALAQNLFAPRLVVNDRVITNYEFEQRVRFLTILGAT 90

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G++EK A+  LI + ++    E++G+      +     + A    LSAE F++ L K G+
Sbjct: 91  GDVEKQAMDALIEDKIRFDAAEQAGLKATEEQIKEGMEEFAGRANLSAEQFAAELGKAGV 150

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               F+ ++    IW ++++  F       E  I     +  +      L+  ++   P 
Sbjct: 151 AVETFRDFVHAGLIWRELMRAKFGAVARPTETAIDRAITRQTSRASIRLLLSEIIIPAPP 210

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
            +      +   I++     +R      +  +  S        G+  ++   +L P    
Sbjct: 211 GQEAEAQALAAEIRNN----VRGEGAFAEAARTYSASSSAERGGRIDWVPLQNLPPTLGP 266

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
            LL  S    ++P      V    +  + +   
Sbjct: 267 MLLTLSPGQVSDPVKIPNAVALFQLRGRDESSA 299



 Score = 38.5 bits (88), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 34/103 (33%), Gaps = 2/103 (1%)

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNPYVTQKGVEYIA 271
             DC+ L        +  + +   L  + +       L        ++  +       + 
Sbjct: 331 ADDCDDLYTVMKGATEQQLRRT-TLPLAQVPQDVALELAGLDAGEVSSSALPGGTRRVLM 389

Query: 272 ICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           +C +R +  E   +  L+       I      Y+  LR+NAII
Sbjct: 390 LCARRPVSAEPIDRGRLAQALANQSISASADAYMADLRANAII 432


>gi|257465500|ref|ZP_05629871.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor 202]
 gi|257451160|gb|EEV25203.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus minor 202]
          Length = 317

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/320 (20%), Positives = 115/320 (35%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +K  +   +L+ F     +S    A   R+  T++G +I +  +      L  +      
Sbjct: 1   MKFTSAKSLLVAFVATLGLSQSLLAAEERVIATVDGNMIMESQV---TRALGKKANTEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++ +I E L ++ I++SG+  D   V+    + A   GL+       LD QGI  N
Sbjct: 58  RKAALENIIDEMLVQKAIQQSGVKVDYRRVDQAIEEIAVRNGLTYGQLLDALDYQGITLN 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ----------KMKNITVREYLIRT 182
            ++Q +A Q +   V              ++ A  Q          K+K+++  E  I  
Sbjct: 118 QYRQQIAQQMMMEAVRHQSIGKSIQVNPEDVRAQAQALMAKDKAAGKLKSVSGTEPRISH 177

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQY-LLE 239
           +L       + N    + ++               +  K  S   +     G   +  L+
Sbjct: 178 ILIKT--TPVLNDAQAKAKLNSIIADIKAGKTTFEEAAKANSVDYVSAADGGDLGFNFLD 235

Query: 240 SDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
                      K  Q   T P+ +Q G   + + D R   G+    AY      Q    +
Sbjct: 236 IYDPAFANAAAKAKQGQITAPFKSQFGWHILKVTDYRQ--GDRTEDAYAQKAYEQLANQQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            E    ++VK LR  A I Y
Sbjct: 294 AEAASKDWVKALRKTANIQY 313


>gi|126739402|ref|ZP_01755095.1| PPIC-type PPIASE domain [Roseobacter sp. SK209-2-6]
 gi|126719502|gb|EBA16211.1| PPIC-type PPIASE domain [Roseobacter sp. SK209-2-6]
          Length = 426

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 48/273 (17%), Positives = 106/273 (38%), Gaps = 9/273 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKINGEL 72
           ++   +   F +   + +     +  +     T++  VIT+ ++ +R   + L +  G++
Sbjct: 23  VSARLLGAAFALTFGLGFAPSLEAQSLFAPAITVDSAVITNYELDQRERFMALLRTPGDI 82

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            + A +ELI + LK   +++ GI  D   +     + A    LS E+F   L + GI   
Sbjct: 83  AEKAREELIDDRLKLAILDEFGIEVDDEEIKQGMTELAGRANLSLEEFLGVLRQNGIAPE 142

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             +    +   W + +   ++ +    E EI     +  +  V+  L   ++     N  
Sbjct: 143 TVRDLTRVGISWRNFLGARYLSQARPTEEEIDRAMGQAGSGGVQVLLSELIVPINEQNAS 202

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLK 251
           Q + F+Q+  K             +   ++++     + G+  ++  + L PQ Q  +L+
Sbjct: 203 QVEQFIQQVGKLK-----SYDAFSSAATQYSAADSRNNGGRLPWMNLTKLPPQLQAVVLE 257

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL 284
                 T P   Q  V    +   R++ G    
Sbjct: 258 LDLGEITEPVPLQGAVALFQMRGLREIVGGTQR 290


>gi|221639318|ref|YP_002525580.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides KD131]
 gi|221160099|gb|ACM01079.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides KD131]
          Length = 405

 Score =  179 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 102/273 (37%), Gaps = 9/273 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKIN 69
           +K   ++ + ++       +    A++  +   R  +N  VIT+ +  +R+  L +    
Sbjct: 1   MKTFVSHCLALVVAAGLTFTSAPGALAQNLFAPRLVVNDRVITNYEFEQRVRFLTILGAT 60

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G++EK A+  LI + ++    E++G+      +     + A    LSAE F++ L K G+
Sbjct: 61  GDVEKQAMDALIEDKIRFYAAEQAGLKATEEQIKEGMEEFAGRANLSAEQFAAELGKAGV 120

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               F+ ++    IW ++++  F       E  I     +  +      L+  ++   P 
Sbjct: 121 AVETFRDFVHAGLIWRELMRAKFGAVARPTETAIDRAITRQTSRASIRLLLSEIIIPAPP 180

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
            +      +   I+      +R      +  +  S        G+  ++   +L P    
Sbjct: 181 GQEAEAQALAAEIRRN----VRGEGAFAEAARTYSASSSAERGGRIDWVPLQNLPPTLGP 236

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
            LL  S    ++P      V    +  + +   
Sbjct: 237 MLLTLSPGQVSDPVKIPNAVALFQLRGRDESSA 269



 Score = 38.9 bits (89), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 34/103 (33%), Gaps = 2/103 (1%)

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNPYVTQKGVEYIA 271
             DC+ L        +  + +   L  + +       L        ++  +       + 
Sbjct: 301 ADDCDDLYTVMKGATEQQLRRT-TLPLAQVPQDVALELAGLDAGEVSSSALPGGTRRVLM 359

Query: 272 ICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
           +C +R +  E   +  L+       I      Y+  LR+NAII
Sbjct: 360 LCARRPVSAEPIDRGRLAQALANQSISASADAYMADLRANAII 402


>gi|99080787|ref|YP_612941.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Ruegeria sp. TM1040]
 gi|99037067|gb|ABF63679.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Ruegeria sp. TM1040]
          Length = 424

 Score =  179 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 98/248 (39%), Gaps = 7/248 (2%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKI-NGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
             T+N +VIT  ++ +R   L +     G+  + A  +LI + LK+Q ++  G+T     
Sbjct: 48  AITVNEDVITTYELEQRALFLSVLGSVQGDPFETARDDLIEDRLKRQVMKDVGLTLSEEE 107

Query: 102 VNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEM 161
           V     + A+   L+ E+F + L++ G+     + +      W + V+  F+ +    E 
Sbjct: 108 VTEGMRELAQRANLTLEEFLASLNQAGVAPETVRDFTTAGLGWREYVRGRFLSQARPSEA 167

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           EI        + +V+  L   +L    +N  Q Q    +  +       R         +
Sbjct: 168 EIDRAMGTAGSGSVQVLLSEIILPLTQENAAQVQDLAIQISEL-----TRAEAFAASAAQ 222

Query: 222 FASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
           F++       G+  ++  S L PQ Q  +L       T P   Q  +    +   R++ G
Sbjct: 223 FSAADSRTDGGRLPWMSLSRLPPQLQEVVLGLEPGEITQPLPMQGAIAIFRMRGLREVDG 282

Query: 281 EIALKAYL 288
             A  A +
Sbjct: 283 RSATYAAI 290


>gi|77463460|ref|YP_352964.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides 2.4.1]
 gi|77387878|gb|ABA79063.1| Probable PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 435

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 102/273 (37%), Gaps = 9/273 (3%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKIN 69
           +K   ++ + ++       +    A++  +   R  +N  VIT+ +  +R+  L +    
Sbjct: 31  MKTFVSHCLALVVAAGLTFTSAPGALAQNLFAPRLVVNDRVITNYEFEQRVRFLTILGAT 90

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G++EK A+  LI + ++    E++G+      +     + A    LSAE F++ L K G+
Sbjct: 91  GDVEKQAMDALIEDKIRFDAAEQAGLKATEEQIKEGMEEFAGRANLSAEQFAAELGKAGV 150

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               F+ ++    IW ++++  F       E  I     +  +      L+  ++   P 
Sbjct: 151 AVETFRDFVHAGLIWRELMRAKFGAVARPTETAIDRAITRQTSRASIRLLLSEIIIPAPP 210

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
            +      +   I+      +R      +  +  S        G+  ++   +L P    
Sbjct: 211 GQEAEAQALAAEIRRN----VRGEGAFAEAARTYSASSSAERGGRIDWVPLQNLPPTLGP 266

Query: 249 -LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
            LL  S    ++P      V    +  + +   
Sbjct: 267 MLLTLSPGQVSDPVKIPNAVALFQLRGRDESSA 299



 Score = 38.9 bits (89), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 37/106 (34%), Gaps = 8/106 (7%)

Query: 213 PKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTN---PYVTQKGVE 268
             DC+ L        +  + +   L  + +       L        ++   P  T++   
Sbjct: 331 ADDCDDLYTVMKGATEQQLRRT-TLPLAQVPQDVALELAGLDAGEVSSSALPGDTRR--- 386

Query: 269 YIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
            + +C +R +  E   +  L+       I      Y+  LR+NAII
Sbjct: 387 VLMLCARRPVSAEPIDRGRLAQALANQSISASADAYMADLRANAII 432


>gi|254453743|ref|ZP_05067180.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Octadecabacter
           antarcticus 238]
 gi|198268149|gb|EDY92419.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Octadecabacter
           antarcticus 238]
          Length = 388

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 45/282 (15%), Positives = 100/282 (35%), Gaps = 6/282 (2%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQE 89
           ++S    A       T+N  V+++ +I +R+ +L   +  G LE  A ++LI + LK   
Sbjct: 1   MLSPVMTAAQLAPAITVNDSVVSEFEIDQRVIMLGTFRTPGNLEDTAREQLIEDRLKLAA 60

Query: 90  IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
           +  +G+      +     + A    +  + F + L + G+ +  F+ ++ +   W D ++
Sbjct: 61  LNSAGLRITDEGLVGAMGEFATRANMDLDQFITMLGQSGVSEETFRDFVRVNVSWRDFIR 120

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
             F  +    E +I     +    +  E L+  ++   P    +       RI     + 
Sbjct: 121 TRFNDRAQVSEADIDLALGQSDASSSIEVLLSEIIIPAPPESAEQANATADRIAQLTSTA 180

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVE 268
                   +  + ++       G+  +L  S+     +  LL  +    T P     GV 
Sbjct: 181 A----FEAEARRVSALPSKTRGGRLDWLPISNYPAGLRGLLLNLAPGEITAPLPITNGVA 236

Query: 269 YIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
              + D R++       A +                + + R 
Sbjct: 237 LFQMRDVREVPRAAPEPAAIEYAAFYIAG-GLSERGLAEARR 277


>gi|260576764|ref|ZP_05844749.1| SurA domain protein [Rhodobacter sp. SW2]
 gi|259021016|gb|EEW24327.1| SurA  domain protein [Rhodobacter sp. SW2]
          Length = 402

 Score =  177 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 48/273 (17%), Positives = 107/273 (39%), Gaps = 8/273 (2%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS--RIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           ++    V+ +F +    +  + A       R  +N  VI+  ++ +RI+ + +  +   +
Sbjct: 1   MMRIKTVIFVFLLGLTGAIPAAAQDGPFAPRVYVNDRVISQYELDQRISFMTVLGLRENV 60

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E++A+  LI E L+    ++  +      V     + A    LS E+F + L   G+   
Sbjct: 61  EEVALNALIDERLQMTVAKQYNVKLTPKQVEAGMAEFAGRAQLSTEEFLTALAPAGVEAQ 120

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            F+ ++    IW ++V+  F  +    E EI     ++   T  + L   ++   P+ +L
Sbjct: 121 GFRDFVTAGLIWREIVRAKFGPRASISEAEIDQAIAQIDKNTSVQILASEIVIPAPEGQL 180

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKF-ASKIHDVSIGKAQYLLESDLHPQFQNL-L 250
                  +R+K    ++ R P+D  K  +  +S       G+  +    +L P    + L
Sbjct: 181 PVALATARRLK----AQSRTPEDFAKAARENSSSSSAGRGGRLNWTPVGNLPPDVVPVLL 236

Query: 251 KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
                  + P   +  V    + + +    +  
Sbjct: 237 ALKPGQVSAPVKLEGSVALFLLHEIKAQEQDGP 269



 Score = 40.4 bits (93), Expect = 0.36,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 59/155 (38%), Gaps = 17/155 (10%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD-CNKLE 220
           EI A +Q        +Y      F +P+              DAE +R+R   D CN L 
Sbjct: 260 EIKAQEQDGPVTMSVDYA----QFLLPNTTA----------ADAEFARIRNEVDVCNDLN 305

Query: 221 KFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
           K A  +    + + +    + +       L K     ++   V      ++ +C++  + 
Sbjct: 306 KVALGLPAEQLLR-ETKPMAQVPSDIGLELAKLDPGESSTALVRGGNRVFLMLCNRIPVL 364

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                +  + AQ    ++  + A Y+  LR+NAII
Sbjct: 365 DVPPSREAVRAQLLNQRLAAYGAGYLADLRANAII 399


>gi|319943017|ref|ZP_08017300.1| peptidyl-prolyl cis-trans isomerase [Lautropia mirabilis ATCC
           51599]
 gi|319743559|gb|EFV95963.1| peptidyl-prolyl cis-trans isomerase [Lautropia mirabilis ATCC
           51599]
          Length = 491

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 106/255 (41%), Gaps = 11/255 (4%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKI---------NGELEKIAVQELIVETLKKQEI 90
            RI   +N  VIT+ ++  +I L++ +             EL K  ++++I++  ++Q  
Sbjct: 85  DRIVAVVNQGVITESELQAQIHLIEGRAAQTPGAGVPPPDELRKQVLEQMILQLAQEQYA 144

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
              G+      V+      A+N GLS +  +  L  +G+  + F++ L  + +   + + 
Sbjct: 145 ADYGLKPSDAEVDRAVADVAQNNGLSTQQLTERLKDEGVSLDTFRRQLVAEIVSARLRER 204

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
           +        E EI A   K   ++  EY IR +L  +P+   Q +   QK   D   ++ 
Sbjct: 205 ETASNVSISEGEIDAELAKSGKVSQPEYDIRQILLKLPEGADQKEVARQKARADELVAKA 264

Query: 211 RLPKDCNKLEKFASKIHD-VSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVE 268
           R   D   L +  S+  D  + G   +    DL   F + ++K      + P  +  G  
Sbjct: 265 RKGADFGALAQENSEAGDAATGGSMGWRKADDLPGLFADTVRKLKPGEISAPVRSPAGFH 324

Query: 269 YIAICDKRDLGGEIA 283
            + + D+RD G    
Sbjct: 325 ILKLQDRRDGGATTV 339



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 56/155 (36%), Gaps = 5/155 (3%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            +++     TV     R +L   P N  +     ++R+            D  KL K  S
Sbjct: 329 QDRRDGGATTVELTHARHILL--PANSPETAAEAERRLSLFRRDIEAGKADFAKLAKEFS 386

Query: 225 KI-HDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR-DLGGE 281
                   G   +L   D  P+F+  +K       + P  TQ GV  + +  +R D    
Sbjct: 387 SDGSAAKGGDLGWLYPGDTVPEFEQAMKSLHDGEISEPVQTQFGVHLVQVLGRRTDTESP 446

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             L+    A+    K  +   +++++LR    + Y
Sbjct: 447 ERLRNAARAKLREAKGGEAYQQWLRELRDRTYVEY 481


>gi|110680309|ref|YP_683316.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           denitrificans OCh 114]
 gi|109456425|gb|ABG32630.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           denitrificans OCh 114]
          Length = 406

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 97/282 (34%), Gaps = 27/282 (9%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           IK   +   L   C +          S  I+  +N  VIT+ +I +R   L L    G  
Sbjct: 4   IKQFCSVLALCAACSLAPPLGAQNLFSPAIQ--VNDAVITEFEIEQRQQFLTLLNAPGSS 61

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  V+ELI E L+ Q +  +G+      +     + A    L  ++F + L++ GI   
Sbjct: 62  RQAVVEELINERLRAQAVANAGLELSDAALQEGMTEFAGRVNLGVDEFKTVLEENGIAAE 121

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
            F+ ++ +   W D +   F  +    E EI          +  + L+  ++   P ++ 
Sbjct: 122 TFEDFVRVGVSWRDFIAARFGPRLQVSEEEIDQALGSTNGASNIQVLVSEIIIPAPPSRA 181

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL--- 249
                V ++I         +     +  ++A +    +       L       +Q L   
Sbjct: 182 VEVQEVAEQIA--------VTTSTEEFSEYARRFSATATRDQGGRL------DWQPLSNL 227

Query: 250 --------LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
                   L  +    T P    + V    + D R+ G    
Sbjct: 228 PPSLRPLLLGLAPGEVTEPLNIPEAVALFQLRDIRETGASTP 269


>gi|322514871|ref|ZP_08067889.1| peptidyl-prolyl cis-trans isomerase [Actinobacillus ureae ATCC
           25976]
 gi|322119175|gb|EFX91320.1| peptidyl-prolyl cis-trans isomerase [Actinobacillus ureae ATCC
           25976]
          Length = 314

 Score =  177 bits (448), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 60/320 (18%), Positives = 118/320 (36%), Gaps = 24/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A   R+  T++G  + + D+ +    L  +      
Sbjct: 1   MKLISAKSLLLTLVAAVGISQSAMAWEERVVATVDGVPVMESDVQR----LLGKNATAAQ 56

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K AV++ I + L ++ ++++G+  +   V+    Q A   G++       LD QGI  N
Sbjct: 57  HKSAVEQAIDDVLIQKAVKEAGVKVNYAHVDQAIEQIAARNGITYGQLLDALDYQGITLN 116

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ----------KMKNITVREYLIRT 182
            ++Q +A Q     V              ++ A  Q          K+K +T  +Y I  
Sbjct: 117 QYRQQIAQQMAMEQVRNISIGKSIQVQPQDVQARAQELLAQDKAIGKLKTVTGNQYRISH 176

Query: 183 VLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           +L       N +Q +  + +   D    +    +           +     G   Y    
Sbjct: 177 ILLKTTPVLNDVQAKAKLTQITADINAGKTTFEQ--AAKLNSVDYVSAADGGDLGYNFLD 234

Query: 241 DLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F        Q+  T P+ +Q G   + +   +   G+    AY      Q    +
Sbjct: 235 IYDPAFAKAASMAKQDQITAPFKSQFGWHILKVTGSQQ--GDRTEDAYHQRAYEQLVDKQ 292

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LR  A + Y
Sbjct: 293 AQEASRDWVKALRKTANVQY 312


>gi|260433485|ref|ZP_05787456.1| ppic-type ppiase domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417313|gb|EEX10572.1| ppic-type ppiase domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 417

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 52/286 (18%), Positives = 105/286 (36%), Gaps = 12/286 (4%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQ 88
           P  +   ++ + R    +N +++T  ++ +R   L+L  I G  E    + LI E L+KQ
Sbjct: 34  PASAQSPFSPAIR----VNQDIVTWYELEQRQRFLELLGIPGSSEAEVRKALIDERLRKQ 89

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
            + ++GI      V     + A    LS E+F + L   G+     + Y+A Q  W D V
Sbjct: 90  AMREAGIQSAPEDVQLAIDEFAARGQLSPEEFLAALSDAGVAPETVRDYVASQLAWRDYV 149

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
              F+ +    + EI     +     ++  L   ++   P    Q +   ++  +     
Sbjct: 150 SARFISQARPTQDEINRALGQAGGGGLQVLLSEIIIPVTPQTLGQAEALAEEIAQVK--- 206

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGV 267
              +        ++++     + G+  +L  ++L P  Q  +L       T+P      V
Sbjct: 207 --SVDAFSAAATQYSAAPTRENGGRLDWLNITNLPPVLQPIILGLKTGEVTDPLTLPNAV 264

Query: 268 EYIAICDKRDLGGEIAL--KAYLSAQNTPTKIEKHEAEYVKKLRSN 311
               +   R++        K   +A   P  +          L+  
Sbjct: 265 ALFQLRGLREVATGTPRYSKIDYAAYYLPGGLSPETQRRAADLKEK 310


>gi|159043736|ref|YP_001532530.1| SurA domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157911496|gb|ABV92929.1| SurA domain protein [Dinoroseobacter shibae DFL 12]
          Length = 398

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 37/265 (13%), Positives = 102/265 (38%), Gaps = 5/265 (1%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQEL 80
            L+   ++      S A +     T+N E I+  ++ +R   +   ++ G+  ++A + L
Sbjct: 7   ALLALAMLIGQPATSQAQTFGPVITVNNEGISGYELEQREKFVTALRLPGDPARLAREGL 66

Query: 81  IVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAI 140
           I + LK Q    +G+    + +     + A    L+ E F + L  +G+    F+ ++  
Sbjct: 67  IEDKLKLQAARAAGLEIGIDELELGLEEFASRANLTTEQFIAALADEGVAPETFRDFVRA 126

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
             +W ++++  F  +    + E+          +     +  ++   P ++      +  
Sbjct: 127 DLVWRELIRQRFGPRARVSDAEVERALALQGAASGARIRVAEIIIPTPPDRRVEAETLAA 186

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTN 259
            I++  ++  +        ++F++     + G   ++  S+L P   Q LL     + ++
Sbjct: 187 NIRERVQTTAQFS---EAAQRFSAASSRANGGLRDWIAVSELPPGLAQRLLTLGPGDVSD 243

Query: 260 PYVT-QKGVEYIAICDKRDLGGEIA 283
           P     + +    +   ++      
Sbjct: 244 PVPLGDQAIALFQVRGFQESAARAP 268



 Score = 37.7 bits (86), Expect = 2.6,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 2/100 (2%)

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDK 275
           C+ L   A  + + S+ + + L  +++       L    N  +       G E+I +C  
Sbjct: 301 CDDLYGLARDLPEGSLRR-EVLAAAEIPSDIATALAGLDNQESTEIARAGGREHIMLC-T 358

Query: 276 RDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           R    E   +  L  Q    ++  + A Y+++L + A I 
Sbjct: 359 RTTALEEDDEGTLRRQLLNQRLGSYAANYLQELLAEATIQ 398


>gi|84516316|ref|ZP_01003676.1| PPIC-type PPIASE domain [Loktanella vestfoldensis SKA53]
 gi|84510012|gb|EAQ06469.1| PPIC-type PPIASE domain [Loktanella vestfoldensis SKA53]
          Length = 415

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 54/275 (19%), Positives = 112/275 (40%), Gaps = 12/275 (4%)

Query: 17  TTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIA 76
           T    L +    P  +   +A +     T+N  VIT  ++++RI LL++    G++ + A
Sbjct: 18  TAVLALALGLGQPATAQNQFAPA----ITVNERVITQYELTQRIRLLEVFGTRGDIAQAA 73

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
              LI + LK+QEI++ G+      +N    + A    +    F++ L + G+     + 
Sbjct: 74  RDALIADRLKQQEIDRVGLQVPPEAINAALDEFAGRADMDLAQFNAMLAQNGVDAVTLRD 133

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
           +++I   W + V+  F  +    + +I  A  Q  +  +  E L+  ++ + P       
Sbjct: 134 FVSIGVTWREYVRARFNREVTVTDADIARAQGQIGRATSEMEVLLNEIIIAAPPEMADRA 193

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQN-LLKKS 253
                     + +++R   D     +  S +      G+  +L  ++  PQ Q+ +L   
Sbjct: 194 AQAA-----DQIAQMRSFADFEAAARQVSALPSRDQGGQLDWLPIANYPPQLQSLILDLD 248

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
               T P +   G+    +  KR+     A  A +
Sbjct: 249 TGEVTEPIMIPNGIALFQMRGKREALRPAAAPASI 283


>gi|163735798|ref|ZP_02143227.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           litoralis Och 149]
 gi|161390884|gb|EDQ15224.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Roseobacter
           litoralis Och 149]
          Length = 415

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 48/280 (17%), Positives = 96/280 (34%), Gaps = 14/280 (5%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSS-RIRTTINGEVITDGDISKRIALLKLQKINGELE 73
            +  +  +++ C     +    A S       +N  VIT+ +I +R   L L    G   
Sbjct: 12  RIKEFCTVLMVCATCSFAVPLGAQSLFSPVIEVNDGVITEFEIEQRQQFLILLNAPGSSR 71

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  ++ELI E L+ Q +  +G+      +    ++ A    L  ++F + L++ GI    
Sbjct: 72  QAVIEELINERLRAQAVANAGLELSDAAMQDGMIEFAGRVNLGVDEFKTVLEENGIAATT 131

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           F+ ++ +   W D +   F  +    E EI          +  + L+  ++   P  +  
Sbjct: 132 FEDFVRVGVSWRDFIAARFGPRLQVSEEEIDQALGSTNGASNIQVLVSEIIIPAPPARAL 191

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD-----LHPQFQN 248
               V ++I               +   +A +    +       LE              
Sbjct: 192 EVQEVAEQIA--------TTTSVEEFSDYARRFSATATRDQGGRLEWQALSNLPPSLRPL 243

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           LL  +    T P    + V    + D R+ G      A +
Sbjct: 244 LLGLAPGEVTEPLNIPEAVALFQLRDIRETGASTPEYAAI 283


>gi|260428595|ref|ZP_05782574.1| ppic-type ppiase domain protein [Citreicella sp. SE45]
 gi|260423087|gb|EEX16338.1| ppic-type ppiase domain protein [Citreicella sp. SE45]
          Length = 410

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 94/238 (39%), Gaps = 5/238 (2%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
              ++  VIT  ++ +R  +L L    G    +A ++L+ + L+ Q  + +GI      +
Sbjct: 36  AIIVDEMVITGYELDQRARMLTLLNAPGNTNDLAREQLVDDRLRLQAAQNAGIEPTEEEI 95

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
                + A    LS E+F + L + G+ +  F+ ++   + W  +V++ F+ +      E
Sbjct: 96  LDGMSEFAGRAQLSREEFVTALGRAGVAEQTFRDFVRAGAAWRSLVQSRFVQQSQVSPAE 155

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +          +    L+  ++  +    ++      +RI           +   +  ++
Sbjct: 156 VDRALAGNGGSSTVRVLLSEIIMPLSPQNVEEVRARAERIAQMTSE----SEFSAQARQY 211

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
           ++     + G+  +   ++L PQ +  +L  S    T P   Q  V    + D  + G
Sbjct: 212 SATATRDAGGRLPWRELNELPPQLRPMILGLSPGQVTQPIPIQGAVALFQLRDIEETG 269



 Score = 36.9 bits (84), Expect = 3.7,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 41/116 (35%), Gaps = 5/116 (4%)

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKKSQNNTTNP 260
           +  A     ++ + C+ L   A    +  + +   L  S L       L K  +   +  
Sbjct: 294 LAKARVLAQKVDR-CDDLYGIAKGQPEQVLERT-TLPPSQLPTDIAYELSKLDEGEVSTA 351

Query: 261 YVTQKG--VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
                G  + ++ +C +     E A +  +       +I      Y+ +LR+NA I
Sbjct: 352 LTRSNGQSLMFLMLCGRTAAVSEDADRQQVEMGLRNQRISAMADGYLAQLRANARI 407


>gi|165975861|ref|YP_001651454.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|165875962|gb|ABY69010.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 316

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 54/320 (16%), Positives = 117/320 (36%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQR---ALGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++GI  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGIKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNL----------EMEIPANKQKMKNITVREYLIRT 182
            ++Q +A Q     V                       +E      K+KN+T  ++ +  
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 183 VLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           +L       N +Q +  + + + D +  +    +           +     G   Y    
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEE--AAKANSVDYLSAADGGDLGYNFLD 235

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F        Q   T P+ +Q G   + +   +   G+    AY      Q    +
Sbjct: 236 IYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQ--GDRTEDAYNQRAYEQLVDKQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LR  A + Y
Sbjct: 294 AQEAAKDWVKALRKTADVQY 313


>gi|32034721|ref|ZP_00134852.1| COG0760: Parvulin-like peptidyl-prolyl isomerase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207884|ref|YP_001053109.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae L20]
 gi|126096676|gb|ABN73504.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 316

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 53/320 (16%), Positives = 118/320 (36%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQR---ALGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  + + V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYSKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNL----------EMEIPANKQKMKNITVREYLIRT 182
            ++Q +A Q     V                       +E      K+KN+T  ++ +  
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 183 VLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           +L       N +Q +  + + + D +  +    +           +     G   Y    
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEE--AAKANSVDYLSAADGGDLGYNFLD 235

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F        Q   T P+ +Q G   + +   +   G+    AY      Q    +
Sbjct: 236 IYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQ--GDRTEDAYNQRAYEQLVDKQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LR  A + Y
Sbjct: 294 AQEAAKDWVKALRKTADVQY 313


>gi|303249762|ref|ZP_07335966.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307245230|ref|ZP_07527321.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307251950|ref|ZP_07533851.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254177|ref|ZP_07536022.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258641|ref|ZP_07540376.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260875|ref|ZP_07542561.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|302651329|gb|EFL81481.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853874|gb|EFM86088.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306860642|gb|EFM92654.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862877|gb|EFM94826.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867298|gb|EFM99151.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869442|gb|EFN01233.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 316

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 53/320 (16%), Positives = 117/320 (36%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQR---ALGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNL----------EMEIPANKQKMKNITVREYLIRT 182
            ++Q +A Q     V                       +E      K+KN+T  ++ +  
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 183 VLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           +L       N +Q +  + + + D +  +    +           +     G   Y    
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEE--AAKANSVDYLSAADGGDLGYNFLD 235

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F        Q   T P+ +Q G   + +   +   G+    AY      Q    +
Sbjct: 236 IYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQ--GDRTEDAYNQRAYEQLVDKQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LR  A + Y
Sbjct: 294 AQEAAKDWVKALRKTANVQY 313


>gi|84500986|ref|ZP_00999221.1| PPIC-type PPIASE domain protein [Oceanicola batsensis HTCC2597]
 gi|84391053|gb|EAQ03471.1| PPIC-type PPIASE domain protein [Oceanicola batsensis HTCC2597]
          Length = 402

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 44/287 (15%), Positives = 106/287 (36%), Gaps = 7/287 (2%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEI 90
            +  + A S      +N +V+T+ ++ +R  +L+L +  G+++ +A  +LI + L+ Q  
Sbjct: 16  TAQFAAAQSFSPAIKVNDKVVTEFELDQRTRMLRLFRTPGDIDALAADQLIDDRLRMQAA 75

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
           E+ GI+   + +     + A    LSAE F + L + G+    F+ ++     W + ++ 
Sbjct: 76  EEIGISPSEDQIMAGMEEFAGRANLSAEQFVAALQQAGVAPESFRDFVRAGVAWRETIRA 135

Query: 151 DFMLKYGNLEMEIPANKQ-KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
            F  +    E +I         +    + L+  +   +          + +RI+      
Sbjct: 136 RFGPRIQISEQQIDRALASGGASGASVQVLMSEIFLPLTPGAEDETRALAQRIRG----- 190

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVE 268
           +          + +S     + G+  ++  S+L PQ ++ +L       + P      + 
Sbjct: 191 MSAEAFARAAREHSSAPSAGAGGRVNWVPVSNLSPQLRSVILGLRPGQISEPVELDGQLA 250

Query: 269 YIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +        A +          +      +  R  A + 
Sbjct: 251 LFLLRAVEETENRAPSYAAVEYAAYYIAGGRSAQALERAARVRAQVD 297


>gi|307249622|ref|ZP_07531608.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858320|gb|EFM90390.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 316

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 53/320 (16%), Positives = 117/320 (36%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTATAIEERVVALVDGVPVMESQVQR---ALGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNL----------EMEIPANKQKMKNITVREYLIRT 182
            ++Q +A Q     V                       +E      K+KN+T  ++ +  
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 183 VLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           +L       N +Q +  + + + D +  +    +           +     G   Y    
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEE--AAKANSVDYLSAADGGDLGYNFLD 235

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F        Q   T P+ +Q G   + +   +   G+    AY      Q    +
Sbjct: 236 IYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQ--GDRTEDAYNQRAYEQLVDKQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LR  A + Y
Sbjct: 294 AQEAAKDWVKALRKTADVQY 313


>gi|190149693|ref|YP_001968218.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303252643|ref|ZP_07338806.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307247402|ref|ZP_07529449.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307256445|ref|ZP_07538227.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307263001|ref|ZP_07544623.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914824|gb|ACE61076.1| peptidyl-prolyl cis-trans isomerase SurA [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302648611|gb|EFL78804.1| survival SurA-like protein [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|306856099|gb|EFM88255.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306865075|gb|EFM96976.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306871627|gb|EFN03349.1| Survival protein SurA-like protein [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 316

 Score =  172 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 53/320 (16%), Positives = 117/320 (36%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL++   +L+       +S  + A+  R+   ++G  + +  + +    L  +  +   
Sbjct: 1   MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQR---ALGKKANSEAN 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K A++++I + L ++ ++++G+  +   V+      A   G++       LD QGI   
Sbjct: 58  HKAALEQIIDDLLVQKAVKEAGVKVNYAKVDQVIEDIAARNGITYGQLLDALDYQGITLE 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNL----------EMEIPANKQKMKNITVREYLIRT 182
            ++Q +A Q     V                       +E      K+KN+T  ++ +  
Sbjct: 118 QYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANGKLKNVTGVQHRVSH 177

Query: 183 VLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
           +L       N +Q +  + + + D +  +    +           +     G   Y    
Sbjct: 178 ILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEE--AAKANSVDYLSAADGGDLGYNFLD 235

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F        Q   T P+ +Q G   + +   +   G+    AY      Q    +
Sbjct: 236 IYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQ--GDRTEDAYNQRAYEQLVDKQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LR  A + Y
Sbjct: 294 AQEAAKDWVKALRKTADVQY 313


>gi|94499974|ref|ZP_01306509.1| Parvulin-like peptidyl-prolyl isomerase [Oceanobacter sp. RED65]
 gi|94427832|gb|EAT12807.1| Parvulin-like peptidyl-prolyl isomerase [Oceanobacter sp. RED65]
          Length = 436

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/317 (18%), Positives = 128/317 (40%), Gaps = 18/317 (5%)

Query: 10  SDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN 69
           +  I+ +T   +L IF +   +  +   + S I   ++  +I + ++ +RI  +K Q   
Sbjct: 11  TSIIQQITKTALLGIFAVSLPLQAQIQTIDS-IAAVVDDGIIMESELEQRIDTIKRQSQG 69

Query: 70  GEL------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
             L      +   ++ LI+E L+ Q  E+SG+      +N   +  A+  GL+  +F   
Sbjct: 70  MRLPPDDILQDQVLERLIIENLQLQMAERSGMRISDEQLNQTIINIAKQNGLTLREFKKA 129

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIR 181
           L+K G+     ++ +  + I  +V +     K    E ++    N  + K+ T  EY + 
Sbjct: 130 LEKDGVSYAQAREQIRRERIISEVQRYRVGSKINISEQDVDNFLNSVRGKSATAEEYRLG 189

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLES 240
            +L  +P    + Q    +   +    +LR   D  ++    +   + +  G   +  E+
Sbjct: 190 HILIQVPSQASRAQLKRAQNKAEDIVKKLRNGADFQQMAISQSEGRNALKGGDLGWRKEA 249

Query: 241 DLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEI-----ALKAYLSAQNTP 294
           +L   F +++    +   +NP  +  G   I I DKR  GG+          ++  Q   
Sbjct: 250 ELPTLFADIVPDLKKGQVSNPIRSASGYHIIKISDKR--GGDTQMVRQTKARHILIQENE 307

Query: 295 TKIEKHEAEYVKKLRSN 311
            +  +   + +  L   
Sbjct: 308 IRNSQQAKKLINDLYKK 324



 Score = 60.4 bits (145), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 101/316 (31%), Gaps = 69/316 (21%)

Query: 62  LLKLQKINGELEKIAVQELIVETLKKQEIEKS----GITFDSNTVNYFFVQH-------- 109
             K  + +G     A +++  E +   E+++      I      V+ F            
Sbjct: 126 FKKALEKDGVSYAQAREQIRRERI-ISEVQRYRVGSKINISEQDVDNFLNSVRGKSATAE 184

Query: 110 --------------ARNTGLSAED---------------FSSFLDKQGIGDNHFKQYLAI 140
                         A    L                   F      Q  G N  K     
Sbjct: 185 EYRLGHILIQVPSQASRAQLKRAQNKAEDIVKKLRNGADFQQMAISQSEGRNALKG---G 241

Query: 141 QSIWPDVVK-----------------NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTV 183
              W    +                 ++ +       +   ++K+      VR+   R +
Sbjct: 242 DLGWRKEAELPTLFADIVPDLKKGQVSNPIRSASGYHIIKISDKRGGDTQMVRQTKARHI 301

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV--SIGKAQYLLESD 241
           L  I +N+++N    +K I D  + +L+   D ++L K  S       S G   ++ + D
Sbjct: 302 L--IQENEIRNSQQAKKLINDLYK-KLKNGADFDELAKEYSDDPGSKLSGGDLGWVNQGD 358

Query: 242 LHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEK 299
           + P F+  +  ++    + P+ ++ G   + + D R    GE   +          + E+
Sbjct: 359 MVPAFEQTMNATKKGQISEPFKSRFGWHVLQVTDYRQKDVGEEIQRNQARQLLYSRRFEE 418

Query: 300 HEAEYVKKLRSNAIIH 315
               +++++R++A + 
Sbjct: 419 ELPIWLRQIRADAYVE 434


>gi|254438097|ref|ZP_05051591.1| SurA N-terminal domain family [Octadecabacter antarcticus 307]
 gi|198253543|gb|EDY77857.1| SurA N-terminal domain family [Octadecabacter antarcticus 307]
          Length = 383

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 44/244 (18%), Positives = 90/244 (36%), Gaps = 5/244 (2%)

Query: 36  WAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGI 95
            A        +N  V+++ +I +R+ALL   +  G LE  A ++LI E LK + ++ + +
Sbjct: 2   TAAQFAPAIIVNDSVVSEFEIDQRVALLLAFRTPGNLEDTAHEQLIQERLKLEALDSARL 61

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
                 +     + A    L  + F + L + G+ +  F+ ++ +   W D ++  F   
Sbjct: 62  RITDEGLVLAMTEFATRANLELDQFITMLGQSGVAEETFRDFVRVNVSWRDFIRTRFNDS 121

Query: 156 YGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
               E +I     +    +  E L+  ++   P    Q      +RI             
Sbjct: 122 AQVSEADIDLALGQSGASSSIEVLLNEIIIPAPAESAQQAMATAERIAQL----TTTSAF 177

Query: 216 CNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICD 274
             +    ++       G+  +L  S+     +  LL  +    T P     GV    +  
Sbjct: 178 EAEARSVSALPSRTRGGRLDWLPISNYPAGLRGLLLNLAPGEVTAPIPITDGVALFQMRG 237

Query: 275 KRDL 278
            R++
Sbjct: 238 LREV 241


>gi|84684877|ref|ZP_01012777.1| Probable PpiC-type peptidyl-prolyl cis-trans isomerase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667212|gb|EAQ13682.1| Probable PpiC-type peptidyl-prolyl cis-trans isomerase
           [Rhodobacterales bacterium HTCC2654]
          Length = 414

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 49/298 (16%), Positives = 118/298 (39%), Gaps = 8/298 (2%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELE 73
           ++LT      +  ++      +      +   +N   +T  + ++R+A L++    G++ 
Sbjct: 16  RILTLCASAALGMMMAGSPATAQGQFVPV-AKVNDSAVTVYERNQRMAFLRILNAPGDIT 74

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           ++A+ +LI E ++  E E+ GIT D   V     + A    L  E F +FL + GI    
Sbjct: 75  QLALDQLINERIQLAEAERMGITADPEAVQNGMAEFAARGNLDVEQFGAFLAQAGIAFET 134

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
           F+ ++    +W +V +  F+ +    E EI     + +     ++L+  ++         
Sbjct: 135 FRDFVTAGIVWREVARAKFLPQVSITESEIDRAYAEAEPQPGEKFLLTEIVLP----ASS 190

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD-VSIGKAQYLLESDLHPQFQNLLKK 252
           +      R +    S++   ++     K  S +   ++ G+  ++    L PQ Q+ ++ 
Sbjct: 191 DLSLKASRARADRLSKITTAEEFADAAKRFSVVPSRLNAGERDWVDVQALPPQAQSAVRA 250

Query: 253 S-QNNTTNPYVTQK-GVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           + +   + P +    GV    + D+  +      +    A       ++       ++
Sbjct: 251 TREGRASRPVIIPDVGVAVYFVRDRETIRSTKVGELLEYAAFFVPGGQEEANRIRAEV 308



 Score = 44.3 bits (103), Expect = 0.027,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 45/122 (36%), Gaps = 14/122 (11%)

Query: 202 IKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQF------QNLLKKSQN 255
            ++A   R  + + C+ L   A  +       A  L+  +L            L      
Sbjct: 298 QEEANRIRAEV-QICDDLYPIARGL------PADQLVREELPTGAVPARYRAELANLDPG 350

Query: 256 NTTNPYVTQKG-VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             +       G + ++ +C++R+   +   +A ++      +I  +  + +  LR+NA I
Sbjct: 351 EVSTRLTAGNGTLVFLMLCNRRNDVPDSVSRAQIADALRNQRIGAYANDLLADLRANAHI 410

Query: 315 HY 316
            Y
Sbjct: 411 EY 412


>gi|300023220|ref|YP_003755831.1| SurA domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525041|gb|ADJ23510.1| SurA domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 442

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 54/261 (20%), Positives = 97/261 (37%), Gaps = 6/261 (2%)

Query: 58  KRIALLKLQKIN-GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
           +R A    +K +   ++K A++ELI E LK QE +K  +T + + V+      A    ++
Sbjct: 185 QREAFESARKASLPAVKKQAIEELIDERLKLQEAKKQSVTIEDSEVDRVITGIAERNKMT 244

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR 176
            + F+    + G   +  K  +     W +VV+  F         ++             
Sbjct: 245 LDQFTK---QVGGSIDPMKSRIRAALSWNEVVRRRFGPLINVNTKDVDKMVATAAGSAQE 301

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
           +  ++     I   K   +  + +RI++AE+ R R   DC      A+ I          
Sbjct: 302 DVELQIQRVQIMLPKKMEEHGIAQRIEEAEKVRSRF-TDCKSTAAAATGIPGAKFENIGK 360

Query: 237 LLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT 295
              S L    +  LL  S      P V    VE   +C +  +  +   +     +    
Sbjct: 361 RKSSTLPEPTRTLLLNASDGEMLPPSVGDGAVELYVVCGRDSVKSDADKRTQAEGELKQK 420

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           + E     Y+K LR +A I Y
Sbjct: 421 EFEVMARRYLKDLREDAHIEY 441


>gi|255264369|ref|ZP_05343711.1| ppic-type ppiase domain protein [Thalassiobium sp. R2A62]
 gi|255106704|gb|EET49378.1| ppic-type ppiase domain protein [Thalassiobium sp. R2A62]
          Length = 404

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 45/268 (16%), Positives = 94/268 (35%), Gaps = 7/268 (2%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           ++ +     LI+  +    +      S  I   +N EVIT  ++ +R  LL + +  G L
Sbjct: 1   MRRILLGLALILTSLTTAPAMAQGLFSPAI--IVNDEVITRYELDQRAKLLGVLRTPGNL 58

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            ++A ++LI + LK + I  +G+    + +       A    L    F+  L++ G+   
Sbjct: 59  SELAQEQLIEDRLKARLIRNAGLQLTGDGLQQALSDFAGRANLDLATFTQVLNQNGVEQE 118

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
             +  +A    W + ++  +  +    + EI               LI  ++        
Sbjct: 119 TLRDLVATGVSWREYIRTRYGNRAQITDNEIDRALSSTGGRAGIRVLISEIIMDARPQVA 178

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLK 251
            +     +RI     +         +  + +      + G+  +L  SDL P  Q  +L 
Sbjct: 179 TSAQARAERISKLTSTAA----FSAEARRVSLLPSRENGGRLDWLPLSDLPPTVQPIILN 234

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLG 279
            S    T P      +    +    +  
Sbjct: 235 LSPGEITPPLPIPNALALFQLRAIEETS 262


>gi|119383650|ref|YP_914706.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paracoccus
           denitrificans PD1222]
 gi|119373417|gb|ABL69010.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Paracoccus
           denitrificans PD1222]
          Length = 423

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 90/236 (38%), Gaps = 7/236 (2%)

Query: 44  TTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVN 103
             +N  V+T  ++ +R+  L++ +        A Q LI + L+     + GI      ++
Sbjct: 33  VYVNDSVVTRYELDQRMRFLQILRAPDGDRASAEQALIDDRLRLFAARQMGIAASDAQID 92

Query: 104 YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
               + A    +  E+F+  L + G+    F+ ++A   +W ++V+   + +    + E+
Sbjct: 93  AGLAEFAGRANMDVEEFTRALAQAGVEQQTFRDFIAAGVVWRELVRQRLVPQVQVSDAEL 152

Query: 164 PANKQK-MKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
               Q+ ++   +    +  ++   P      Q     R+ ++    +R   D     + 
Sbjct: 153 DQEMQRVIETPRITHVALSELIIPAPPG----QEAQAMRLAESLVQSVRSEADFAAAARQ 208

Query: 223 ASKIHDV-SIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
            S      + G+  +    +L P  + ++   Q    + P   +  V    + D R
Sbjct: 209 HSATPSAENGGRLPWAPLENLPPSLRPIILSMQNGQISQPLTVEGAVVLFYLRDSR 264


>gi|126725343|ref|ZP_01741185.1| PPIC-type PPIASE domain [Rhodobacterales bacterium HTCC2150]
 gi|126704547|gb|EBA03638.1| PPIC-type PPIASE domain [Rhodobacterales bacterium HTCC2150]
          Length = 407

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 40/272 (14%), Positives = 95/272 (34%), Gaps = 9/272 (3%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
              K+L    +LI    + +     +A +     T++   +T  +I +R A L + +  G
Sbjct: 4   SIKKILVIGALLIAPAQISLAQSNPFAAA----VTVDNRAVTYFEIEQRAAFLDVLRAPG 59

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            + K A + L+ E L+    +  GI  +   +     + A+   L   +F   + + GI 
Sbjct: 60  NVLKTARETLVNERLQLNAAQSLGIQINQEELAVGMAEFAKRANLKTAEFIKAIGQDGIE 119

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F+ ++     W  +V+N F+ +    E EI               L+  ++      
Sbjct: 120 PETFQDFVRAGLTWRKLVQNRFVGRAQVSEDEIDRALALSSRKGGARVLLSEIVLPA--- 176

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS-KIHDVSIGKAQYLLESDLHPQFQNL 249
           +   +    K +    +  ++         +  S      + G+  +L  ++L P    +
Sbjct: 177 RNPEEAEASKNLAAELKDTIKTQSAFESAARTYSVSGSAANGGRITWLPLANLPPSIVPV 236

Query: 250 -LKKSQNNTTNPYVTQKGVEYIAICDKRDLGG 280
            L       ++    +  +    +   ++   
Sbjct: 237 LLTLKPGEVSDTVPVENAISMFQVRGLQEFDA 268


>gi|33152289|ref|NP_873642.1| peptidyl-prolyl cis-trans isomerase [Haemophilus ducreyi 35000HP]
 gi|33148512|gb|AAP96031.1| survival protein SurA-like protein [Haemophilus ducreyi 35000HP]
          Length = 317

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/320 (18%), Positives = 113/320 (35%), Gaps = 23/320 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL 72
           +KL +   +L+       +S  + A    +  T+N   + +  +    +LL  QK +   
Sbjct: 1   MKLNSAKSLLVALVTAVSLSQSAMAWEEHVVATVNNIPVMESQVQ---SLLGQQKNSKTD 57

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            K+A++ +I + L ++ I  +GI  D   V+      A + G++       +D QGI  +
Sbjct: 58  RKMAIEHIIDDILVQKTIADAGIQVDYKLVDKAIEDIAASNGITYGQLLDAIDNQGISLD 117

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGN----------LEMEIPANKQKMKNITVREYLIRT 182
            ++  +A Q     V                       +E    K K+K     +Y I  
Sbjct: 118 QYRGQIAQQMAMEQVRHMSISQSIQLDPNEVQTLAKKMLEEDKAKGKLKKSMGTQYRISH 177

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLES 240
           +L       + N    + ++               +  K  S   I     G   Y    
Sbjct: 178 ILIKT--TPVLNDAKAKAKLMRIAADIKAGKTTFEQAAKANSIDYISAADGGDLGYNFLD 235

Query: 241 DLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQNTPTK 296
              P F  +  K  QN  + P+ +Q G   + +   +    +    +Y           +
Sbjct: 236 IYDPTFAKIANKAKQNQISAPFKSQFGWHILKVTATQ--KADRTEDSYNQFAYELLANQQ 293

Query: 297 IEKHEAEYVKKLRSNAIIHY 316
            ++   ++VK LRS+A I Y
Sbjct: 294 GQEIAKDWVKILRSSADIQY 313


>gi|219870954|ref|YP_002475329.1| peptidyl-prolyl cis-trans isomerase SurA [Haemophilus parasuis
           SH0165]
 gi|219691158|gb|ACL32381.1| peptidyl-prolyl cis-trans isomerase SurA [Haemophilus parasuis
           SH0165]
          Length = 312

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/325 (18%), Positives = 116/325 (35%), Gaps = 31/325 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
            +    L    F L         ++ S     R+  T++G  I    + +    L  +  
Sbjct: 3   FTQVKSLFIAGFAL--------FAFSSANAEERVVATVDGYPIMQSQVKQ---ALGKKAN 51

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
                K A++ +I + + ++ I++SGI  D   V+      A   G++       LD QG
Sbjct: 52  TEANRKAALETIIDDFVVQRAIKESGIKVDYAYVDQMMEDVAAQNGITYGQLLDALDYQG 111

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGN----------LEMEIPANKQKMKNITVREY 178
           I  + ++Q LA Q +   V +                     ++       ++ ++  EY
Sbjct: 112 ISLSQYRQQLAHQLLMEQVRQQSIGNSIQVDPKDVQSLAKDMLDKAKTNGTLETVSATEY 171

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQY 236
            I  +L       + N    + ++               +  K  S   I  +  G   +
Sbjct: 172 RISHILIKT--TPILNDMQAKAKLLSITADIKSGKITFEEAAKINSVDYISGIDGGDLGF 229

Query: 237 LLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQN 292
                    F N+  KS+ +  ++P+ +Q G   + + D R   G+    AYL     Q 
Sbjct: 230 NFLDAYDSTFANIASKSKIDVISSPFKSQFGWHILKVTDTRR--GDRTEDAYLQKAYEQL 287

Query: 293 TPTKIEKHEAEYVKKLRSNAIIHYY 317
              +++    +++K LRS   I Y+
Sbjct: 288 IDKQVQVASKDWIKVLRSKLDIKYF 312


>gi|163746451|ref|ZP_02153809.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380336|gb|EDQ04747.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 412

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 95/266 (35%), Gaps = 9/266 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKI 75
           +     L +  ++   +      +      +N E IT  ++ +R   ++L    G     
Sbjct: 13  MRGTAALALALVIGQSAAAQNLFAP--VARVNDEAITGYEVQQRQRFMQLIGAPGTDSNS 70

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            +  LI + L+ Q +E++G+    + +     + A    LS E+F   L +  I +  F+
Sbjct: 71  VIDSLIEDRLRGQILEQAGLEVTPDGIRAGMTEFAGRADLSTEEFLKVLGQAQISEETFR 130

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI-PDNKLQN 194
            ++ I + W D+++  +  +    + E+       +       L+  ++    P N  Q 
Sbjct: 131 DFIVISAAWRDLIRARYNGRVNITDEEVERALGSSRGNNGLRVLLSEIIIPAPPQNADQV 190

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL-LKKS 253
               ++  + + E+            ++++       GK  +    +L    + + L  +
Sbjct: 191 NALAERIAQSSSEAEFSSY-----ASQYSATASRERGGKMPWTPLENLPVSLRPILLALA 245

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLG 279
               T P      V    +    + G
Sbjct: 246 PGEVTAPLPIPNAVALFQLRGIEETG 271


>gi|254463317|ref|ZP_05076733.1| peptidyl-prolyl cis-trans isomerase SurA, putative [Rhodobacterales
           bacterium HTCC2083]
 gi|206679906|gb|EDZ44393.1| peptidyl-prolyl cis-trans isomerase SurA, putative
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 416

 Score =  165 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 40/271 (14%), Positives = 96/271 (35%), Gaps = 8/271 (2%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTT---INGEVITDGDISKRIALLKLQK 67
            F     T    +    +       ++ +  +  T   +N   IT+ +I +R+  L L +
Sbjct: 7   SFKSFTRTCAHALACGALLTFGSVQYSNAQGLFATAIKVNDRSITNFEIDERVKFLGLLR 66

Query: 68  INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
             G+  K+A ++LI + LK    +  GI+     V+    + A    L   +F   ++  
Sbjct: 67  TPGDHRKLAREQLIEDRLKLGAAQSVGISPTQEEVDAGMGEFAGRVNLETAEFIKAINAG 126

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSI 187
           G+ ++ F+ ++     W  +V+  F  +    E ++        +      L+  ++   
Sbjct: 127 GVSEDAFRAFVLSGLAWRQLVQAKFGSRITVSEEDVDRLIAASGSGGGIRVLLSEIIMPA 186

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESD-LHPQF 246
           P +    Q    +   +            ++  ++++       G+  +L  +    P  
Sbjct: 187 PPS----QAAAVQERAERISQITSTAAFASEARRYSASPSKARSGRLDWLPITQLPAPLR 242

Query: 247 QNLLKKSQNNTTNPYVTQKGVEYIAICDKRD 277
             LL  +    T+P   Q  +    +    +
Sbjct: 243 PLLLGLAPGEITDPIPLQNAIALFQLRGIEE 273



 Score = 42.7 bits (99), Expect = 0.075,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 46/124 (37%), Gaps = 5/124 (4%)

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ-NLLKK 252
           + G     +  A + + R+ + C+ L   A    D S+        S++       L K 
Sbjct: 292 SGGRTDATLAAARKVQSRVDR-CDDLYGVAKG-QDPSVLDRDSKKPSEIPTDIALELAKM 349

Query: 253 SQNNTTNPYVTQKG--VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
               T+       G  +  + +C +     +   +A LS      ++      Y+++LR+
Sbjct: 350 DPGETSTALTRADGQTLVVLMLCGRTPELEQEVDRAELSLGLQNQRLASFSKGYLEELRA 409

Query: 311 NAII 314
           +A I
Sbjct: 410 DARI 413


>gi|167854677|ref|ZP_02477457.1| bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
           adenyltransferase [Haemophilus parasuis 29755]
 gi|167854214|gb|EDS25448.1| bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
           adenyltransferase [Haemophilus parasuis 29755]
          Length = 312

 Score =  165 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 59/325 (18%), Positives = 116/325 (35%), Gaps = 31/325 (9%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
            +    L    F L         ++ S     R+  T++G  I    + +    L  +  
Sbjct: 3   FTQVKSLFIAGFAL--------FAFSSANAEERVVATVDGYPIMQSQVKQ---ALGKKAN 51

Query: 69  NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQG 128
                K A++ +I + + ++ I++SGI  D   V+      A   G++       LD QG
Sbjct: 52  TEANRKAALETIIDDFVVQRAIKESGIKVDYAYVDQMMEDVAAQNGITYGQLLDALDYQG 111

Query: 129 IGDNHFKQYLAIQSIWPDVVKNDFMLKYGN----------LEMEIPANKQKMKNITVREY 178
           I  + ++Q LA Q +   V +                     ++       ++ ++  EY
Sbjct: 112 ISLSQYRQQLAHQLLMEQVRQQSIGNSIQVDPKDVQSLAKDMLDKAKINGTLETVSATEY 171

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQY 236
            I  +L       + N    + ++               +  K  S   I  +  G   +
Sbjct: 172 RISHILIKT--TPILNDMQAKAKLLSITADIKSGKITFEEAAKINSVDYISGIDGGDLGF 229

Query: 237 LLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS---AQN 292
                    F N+  KS+ +  ++P+ +Q G   + + D R   G+    AYL     Q 
Sbjct: 230 NFLDAYDSTFANIASKSKIDVISSPFKSQFGWHILKVTDTRR--GDRTEDAYLQRAYEQL 287

Query: 293 TPTKIEKHEAEYVKKLRSNAIIHYY 317
              +++    +++K LRS   I Y+
Sbjct: 288 IDKQVQVASKDWIKVLRSKLDIKYF 312


>gi|315500015|ref|YP_004088818.1| ppic-type peptidyl-prolyl cis-trans isomerase [Asticcacaulis
           excentricus CB 48]
 gi|315418027|gb|ADU14667.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Asticcacaulis
           excentricus CB 48]
          Length = 423

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 45/277 (16%), Positives = 113/277 (40%), Gaps = 10/277 (3%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL-------QKINGELEKI 75
            +       + ++  +   +   +N ++I+  D+ +R+ LL +       Q+     ++ 
Sbjct: 24  AVAQTTAQPAAQARPLGEGVVALVNDKLISSYDLKQRMLLLIITSGVQVTQQNYAAFQQQ 83

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
           A++ LI E L+  E +   +      ++      A+ +GLS +   + L + GI     +
Sbjct: 84  ALRALIDEHLQLAEADHFKLNVSDEEIDEEIANMAQQSGLSKDQLLAELKRAGIEAQTLR 143

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQN 194
             +  +  W  +V   F  K    + ++ A   K+   +   +YL+  +L        Q 
Sbjct: 144 DQIKAEIAWGQLVNGRFRPKARVGKDQVDAFMTKLTEDSQKPQYLVAEILIDPEVAGGQK 203

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KS 253
           +     + +  ++    +    +   +F++     + G A +L+   + P+ + +LK  +
Sbjct: 204 EAEAGAQ-QLFDQIAQGVAPFQSVARQFSNAPSAANGGDAGWLVSGTIDPKIETVLKGMN 262

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               T P VT +GV    + +K++   +  ++   +A
Sbjct: 263 PGQMTRPIVTDEGVYIYYLREKKEGKADAKVRLKQAA 299



 Score = 55.4 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 44/110 (40%), Gaps = 3/110 (2%)

Query: 207 ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQK 265
             R + P  C+ L         VS+    +   SDL P++ + L+      +T P     
Sbjct: 314 SFRAKYPT-CDALNNE-KGNGQVSVADLGFTALSDLKPEYASALQPLKVGQSTEPMKNTM 371

Query: 266 GVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +  + +CDK   G ++  +  +  + T  K+      Y++ +R  A I 
Sbjct: 372 NINVVYVCDKTAAGDDVPSREQVEQRLTQQKVAMLGRRYLRDIRDGATIE 421


>gi|254511943|ref|ZP_05124010.1| ppic-type ppiase domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221535654|gb|EEE38642.1| ppic-type ppiase domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 417

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 47/289 (16%), Positives = 100/289 (34%), Gaps = 9/289 (3%)

Query: 4   KVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRI 60
           ++ +  + F++      +L +  +         A    +      +N +++T  ++ +R 
Sbjct: 2   QLISGFTKFLRSGCRASILPVMALALTAMATPQAQGQSLFSPAIRVNQDIVTWYELEQRQ 61

Query: 61  ALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
             L+L       E    + LI + L+KQ + ++GI      V       A    LS+E+F
Sbjct: 62  QFLELLGAPNSSEIEVREALIDDRLRKQVMREAGIEAAPEAVETGIDDIAARGNLSSEEF 121

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLI 180
              L+  G+     + ++A Q  W D +   F+ +    E EI     +     ++  L 
Sbjct: 122 LQLLNDAGVSRETVRDFVADQLTWRDYISARFLSQARPSEDEINRALGQGGGGGLQVLLS 181

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
             ++   P    Q +    +  +  +E                      + G+  +L  S
Sbjct: 182 EIIIPVTPQTLSQAEALADEISQLPDEQSFASAAAQYSAADTR-----TNGGRLDWLSLS 236

Query: 241 DLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +L P  Q  +L       T P      V    +   R++       + +
Sbjct: 237 NLPPALQPVILGLKNGEITEPLSLSNAVALFQMRGIREVATAAPRYSEI 285


>gi|146277165|ref|YP_001167324.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555406|gb|ABP70019.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 405

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 101/276 (36%), Gaps = 7/276 (2%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRI---RTTINGEVITDGDISKRIALLKLQKIN 69
           +K   ++ +  +       +    A +  +   R  +N  VIT+ +  +R+  L +    
Sbjct: 1   MKTFVSHCLAFVMASGLTFASAVDAPAQNLFAPRLVVNDRVITNYEFEQRVRFLTILGAT 60

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
           G+LEK A+  LI + ++    E++G+    + V     + A    LSAE F + L K G+
Sbjct: 61  GDLEKQAMDALIDDKIRLDAAERAGLKATESQVTEGMEEFAGRANLSAEAFVAELGKAGV 120

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPD 189
               F+ ++    +W ++++  F  +    E  I     +    T    L+  ++   P 
Sbjct: 121 APETFRDFVHAGLVWRELMRARFGAEARPSETAIDRAITRQTRRTTIRLLLSEIIIPTPP 180

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYL-LESDLHPQFQN 248
            +  +   + + I+   +      +        +S       G+  ++ L++        
Sbjct: 181 GQEADALALAEEIRRTAQGETAFAQAARSYSASSSAERG---GRIDWVPLQNLPPSLGPL 237

Query: 249 LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL 284
           LL  S    ++P      V    +    +       
Sbjct: 238 LLTLSPGQVSDPLKIPNAVALFQVRAIDETSEPAPA 273


>gi|329850880|ref|ZP_08265725.1| PPIC-type PPIASE domain protein [Asticcacaulis biprosthecum C19]
 gi|328841195|gb|EGF90766.1| PPIC-type PPIASE domain protein [Asticcacaulis biprosthecum C19]
          Length = 445

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 46/268 (17%), Positives = 103/268 (38%), Gaps = 10/268 (3%)

Query: 32  SYKSWAMSSRIRTTINGEVITDGDISKRIALLKL-------QKINGELEKIAVQELIVET 84
           +     +S  +  ++N ++IT  D+ +R+ LL +       Q+     ++ A+  L+ E 
Sbjct: 49  APNLPQLSEGMLISVNDDMITSYDLKQRMLLLIVTSGVQVTQENYAAFQQQAINGLVDER 108

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           L+ QE++   +  D   +N    + A  +GL+ E   + L K GI     K  +  ++ W
Sbjct: 109 LQMQELDHWKVKVDDADINEELERMASQSGLTGEQLLTELKKVGIEPATLKSQIRAETGW 168

Query: 145 PDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK 203
             +V   +         ++     + + +   ++YL+  +                 + +
Sbjct: 169 SRLVGGRYQSNAKVGSAQVDGTMDRIVADGQKQQYLVAEIFLDPAQAGGIENAQKGAQ-Q 227

Query: 204 DAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYV 262
              + + R         +F++       G A +L+  +L P  +  L  +     T P  
Sbjct: 228 LYNQLQARAAPFQAVARQFSNAPSAAQGGDAGWLVADNLDPAIEVALAAAQPGEMTPPIT 287

Query: 263 TQKGVEYIAICDKRDLGGEIALKAYLSA 290
           T+ GV    +  K    G++ +    +A
Sbjct: 288 TEDGVYIYLLRQKTTGDGDMVMHLKQAA 315



 Score = 57.7 bits (138), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 53/133 (39%), Gaps = 3/133 (2%)

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           +IP     ++  V          R ++   C+ L++ A    ++ +        S L P 
Sbjct: 315 AIPLAPNASESEVANAQSALLSFRSKVS-SCDALDE-AKVPGNIQVVDLGEAQLSTLLPD 372

Query: 246 FQNLLKKSQN-NTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           +   LK  +    + P    + +  + +CD+R  G     +  + +Q   T++      Y
Sbjct: 373 YVATLKPLKGKQVSQPVRNSQFMNVVYVCDRRLAGENALTREQVESQLVNTRLAMLGKRY 432

Query: 305 VKKLRSNAIIHYY 317
           +++LR +A I  +
Sbjct: 433 LRELRGSATIENH 445


>gi|89070359|ref|ZP_01157666.1| PPIC-type PPIASE domain protein [Oceanicola granulosus HTCC2516]
 gi|89044006|gb|EAR50181.1| PPIC-type PPIASE domain protein [Oceanicola granulosus HTCC2516]
          Length = 405

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 40/243 (16%), Positives = 91/243 (37%), Gaps = 4/243 (1%)

Query: 43  RTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTV 102
             T+N   I+  +I +R  LL++    G+LE +A ++L+ + LK  E++++G+     ++
Sbjct: 31  AITVNDSAISFYEIDQRAKLLRVFNTPGDLEALAREQLVEDRLKLAELDRAGLQLSEESL 90

Query: 103 NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEME 162
                  A    L  E F   L + G+ +   + ++ +   W D ++  +  +    E +
Sbjct: 91  AAEMEAFAGRADLPYEQFIGVLAEAGVAEETLRDFVRVGVSWRDYIRTRYRGRAEVNEAD 150

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +        N   +   I  +L  I       +    + I +                ++
Sbjct: 151 VDQTLAAPPNGGTQ---IEVLLNEIIIPAPPPRAAEAQAIAERISQTTSTAAFEAAAREY 207

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           ++       G+  +L  ++  P  Q  +L  +    T P     G+    +   R++ G 
Sbjct: 208 SALPSRERGGRLDWLPIANYPPPIQALVLGLAPGEVTAPLPIPNGIALFQLRAVREVAGS 267

Query: 282 IAL 284
              
Sbjct: 268 RPQ 270


>gi|254417887|ref|ZP_05031611.1| SurA N-terminal domain family [Brevundimonas sp. BAL3]
 gi|196184064|gb|EDX79040.1| SurA N-terminal domain family [Brevundimonas sp. BAL3]
          Length = 393

 Score =  162 bits (409), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 52/253 (20%), Positives = 101/253 (39%), Gaps = 10/253 (3%)

Query: 38  MSSRIRTTINGEVITDGDISKRIALL----KLQKINGEL---EKIAVQELIVETLKKQEI 90
           M+  I  T+N ++IT  D+ +++ +L    ++Q     L   ++ A+  LI + LK QEI
Sbjct: 1   MADGIVATVNDKIITGFDLRQQMLMLIASSQVQPTEQNLPAIQQAALNRLIEQRLKAQEI 60

Query: 91  EKS-GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVK 149
            K   +      ++    Q AR  G++   +  FL + GI  N F++ L  +  W  +V 
Sbjct: 61  TKFESLKVTDQEIDEEIAQMARQAGVTPAAYMEFLQQGGIQPNAFRESLRTEIGWGQLVP 120

Query: 150 NDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
             F  +     +++    +++ +     +YLI  +         Q       R    +  
Sbjct: 121 GRFNSRARPSTLQVDQEVRRLNDAAAQPQYLIGEIYIEAARVGGQEAAMNGARQLVQQII 180

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
           +    +   +    A        G A ++++  + P  Q +  +      +NP     GV
Sbjct: 181 QGAPFQAVAQQFSSAPSASARVPGDAGWVVKGTVQPALQTIFDQLQPGQLSNPIAVDGGV 240

Query: 268 EYIAICDKRDLGG 280
             I + DKRD   
Sbjct: 241 YIIYMRDKRDGAA 253



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 59/151 (39%), Gaps = 5/151 (3%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           + K          +R ++  +P+   +       R  +     LR   +C+ +   A   
Sbjct: 246 RDKRDGAATSLVSLRQLMVELPETASEADLAAATRTLEG----LRQGLNCDNILSQARAT 301

Query: 227 HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
             V          ++L PQFQ   +  +  + + P  T  G+  +A+C +R  G E   +
Sbjct: 302 QGVIGADLGESDVANLAPQFQQFARTGEIGSVSTPIRTPLGLHLVAVCGRRVGGPEAPNR 361

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +  +     +   E  Y++ LRS+A+I +
Sbjct: 362 QQVEGRLRSQNLAVLERRYLRDLRSDALIEF 392


>gi|330878394|gb|EGH12543.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963847|gb|EGH64107.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 440

 Score =  160 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 112/294 (38%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                       +L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S +
Sbjct: 58  IAKRGSGVPPAADLQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVD 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    E E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQ 235
           E+ +  +L + PD+   +          +   +L+   D  K     +S  + +  G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 70.8 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/315 (12%), Positives = 90/315 (28%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          K +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F++++  +     + P+ T  G   + +  +R       A      +     K ++ 
Sbjct: 355 VPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|302130724|ref|ZP_07256714.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato NCPPB 1108]
          Length = 440

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 111/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                       +L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAADLQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+     ++ +  + I   V +     +    E E+       + K     
Sbjct: 118 QFRAALAHDGLSYEDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQ 235
           E+ +  +L + PD+   +          +   +L+   D  K     +S  + +  G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/315 (12%), Positives = 90/315 (28%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYEDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          K +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F++++  +     + P+ T  G   + +  +R       A      +     K ++ 
Sbjct: 355 VPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|331017629|gb|EGH97685.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 440

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 111/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                       +L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAADLQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+     ++ +  + I   V +     +    E E+       + K     
Sbjct: 118 QFRAALAHDGLSYEDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQ 235
           E+ +  +L + PD+   +          +   +L+   D  K     +S  + +  G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 70.5 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/315 (12%), Positives = 90/315 (28%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYEDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          + +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRSEEATRLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F++++  +     + P+ T  G   + +  +R       A      +     K ++ 
Sbjct: 355 VPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|237803361|ref|ZP_04590946.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025342|gb|EGI05398.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 440

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/294 (17%), Positives = 110/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVAAIVDNDVIMKSQVDQRVHEVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+K  +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQKQVLDRLILENLQLQMGERSGIRVSDDELNQAIASIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  +  ++ +  + I   V +     +    E E+       + K     
Sbjct: 118 QFRAALIHDGVSYDDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +          +   + +   D  KL    S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDVIQAAALKAKSIYDQAKKGADFAKLAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 43/315 (13%), Positives = 96/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL+       +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALIHDGVSYDDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 177

Query: 119 DF-------------------SSFLDKQGIGDNHFK----QYLAI------------QSI 143
           +F                   ++ L  + I D   K      LA                
Sbjct: 178 EFHLANILIATPDSASSDVIQAAALKAKSIYDQAKKGADFAKLAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          K +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRSEEATKLLAQKIYERIENGEDFAALAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++  +     + P+ T  G   + +  +R       A +    +     K ++ 
Sbjct: 355 VPEFREVMNSTPQGTLSKPFKTAYGWHVLEVLGRRATDATGQAREQQALSVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|312113659|ref|YP_004011255.1| hypothetical protein Rvan_0880 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218788|gb|ADP70156.1| hypothetical protein Rvan_0880 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 365

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/340 (18%), Positives = 116/340 (34%), Gaps = 66/340 (19%)

Query: 37  AMSSRIRTTINGEVITDGDISK----------------------------RIALLK---- 64
           A +  I   +N E IT GDI++                            R  ++K    
Sbjct: 27  AKAQNIVVLVNDEPITSGDIAQRTRWMARTSGFGDRMKALLTGDSIKERFRQLMIKANPR 86

Query: 65  ------------------------LQKINGELEKIAVQELIVETLKKQEIEKSGITFDSN 100
                                   L +  G   K  ++ LI + LK Q  ++  IT    
Sbjct: 87  SQAEAEQTAERIKKQLVEEAKGRVLSEGGGTSRKQVIETLIEDKLKLQAAKRLEITVSDK 146

Query: 101 TVNYFFVQHARNTGLSAEDFS---SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYG 157
            V     Q A          +      +  GI     +  +  Q  W DV++  +  +  
Sbjct: 147 EVEEVLAQRAGGGDGKKPQLNEFYQQFEADGISRKTVQNIIRAQLAWRDVIRRQYGPRIA 206

Query: 158 NLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCN 217
            +   +P + QK  +  + ++ +R +  ++      ++  V +R+ +AE  R +    C 
Sbjct: 207 AMLAALPTDDQKPADGDI-QFDVRVLRLAV---AGSDERAVSQRMMEAENLRSKF-TSCA 261

Query: 218 KLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKR 276
            L K A  + D S+        +  +   Q  +LK S+   T P +    VE  AIC K 
Sbjct: 262 DLPKRAKLVADASVKAVDKAKLASFNKDAQPLILKASEGQMTPPILVSGAVEAYAICKKG 321

Query: 277 DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            +       A         + ++    Y+++L+ +A I Y
Sbjct: 322 VVLKRNPA-AEQKPDARAQEYDRFSRRYLQELKKSASIDY 360


>gi|301382733|ref|ZP_07231151.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato Max13]
 gi|302063472|ref|ZP_07255013.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato K40]
          Length = 440

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 111/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMGQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                       +L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAADLQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+     ++ +  + I   V +     +    E E+       + K     
Sbjct: 118 QFRAALAHDGLSYEDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQ 235
           E+ +  +L + PD+   +          +   +L+   D  K     +S  + +  G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/315 (12%), Positives = 90/315 (28%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYEDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          K +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F++++  +     + P+ T  G   + +  +R       A      +     K ++ 
Sbjct: 355 VPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|327479275|gb|AEA82585.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas stutzeri DSM
           4166]
          Length = 435

 Score =  159 bits (402), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 58/320 (18%), Positives = 123/320 (38%), Gaps = 15/320 (4%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK-- 64
           T LSDF++ L    +L+    +   +        R+   ++ +VI    + +RI  ++  
Sbjct: 3   TKLSDFLRPLLLGTLLLGSATLTTAALAQVQPLDRVVAIVDNDVIMQSQLDQRIQEVRQT 62

Query: 65  LQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           ++K   E      L++  ++ LI E L+ Q  E+SG+      +N      A+   ++ E
Sbjct: 63  IEKRGAEVPPNEVLQQQVLERLISENLQLQIGERSGVRISDEELNQAMATIAQRNNMTPE 122

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F   L + G+     ++ +  + I   V +     +    E E+         K     
Sbjct: 123 QFREALARDGLSPETAREQIRREMIISRVRQRRVAERIQVSEQEVQNFLASDLGKLQLSE 182

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQ 235
           EY +  +L  +P+          +R+      +L+   D  +L    ++  + +  G   
Sbjct: 183 EYHLANILIPVPEAADSATIQAAERMARDTHEQLQKGADFARLAVARSASENALEGGDMG 242

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQ 291
           +   + L P F +L+++      T P  T  G   + + +KR       +     ++  +
Sbjct: 243 WRKAAQLPPPFDSLVRELAVGEFTEPVRTPPGFIIVKVLEKRGGETQVRDEVHVRHILIK 302

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
            +  + E      VK+LR  
Sbjct: 303 PSAIRSEDEARLLVKRLRER 322



 Score = 65.1 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 62/156 (39%), Gaps = 9/156 (5%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQG-FVQKRIKDAEESRLRLPKDCNKLEKFA 223
             K+  +     E  +R +L      + +++   + KR+++    R+   +D  +L +  
Sbjct: 281 LEKRGGETQVRDEVHVRHILIKPSAIRSEDEARLLVKRLRE----RILAGEDFAELARNF 336

Query: 224 SKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDL-G 279
           S+    +   G   ++  + L P+F+ ++  +     + P+ +  G   + +  +R    
Sbjct: 337 SEDPGSALNGGDLNWIDPNSLVPEFRQVMANTASGELSQPFQSPYGWHILEVLGRRATDT 396

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            E   +          + ++    +++++R  A + 
Sbjct: 397 SEEFREQQARNLLRNRRYDEELQAWLRQIRDEAYVE 432


>gi|89054302|ref|YP_509753.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Jannaschia sp. CCS1]
 gi|88863851|gb|ABD54728.1| PPIC-type PPIASE domain [Jannaschia sp. CCS1]
          Length = 422

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 39/268 (14%), Positives = 91/268 (33%), Gaps = 8/268 (2%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAV 77
           T+  L      P                +N  ++T+ +I +RI  L++    G+L + A+
Sbjct: 22  TFLCLGCALSAPFGGQAHAQNPFSAAVEVNDTIVTNFEIGQRIRFLQVLNAQGDLREQAI 81

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
           + L+ E L+       G       +     + A    L  E F   + ++GI     + +
Sbjct: 82  EALVNERLQLDAALAVGAEASPEAIETGLEEFAGRANLGPEQFLRQMAQEGIAPETVRDF 141

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK--NITVREYLIRTVLFSIPDNKLQNQ 195
           +A    W +VV+  F       E ++    +        +   L   ++   PDN+   +
Sbjct: 142 VANGITWRNVVRARFGPTIDITEEDVERALELGTVLGGGIEILLAEIIIPVTPDNQANLE 201

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQ 254
             +    +   +    + +      +F++     + G   +    +L    ++  ++   
Sbjct: 202 SELS---RLGRDVAGNVERFSEAARRFSAAPTREAGGVTGWRPLGELPEGLRDRFMQMGY 258

Query: 255 NNTTNPYVTQKG--VEYIAICDKRDLGG 280
              T+P     G          +R++  
Sbjct: 259 AQVTDPVSLGGGQAFALFQYRGQREVTS 286



 Score = 48.9 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 63/190 (33%), Gaps = 19/190 (10%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS-IPD 189
               +    +Q  +  V      +  G  +       +  + +T     I  + +  +P 
Sbjct: 246 PEGLRDRF-MQMGYAQVTD---PVSLGGGQAFALFQYRGQREVTSPRLPITAIDYVTVPI 301

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
           +          R  D      RL    +    F   +          +  S +       
Sbjct: 302 SGG--------RTPDGLAEAARLDAAVDVCNDFNGVLPGGFERHT--VPPSQVPEDIALA 351

Query: 250 LKKSQNNTTNPYVTQKG---VEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVK 306
           ++   N+  +  VT+ G   +  + +CD+     E  +   +  Q    ++++  A Y++
Sbjct: 352 IRTLDNHEMSTAVTRNGGTVLLAVMLCDRVSAEPEAGVDR-IREQLFGQQLQRLAANYLE 410

Query: 307 KLRSNAIIHY 316
           +LR+ A I+Y
Sbjct: 411 ELRAEARINY 420


>gi|330980962|gb|EGH79065.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 442

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/296 (17%), Positives = 109/296 (36%), Gaps = 17/296 (5%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           V T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++
Sbjct: 3   VKTKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQ 57

Query: 65  LQKIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
                          L+   +  LI+E L+ Q  E+SGI      +N      A+   +S
Sbjct: 58  QTIAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMS 117

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNIT 174
            E F + L   G+  N  ++ +  + I   V +     +    + E+         K   
Sbjct: 118 VEQFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQL 177

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGK 233
             E+ +  +L + PD+   +              +L+   D  +L   +S   +    G 
Sbjct: 178 SEEFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGD 237

Query: 234 AQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
             +   + L P F ++L      + T P  T  G   + + +KR   GE  ++  +
Sbjct: 238 MGWRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGEAQMRDEV 293



 Score = 76.2 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 41/315 (13%), Positives = 96/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 122 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDMGKAQLS-E 179

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 180 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMG 239

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 240 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGEAQMRDEVHVRHIL 299

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 300 IKPSE---IRNEAETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 356

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ TQ G   + +  +R     + A +          K ++ 
Sbjct: 357 VPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSKDATDQAREQQALNVLRNRKYDEE 416

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 417 LQTWLRQIRDEAYVE 431


>gi|294678213|ref|YP_003578828.1| chaperone SurA [Rhodobacter capsulatus SB 1003]
 gi|294477033|gb|ADE86421.1| chaperone SurA [Rhodobacter capsulatus SB 1003]
          Length = 418

 Score =  157 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 96/259 (37%), Gaps = 12/259 (4%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELI 81
           L +    P+ +  +   +  I  T+NG  I+  +I++R   ++L    G++ K+A + LI
Sbjct: 17  LALGTAAPLQAQATGDFAPAI--TVNGLAISGYEIAQRARFMELLGATGDVRKMAEEALI 74

Query: 82  VETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
            + L+  + +  GI+     V     + A    LSAEDF   L   G+    ++ ++   
Sbjct: 75  DDRLQGWKAQSLGISVSREAVTRGMAEFAARANLSAEDFLKALAGAGVEAQTYRDFVTSG 134

Query: 142 SIWPDVVK-----NDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
            IW +VVK         +    ++  +     K       + LI  ++      +     
Sbjct: 135 VIWREVVKTTYGGGRIQISDAEIDRALAHEAPKGAEPEPPKVLISEIVIRNFPGRDAETM 194

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQN 255
              ++   A+             ++ +S       G+  ++  + L P+ +  +L     
Sbjct: 195 AKARKAAAAKTEAEFAAL----AKELSSAKSAGQGGRLDWMPVTALPPEVRETVLGLRPG 250

Query: 256 NTTNPYVTQKGVEYIAICD 274
             + P  T   V    +  
Sbjct: 251 RASAPVETPNSVSVFFLRG 269


>gi|289676168|ref|ZP_06497058.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae FF5]
 gi|330938460|gb|EGH42067.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. pisi str. 1704B]
          Length = 440

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/294 (17%), Positives = 108/294 (36%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI      +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+         K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +              +L+   D  +L   +S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   GE  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGEAQMRDEV 291



 Score = 76.2 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 41/315 (13%), Positives = 96/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDMGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGEAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRNEAETKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ TQ G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSKDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|146281122|ref|YP_001171275.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas stutzeri
           A1501]
 gi|145569327|gb|ABP78433.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas stutzeri
           A1501]
          Length = 451

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/325 (17%), Positives = 121/325 (37%), Gaps = 15/325 (4%)

Query: 2   TSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIA 61
           T  V T LS+ ++ L    +L+    +   +        R+   ++ +VI    +++R+ 
Sbjct: 14  TVNVKTKLSEVLRPLALGALLLSGATLAPAALAQVQPLDRVVAIVDNDVIMQSQLNQRMR 73

Query: 62  LLK--LQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT 113
            ++  ++K   +      L++  ++ LI E L+ Q  E+SGI      +N      A+  
Sbjct: 74  EVQQTIEKRGADAPPTDVLQQQVLERLITENLQLQIGERSGIRISDEELNQAMGTIAQRN 133

Query: 114 GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMK 171
            +S E F   L + G+     ++ +  + +   V +     +      E+         K
Sbjct: 134 NMSLEQFREALARDGLSLETAREQIRREMVISRVRQRRVAERIQVSNQEVQNFLASDLGK 193

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS- 230
                EY +  +L ++P+          +R       +L+   D  +L    S   +   
Sbjct: 194 LQLSEEYHLANILIAVPEGADSATIQAAERTAMDTYQQLQQGADFARLAVSRSGSENALE 253

Query: 231 IGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKA 286
            G   +   + L P F   ++  S    T P  T  G   + + DKR       +     
Sbjct: 254 GGDMGWRKAAQLPPPFDTEVRELSVGEVTQPVRTPPGFIMLKLLDKRGGETQVRDEVHVR 313

Query: 287 YLSAQNTPTKIEKHEAEYVKKLRSN 311
           ++  + +  + ++     V++LR  
Sbjct: 314 HILIKPSAIRSDEEARLLVQRLRDR 338



 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/156 (12%), Positives = 60/156 (38%), Gaps = 9/156 (5%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQG-FVQKRIKDAEESRLRLPKDCNKLEKFA 223
            +K+  +     E  +R +L      +   +   + +R++D    R+   +D  +L +  
Sbjct: 297 LDKRGGETQVRDEVHVRHILIKPSAIRSDEEARLLVQRLRD----RINAGEDFAQLARSF 352

Query: 224 SKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG 280
           S+    +   G   ++  + L P+F+ ++  +     +  + +  G   + +  +R    
Sbjct: 353 SEDPGSALNGGDLNWIDPASLVPEFREVMANTPSGELSQVFKSPYGWHILEVLGRRATDA 412

Query: 281 EIALKAYLSAQ-NTPTKIEKHEAEYVKKLRSNAIIH 315
               +   +       K ++    +++++R  A + 
Sbjct: 413 SEQFREQQALSLLRNRKYDEELQAWLRQIRDEAYVE 448


>gi|330961060|gb|EGH61320.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 440

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 109/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+K  +  LI+E L+ Q  E++GI      +N      A+   +S +
Sbjct: 58  IAKRGSGVPPAEALQKQVLDRLILENLQLQMGERAGIRVSDEELNQAIGTIAQRNNMSVD 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  +  ++ +  + I   V +     +    E E+       + K     
Sbjct: 118 QFRAALAHDGLSYDDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+              +   +L+   D  KL    S   +    G   
Sbjct: 178 EFHLANILIATPDSASSEAIQAAAIKAKSIYDQLKKGADFGKLATTNSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 55/157 (35%), Gaps = 7/157 (4%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     + +     E  +R +L    +          K +      R+   +D   L K 
Sbjct: 276 LEKRGGQGQAQMRDEVHVRHILIKPSE---IRSEEATKLLAQKIYDRIENGEDFATLAKS 332

Query: 223 ASKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            S+    +   G   ++  + L P+F+ ++  +     + P+ T  G   + +  +R   
Sbjct: 333 FSEDPGSALNGGDLNWVDPNSLVPEFREVMSNTPQGVLSKPFKTAYGWHVLEVLGRRATD 392

Query: 280 G-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
               A +    +     K ++    +++++R  A + 
Sbjct: 393 ATGQAREQQALSVLRNRKYDEELQTWLRQIRDEAYVE 429


>gi|66047852|ref|YP_237693.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae B728a]
 gi|63258559|gb|AAY39655.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae B728a]
 gi|330970840|gb|EGH70906.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 442

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/296 (17%), Positives = 109/296 (36%), Gaps = 17/296 (5%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           V T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++
Sbjct: 3   VKTKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQ 57

Query: 65  LQKIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
                          L+   +  LI+E L+ Q  E+SGI      +N      A+   +S
Sbjct: 58  QTIAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMS 117

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNIT 174
            E F + L   G+  N  ++ +  + I   V +     +    + E+         K   
Sbjct: 118 VEQFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQL 177

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGK 233
             E+ +  +L + PD+   +              +L+   D  +L   +S   +    G 
Sbjct: 178 SEEFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGD 237

Query: 234 AQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
             +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 MGWRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 293



 Score = 75.8 bits (185), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 41/315 (13%), Positives = 97/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 122 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDMGKAQLS-E 179

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 180 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMG 239

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 240 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 299

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+      R+   +D  +L K  S+    +   G   ++  + L
Sbjct: 300 IKPSEIRNEEE---TKRLAQKIYDRIENGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 356

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ TQ G   + +  +R     + A +          K ++ 
Sbjct: 357 VPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 416

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 417 LQTWLRQIRDEAYVE 431


>gi|330891199|gb|EGH23860.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 440

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 110/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +              +L+   D  +L   +S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTQLAATSSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 77.4 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTQLAATSSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|229592952|ref|YP_002875071.1| putative chaperone [Pseudomonas fluorescens SBW25]
 gi|229364818|emb|CAY52844.1| putative chaperone [Pseudomonas fluorescens SBW25]
          Length = 444

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 61/318 (19%), Positives = 116/318 (36%), Gaps = 19/318 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK-- 64
           T LSD ++ L    VL    +    ++ +     ++   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPL----VLGALLLGTASAHAAVQQLDKVVAIVDNDVIMQSQLDQRVKEVQQT 58

Query: 65  LQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           + K  G       L++  ++ LIVE L+ Q  ++SGI      +N      A+   +S +
Sbjct: 59  IAKRGGGVPPTSVLDQQVLERLIVENLQLQIGDRSGIRISDEELNQAVGTIAQRNNMSID 118

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+     +  +  + I   V +     +    E E+         K     
Sbjct: 119 QFRAALAHDGLSYEDARDQIRREMIISRVRQRRVAERVQVSEQEVKNFLASDLGKMQLSE 178

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQ 235
           E  +  +L   PD+    Q         A   RL+   D  ++    +   + +  G   
Sbjct: 179 ELHLANILIPTPDSANSEQLNAAAAKTQAIYDRLKAGADFAQMAIAQSGSDNALEGGDMG 238

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-NT 293
           +   + L P F + L        T P  T  G   + + +KR  GGE +LK  +  +   
Sbjct: 239 WRKAAQLPPPFDRELSAMEVGGITQPARTPGGFIILKLLEKR--GGETSLKDEVHVRHIL 296

Query: 294 PTKIEKHEAEYVKKLRSN 311
               E       K+L   
Sbjct: 297 VKPSEIRTEAQTKELAQK 314



 Score = 70.1 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 95/316 (30%), Gaps = 60/316 (18%)

Query: 56  ISK-RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114
           I + R AL        +      +E+I+  ++++ + +  +      V  F         
Sbjct: 117 IDQFRAALAHDGLSYEDARDQIRREMIISRVRQRRVAER-VQVSEQEVKNFLASDLGKMQ 175

Query: 115 LS-----------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------I 140
           LS                 +E  ++   K     +  K       +A             
Sbjct: 176 LSEELHLANILIPTPDSANSEQLNAAAAKTQAIYDRLKAGADFAQMAIAQSGSDNALEGG 235

Query: 141 QSIWPDVVK-----NDFMLKYGNLEMEIPA------------NKQKMKNITVREYLIRTV 183
              W    +     +  +       +  PA             K+  +     E  +R +
Sbjct: 236 DMGWRKAAQLPPPFDRELSAMEVGGITQPARTPGGFIILKLLEKRGGETSLKDEVHVRHI 295

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESD 241
           L    + + + Q    K +      R+   +D   L K  S+    +   G   ++    
Sbjct: 296 LVKPSEIRTEAQ---TKELAQKIYDRIESGEDFATLAKSFSEDPGSALNGGDLNWIDPKA 352

Query: 242 LHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEK 299
           L P+FQ ++    Q   + P+ TQ G   + +  +R       A +          K ++
Sbjct: 353 LVPEFQQVMADTPQGVLSKPFKTQYGWHVLEVLGRRATDNTNQAREQQALNVLRNRKYDE 412

Query: 300 HEAEYVKKLRSNAIIH 315
               +++++R  A + 
Sbjct: 413 ELQTWLRQIRDEAYVE 428


>gi|257483108|ref|ZP_05637149.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 442

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 52/296 (17%), Positives = 110/296 (37%), Gaps = 17/296 (5%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           V T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++
Sbjct: 3   VKTKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQ 57

Query: 65  LQKIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
                          L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S
Sbjct: 58  QTIAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMS 117

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNIT 174
            E F + L   G+  N  ++ +  + I   V +     +    + E+       + K   
Sbjct: 118 VEQFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQL 177

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGK 233
             E+ +  +L + PD+   +              +L+   D  +L    S   +    G 
Sbjct: 178 SEEFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGD 237

Query: 234 AQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
             +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 MGWRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 293



 Score = 77.8 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 122 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 179

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 180 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 239

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 240 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 299

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 300 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWIDPNSL 356

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 357 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 416

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 417 LQTWLRQIRDEAYVE 431


>gi|312963417|ref|ZP_07777899.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas fluorescens
           WH6]
 gi|311282223|gb|EFQ60822.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas fluorescens
           WH6]
          Length = 444

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 61/318 (19%), Positives = 116/318 (36%), Gaps = 19/318 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK-- 64
           T LSD ++ L    VL    +    ++ +     ++   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPL----VLGALFLGAASAHAAVQQLDKVVAIVDNDVIMQSQLDQRVKEVQQT 58

Query: 65  LQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           + K  G       L++  ++ LIVE L+ Q  E+SGI      +N      A+   +S +
Sbjct: 59  IAKRGGGVPPTSVLDQQVLERLIVENLQLQIGERSGIRISDEELNQAVGTIAQRNNMSID 118

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+     +  +  + I   V +     +    E E+         K     
Sbjct: 119 QFRAALAHDGLSYEDARDQIRREMIISRVRQRRVAERVQVSEQEVKNFLASDLGKMQLSE 178

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQ 235
           E  +  +L   PD+    Q         A   RL+   D  ++    +   + +  G   
Sbjct: 179 ELHLANILIPTPDSANSEQLNAAAAKTQAIYERLKAGADFAQMAIAQSGSDNALEGGDMG 238

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-NT 293
           +   + L P F + L        T P  T  G   + + ++R  GGE +LK  +  +   
Sbjct: 239 WRKAAQLPPPFDRELSAMEVGGITQPARTPGGFIILKLLERR--GGETSLKDEVHVRHIL 296

Query: 294 PTKIEKHEAEYVKKLRSN 311
               E       K+L   
Sbjct: 297 VKPSEIRSEAQTKELAQK 314



 Score = 70.1 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 40/316 (12%), Positives = 92/316 (29%), Gaps = 60/316 (18%)

Query: 56  ISK-RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114
           I + R AL        +      +E+I+  ++++ + +  +      V  F         
Sbjct: 117 IDQFRAALAHDGLSYEDARDQIRREMIISRVRQRRVAER-VQVSEQEVKNFLASDLGKMQ 175

Query: 115 LS-----------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------I 140
           LS                 +E  ++   K        K       +A             
Sbjct: 176 LSEELHLANILIPTPDSANSEQLNAAAAKTQAIYERLKAGADFAQMAIAQSGSDNALEGG 235

Query: 141 QSIWPDVVK-----NDFMLKYGNLEMEIPA------------NKQKMKNITVREYLIRTV 183
              W    +     +  +       +  PA             ++  +     E  +R +
Sbjct: 236 DMGWRKAAQLPPPFDRELSAMEVGGITQPARTPGGFIILKLLERRGGETSLKDEVHVRHI 295

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESD 241
           L    +          K +      R++  +D   L K  S+    +   G   ++    
Sbjct: 296 LVKPSE---IRSEAQTKELAQKIYDRIQSGEDFATLAKSFSEDPGSALNGGDLNWIDPKA 352

Query: 242 LHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-NTPTKIEK 299
           L P+FQ ++    Q   + P+ TQ G   + +  +R        +   +       K ++
Sbjct: 353 LVPEFQQVMADTPQGVLSKPFKTQYGWHVLEVLGRRATDNTSQAREQQALSVLRNRKYDE 412

Query: 300 HEAEYVKKLRSNAIIH 315
               +++++R  A + 
Sbjct: 413 ELQTWLRQIRDEAYVE 428


>gi|71733994|ref|YP_272934.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554547|gb|AAZ33758.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 440

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 52/294 (17%), Positives = 109/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLESVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    N +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDNELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +              +L+   D  +L    S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 77.8 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|320326011|gb|EFW82069.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|330985794|gb|EGH83897.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 440

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 109/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +              +L+   D  +L    S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 77.8 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|331011659|gb|EGH91715.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 440

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 109/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +              +L+   D  +L    S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 77.4 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWIDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|28867781|ref|NP_790400.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|81732691|sp|Q88A44|SURA_PSESM RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|28851016|gb|AAO54095.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 428

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 102/276 (36%), Gaps = 12/276 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++              +L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAADLQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+     ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYEDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + I   V +     +    E E+       + K     E+ +  +L + PD+   +
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
                     +   +L+   D  K     +S  + +  G   +   + L P F ++L   
Sbjct: 184 AIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSSM 243

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
              + T P  T  G   + + +KR   G+  ++  +
Sbjct: 244 PIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 279



 Score = 70.1 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 39/315 (12%), Positives = 90/315 (28%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 108 RAALAHDGLSYEDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 165

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 166 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 225

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 226 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 285

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          K +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 286 IKPSE---IRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPNSL 342

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F++++  +     + P+ T  G   + +  +R       A      +     K ++ 
Sbjct: 343 VPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKYDEE 402

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 403 LQTWLRQIRDEAYVE 417


>gi|329890123|ref|ZP_08268466.1| PPIC-type PPIASE domain protein [Brevundimonas diminuta ATCC 11568]
 gi|328845424|gb|EGF94988.1| PPIC-type PPIASE domain protein [Brevundimonas diminuta ATCC 11568]
          Length = 457

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 114/294 (38%), Gaps = 16/294 (5%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKIN---GELEKIAVQELIV 82
                 + +S  I  T+N  +IT  D+ +R+    A+ ++Q      G +++ A+ +LI 
Sbjct: 58  TAPAPQFRLSDGIIATVNDRIITGFDLRQRMLVLMAMTQVQPTEENIGAIQQQALNDLID 117

Query: 83  ETLKKQEIEKS-GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQ 141
           + L+  E+ K   +      ++      AR  G +   + +FL++ GI    F++ +  +
Sbjct: 118 QHLQAAELAKFEQLKIGDAEIDQEIADMARQAGTTPASYINFLEQGGISIPAFREQMRTE 177

Query: 142 SIWPDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
             W ++V   F  +    + +I    +Q  ++ T  +YLI  +           +     
Sbjct: 178 IGWRELVGGRFRDRARVGKSQIEQTMRQMTESATKPQYLIGEIYLEAARVGGMQEAMNGA 237

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTN 259
           R     +  ++         +F++       G A ++++  + P  Q+++        +N
Sbjct: 238 RQ--LVQQMIQGAPFMAVARQFSAAPSAARGGDAGWVVQGTVQPALQSVMDTLEAGQLSN 295

Query: 260 PYVTQKGVEYIAICDKRDLGGEIALKAYLSA----QNTPTKIEKHEAEYVKKLR 309
           P     GV  + + DKR       +K         +N          + ++ LR
Sbjct: 296 PIPVDGGVYILYMRDKRSGASTSMVKMKQVMVELPENADEAQVAAATQRLEALR 349



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 61/150 (40%), Gaps = 5/150 (3%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           + K    +     ++ V+  +P+N  + Q     +  +A    LR    C+ +   A   
Sbjct: 309 RDKRSGASTSMVKMKQVMVELPENADEAQVAAATQRLEA----LRGQLTCDNILTRARSE 364

Query: 227 HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
             +          +DL PQFQ + + ++  + +    T  GV  +A+CD+R  G +    
Sbjct: 365 PGLLGADLGESDVADLLPQFQQVARSAEVGSVSTAVRTPLGVHLLAVCDRRLGGPDAPSA 424

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + A+            Y++ LR++A+I 
Sbjct: 425 QQVEARLQNQNYAMLGRRYLRDLRADALIE 454


>gi|302383690|ref|YP_003819513.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194318|gb|ADL01890.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 450

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 108/267 (40%), Gaps = 18/267 (6%)

Query: 27  IVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQKINGEL---EKIAVQE 79
             P+     + M+  I  T+N +VIT  D+ +R+    A+ ++Q     +   ++ A+Q 
Sbjct: 49  TAPLPPQPEFKMADGIVATVNDQVITGFDLRQRMLTTIAMSQVQPTEENIPAIQQQALQG 108

Query: 80  LIVETLKKQEIEKSG-ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
           LI E L+  EI K   +      V+    + A   G + + +  FL   GI   + ++ L
Sbjct: 109 LIEERLQAAEIAKFETLKITDAEVDEEIARMAEEAGTTPQAYVEFLTSGGIRAENLREQL 168

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
             +  W ++V   F  +      ++    +Q  +  +  +YL+  +         Q    
Sbjct: 169 RTEIGWRELVGGRFNSRSRVSRAQVQQALRQVTETASKPQYLVGEIYLEAARVGGQ---- 224

Query: 198 VQKRIKDAEESRLRLPKDC---NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ 254
            Q+ +  AE+   ++ +         +F++       G A +L++  + P+ Q  L+  +
Sbjct: 225 -QQAMNGAEQLVQQMVQGAPFQAVARQFSAAPSAARGGDAGWLVQGTVQPELQAALEALE 283

Query: 255 -NNTTNPYVTQKGVEYIAICDKRDLGG 280
               + P     GV  I + DKR    
Sbjct: 284 VGQLSRPIPVSGGVYIIYMRDKRSGAA 310



 Score = 69.7 bits (169), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 58/151 (38%), Gaps = 7/151 (4%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
           + K          ++  +  +P+            R++      LR    C+ + +  S 
Sbjct: 303 RDKRSGAATNLVSLKQAMIELPETAPPADVAAATTRLQT-----LRGSLTCDNILQRTSS 357

Query: 226 IHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIAL 284
              +          ++L PQFQ + + ++  + ++   T  GV  +A+C +R  G ++  
Sbjct: 358 EAGLLGSDLGEADVANLAPQFQQVARSAEIGSVSDVVRTPLGVHLVAVCGRRAGGADVPT 417

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +  +     +      Y++ LR++A+I 
Sbjct: 418 AREIEGRLQNQNLAMLARRYLRDLRADALIE 448


>gi|302185941|ref|ZP_07262614.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           pv. syringae 642]
          Length = 440

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 108/294 (36%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+         K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+                  +L+   D  +L   +S   +    G   
Sbjct: 178 EFHLANILIATPDSASSEAIQAAAAKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 73.5 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 42/315 (13%), Positives = 97/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDMGKAQLSEE 178

Query: 119 -DFSSFL-----------------DKQGIGDNHFK---QYLA--------------IQSI 143
              ++ L                   +GI  +  K    +                    
Sbjct: 179 FHLANILIATPDSASSEAIQAAAAKAKGI-YDQLKKGADFTRLAATSSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          KR+      R+   +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSE---IRNEAETKRLAQKIYDRIENGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ TQ G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMSETPQGELSKPFQTQYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|330955092|gb|EGH55352.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas syringae
           Cit 7]
          Length = 440

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 110/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S +
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVD 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+         K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDLGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +          A   +L+   D  +L   +S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAAKAKAIYDQLKKGADFTRLAATSSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 74.3 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 60/157 (38%), Gaps = 7/157 (4%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +     + +     E  +R +L    +          KR+      R++  +D  +L K 
Sbjct: 276 LEKRGGQGQAQMRDEVHVRHILIKPSE---IRNEAETKRLAQKIYDRIQNGEDFAELAKS 332

Query: 223 ASKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            S+    +   G   ++  + L P+F+ ++ ++     + P+ TQ G   + +  +R   
Sbjct: 333 FSEDPGSALNGGDLNWVDPNSLVPEFRQVMSETPQGELSKPFQTQYGWHVLEVLGRRSTD 392

Query: 280 G-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + A +          K ++    +++++R  A + 
Sbjct: 393 ATDQAREQQALNVLRNRKYDEELQTWLRQIRDEAYVE 429


>gi|213967673|ref|ZP_03395820.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato T1]
 gi|213927449|gb|EEB60997.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           tomato T1]
          Length = 428

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 102/276 (36%), Gaps = 12/276 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++              +L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMGQRVREVQQTIAKRGSGVPPAADLQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+     ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYEDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + I   V +     +    E E+       + K     E+ +  +L + PD+   +
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
                     +   +L+   D  K     +S  + +  G   +   + L P F ++L   
Sbjct: 184 AIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSSM 243

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
              + T P  T  G   + + +KR   G+  ++  +
Sbjct: 244 PIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 279



 Score = 70.1 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 39/315 (12%), Positives = 90/315 (28%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 108 RAALAHDGLSYEDAREQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDQGKAQLS-E 165

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 166 EFHLANILIATPDSASSDAIQAAAVKAKSIYDQLKKGADFAKIAATTSSSENALEGGDMG 225

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 226 WRKAAQLPPPFGDMLSSMPIGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 285

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               +          K +      R+   +D   L K  S+    +   G   ++  + L
Sbjct: 286 IKPSE---IRSEEATKLLAQKIYERIENGEDFATLAKSFSEDPGSALNGGDLNWVDPNSL 342

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F++++  +     + P+ T  G   + +  +R       A      +     K ++ 
Sbjct: 343 VPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNRKYDEE 402

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 403 LQTWLRQIRDEAYVE 417


>gi|320332054|gb|EFW87990.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 440

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 50/294 (17%), Positives = 109/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           ++ +  +L + PD+   +              +L+   D  +L    S   +    G   
Sbjct: 178 KFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L      + T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 76.2 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 97/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
            F              S  +    +        L                          
Sbjct: 178 KFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|304320041|ref|YP_003853684.1| peptidyl-prolyl cis-trans isomerase family protein [Parvularcula
           bermudensis HTCC2503]
 gi|303298944|gb|ADM08543.1| peptidyl-prolyl cis-trans isomerase family protein [Parvularcula
           bermudensis HTCC2503]
          Length = 421

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 42/267 (15%), Positives = 105/267 (39%), Gaps = 12/267 (4%)

Query: 23  IIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAV----- 77
            +          +  +  R+   +N + I+  D+ +RI L+ + +    L + A+     
Sbjct: 10  TLILTGLTAPLANAQVGERVAAVVNDDPISTFDVRQRIQLIIVTEGMRNLPQEALAQLQG 69

Query: 78  ---QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHF 134
              +ELI E LK QE E+  +T     ++    Q A   G + +  +  L   G+     
Sbjct: 70  RALRELIEERLKLQEAERFELTIPDEAIDAELEQLAGQAGTTVQQLTEDLATAGVNIGTL 129

Query: 135 KQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-NITVREYLIRTVLFSIPDNKLQ 193
           +  +  +  W  +V+  +  +    +  +      ++ +    +YLI  +   +   + Q
Sbjct: 130 RDRIQAEQAWQQLVRGRYGPRVSITDDAVETMLDDLELSARSDQYLISEICLPVTRQEDQ 189

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK- 252
                Q  ++  E+ R  +P      +++++       G   +L   +L     +++++ 
Sbjct: 190 -PEMYQAGMQMIEQLRRGVPFG-ALAQQYSACSSAARGGDLGWLRADELDQTTLDIVQQL 247

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLG 279
           S+ N + P   +  ++ +A+   R+  
Sbjct: 248 SEGNVSRPIPLRGVIKIVALRQTREAA 274


>gi|289627686|ref|ZP_06460640.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649005|ref|ZP_06480348.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868493|gb|EGH03202.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 440

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 110/294 (37%), Gaps = 17/294 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           T LSD ++ L    +L+   +     + +      +   ++ +VI    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGALLLSGAV-----HAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQT 57

Query: 67  KIN--------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                        L+   +  LI+E L+ Q  E+SGI    + +N      A+   +S E
Sbjct: 58  IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L   G+  N  ++ +  + I   V +     +    + E+       + K     
Sbjct: 118 QFRAALAHDGLSYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E+ +  +L + PD+   +              +L+   D  +L    S   +    G   
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 236 YLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
           +   + L P F ++L     ++ T P  T  G   + + +KR   G+  ++  +
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVDDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 291



 Score = 77.4 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 177

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 178 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 237

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 238 WRKAAQLPPPFGDMLSAMPVDDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 297

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 298 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 354

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 355 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 414

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 415 LQTWLRQIRDEAYVE 429


>gi|330812129|ref|YP_004356591.1| peptidylprolyl isomerase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380237|gb|AEA71587.1| putative peptidylprolyl isomerase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 438

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/320 (16%), Positives = 113/320 (35%), Gaps = 20/320 (6%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL- 65
           T LSD ++ L    +      +   +  +     ++   ++ +V+    + +R+  ++  
Sbjct: 3   TKLSDCLRPLMLGAL-----FLGTAANAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQQT 57

Query: 66  -------QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
                  Q   G L++  ++ LIVE L+ Q  E+SGI      +N      A+   +S +
Sbjct: 58  IAKRGGGQPPPGVLDQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNNMSID 117

Query: 119 DFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVR 176
            F + L + G+     +  +  + +   V +     +    E E+         K     
Sbjct: 118 QFRAALARDGLSYEDARDQIRREMVISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSE 177

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQ 235
           E  +  +L   P++          R       +L+   D  ++    S   +    G   
Sbjct: 178 ELHLANILIPTPESANSEAIQSAYRQAMDVYQQLKQGADFGQMAIAKSGSDNALEGGDMG 237

Query: 236 YLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQ 291
           +   + L P F + L   +  + T P  T  G   + + +KR  G    +     ++  +
Sbjct: 238 WRKPAQLPPPFDRELSAMAVGDITQPARTPGGFIILKVLEKRGGGTQVRDEVHVRHILIK 297

Query: 292 NTPTKIEKHEAEYVKKLRSN 311
            +  + E       +KL   
Sbjct: 298 PSEIRSEAETKRLAEKLYDR 317



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/289 (12%), Positives = 89/289 (30%), Gaps = 38/289 (13%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT----FDSNTVNYFFVQHARNTG 114
           R+   ++ +     E+     L  +  K Q  E+  +         + N   +Q A    
Sbjct: 145 RVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPESANSEAIQSAYRQA 204

Query: 115 LSAED-------FSSFLDKQGIGDNHFKQYLAIQSIWPDVVK-----NDFMLKYGNLEME 162
           +           F      +   DN  +        W    +     +  +      ++ 
Sbjct: 205 MDVYQQLKQGADFGQMAIAKSGSDNALEG---GDMGWRKPAQLPPPFDRELSAMAVGDIT 261

Query: 163 IPA------------NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
            PA             K+        E  +R +L    +          KR+ +    R+
Sbjct: 262 QPARTPGGFIILKVLEKRGGGTQVRDEVHVRHILIKPSE---IRSEAETKRLAEKLYDRI 318

Query: 211 RLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGV 267
              +D  +L K  S+    +   G   ++  + L P+F+ ++    Q   + P+ +  G 
Sbjct: 319 EAGEDFAELAKSFSEDPGSALNGGDLNWVDPNALVPEFRQVMADTPQGQLSKPFKSPYGW 378

Query: 268 EYIAICDKRDLGGEIALKAYLSAQ-NTPTKIEKHEAEYVKKLRSNAIIH 315
             + +  +R        +   +       K ++    +++++R  A + 
Sbjct: 379 HVLEVLGRRATDSTTQAREQQAMTVLRNRKYDEELQTWLRQIRDEAYVE 427


>gi|257092441|ref|YP_003166082.1| SurA domain-containing protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044965|gb|ACV34153.1| SurA domain protein [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 436

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 100/274 (36%), Gaps = 12/274 (4%)

Query: 15  LLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI--ALLKLQKINGEL 72
           LL +  V ++                RI   +N EVIT  ++  R+  AL +LQ+   +L
Sbjct: 9   LLMSCLVGVVLAQTASRPLAQPIPVDRIVAVVNDEVITLHELRTRLDGALAQLQRQGTQL 68

Query: 73  ------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                 E+  ++ L+++ ++ Q+    G+  D   +     + A    +S   F + L+K
Sbjct: 69  PPRDVLERQMLERLVIDKVQLQQARDMGVRVDDAQLEQALQRIAAGNKMSLAQFRAALEK 128

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVL 184
            GI    F++ +  +     V + +   K    E EI         +   V E+ +  +L
Sbjct: 129 DGIAFASFREEIRGEMTIARVREREVESKIFISEGEIDNYLAGASGQGGAVEEFNLAHIL 188

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLH 243
              P++    Q    +   +    R+R  ++  +L    S   D    G   +     L 
Sbjct: 189 LRSPESASPEQIQKLRAKGEQVAERVRKGEEFAQLAAAYSDAPDGLKGGDLGWRSLDRLP 248

Query: 244 PQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           P F       +    +    +  G   I +  KR
Sbjct: 249 PLFAEAAATLKVGEVSPLLRSSNGFHLIKLVAKR 282



 Score = 67.4 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/231 (12%), Positives = 75/231 (32%), Gaps = 30/231 (12%)

Query: 107 VQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDV------------------V 148
            Q A       E+F+          +  K        W  +                  V
Sbjct: 208 EQVAERVR-KGEEFAQLAAAYSDAPDGLKG---GDLGWRSLDRLPPLFAEAAATLKVGEV 263

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEES 208
                   G   +++ A +       V++   R +L  + +   +++    +   +    
Sbjct: 264 SPLLRSSNGFHLIKLVAKRGGGTLAAVQQTHARHILIKVNEVVSESEA---RHKLEGLRE 320

Query: 209 RLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKG 266
           R++  +   +L K  S+    +  G   ++   D  P+F+  +   +    + P  +  G
Sbjct: 321 RIKHGESFAELAKLFSQDGSATKGGDLGWVYPGDTVPEFERAMNLLAPGEVSEPVQSPFG 380

Query: 267 VEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              I + ++R  D+  +   +A         K ++   +++++ R  A + 
Sbjct: 381 FHLIEVLERRVQDVSSDR-QRAGARQVLRERKRDEAYQDWLRQTRDRAYVE 430


>gi|197105171|ref|YP_002130548.1| peptidyl-prolyl cis-trans isomerase family protein
           [Phenylobacterium zucineum HLK1]
 gi|196478591|gb|ACG78119.1| peptidyl-prolyl cis-trans isomerase family protein
           [Phenylobacterium zucineum HLK1]
          Length = 468

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/291 (18%), Positives = 119/291 (40%), Gaps = 18/291 (6%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALL----KLQKINGELEK---IAVQELIVETLKKQE 89
            +S  +   +N E+I+  D+++R+ LL     +Q     L +    A+  L+ E L+ QE
Sbjct: 74  GISESVAAVVNDEIISTYDLAQRMRLLIATSGVQPTEQTLPQFQREALVSLVDERLQFQE 133

Query: 90  IEKS------GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           + +        I      V+      AR   ++ E F SFL  +GIG +  +Q +  Q  
Sbjct: 134 LRRVEREQKIDIVATDEEVDEEIADMARQNNMTREQFLSFLGARGIGVDTLRQQIRAQVS 193

Query: 144 WPDVVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRI 202
           W   ++  +  +    + +I A + +++      +Y I  VL  I  +++       +  
Sbjct: 194 WARWIRGRYGSRLRIGDDQIAATQARLEAAAAKPQYQISEVL--IDASRVGGMQQAMQGA 251

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPY 261
           +       +         +F++     + G A ++ + ++  + + +L++      + P 
Sbjct: 252 QQLVAQMQQGAPFPAVARQFSALPTAAAGGDAGWISQGEMPTEVEQVLEQMRPGQLSQPI 311

Query: 262 VTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAE-YVKKLRSN 311
             + GV  + + DKR  GG   +    +A       ++ EA   ++ LR  
Sbjct: 312 PVRDGVYIVYLRDKRAGGGATLVNLKQAAVPLAQGADEAEARAKLEALRPK 362



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 54/150 (36%), Gaps = 7/150 (4%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           + K          ++     +     + +          E  R ++   C  LE+ A+ +
Sbjct: 323 RDKRAGGGATLVNLKQAAVPLAQGADEAEA-----RAKLEALRPKI-TSCETLEQAAAGV 376

Query: 227 HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
             V  G       +DL P F+   +  Q    + P  T  G+  +A+C +R  G     +
Sbjct: 377 EGVVAGDLGEAEVADLAPAFRQAAETLQIGQVSEPIRTNAGLHLVAVCGRRAAGEAQVDR 436

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             +  +    ++      Y++ LR++A I 
Sbjct: 437 EQIENRLYGQQLSMIARRYMRDLRNSATIE 466


>gi|288958015|ref|YP_003448356.1| peptidyl-prolyl cis-trans isomerase [Azospirillum sp. B510]
 gi|288910323|dbj|BAI71812.1| peptidyl-prolyl cis-trans isomerase [Azospirillum sp. B510]
          Length = 485

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/251 (19%), Positives = 99/251 (39%), Gaps = 11/251 (4%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGE-------LEKIAVQELIVETLKKQEIE 91
           S  I   +N EV++  D++ RI +  L             L    ++ LI E L+ QE +
Sbjct: 53  SEGIAAVVNDEVVSVSDVNARIRMALLNAGGAANPETIQRLTPQVMRLLIDERLQMQEAK 112

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           + G+T  ++ ++    + A    ++ +     L +Q +  +  K  +     W  V++  
Sbjct: 113 RQGVTVSASEIDDAIKRIAEQNRMNNQQLQEMLKRQNVPVSTLKDQIRALLAWQKVMQRR 172

Query: 152 FMLKYGNLEMEIPANKQKMK-NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
              +    E E+ A  +++K NI   EYL+  +  ++ D+  Q+    +   +  EE + 
Sbjct: 173 IRQEVVVGEDEVDAAMERLKANIGKPEYLVAEIFLAV-DSPDQDDEVRRNAERLVEEVK- 230

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEY 269
           R         +F+      S G   ++   +L P+    L        + P  T  G   
Sbjct: 231 RGGNFAALARQFSQSAGAASGGDLGWVRSGELSPEVDKALSGMRGGQLSAPVRTATGYHI 290

Query: 270 IAICDKRDLGG 280
           + +  +R  G 
Sbjct: 291 LLVRGQRPFGS 301



 Score = 44.6 bits (104), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/161 (14%), Positives = 55/161 (34%), Gaps = 30/161 (18%)

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYL 237
             ++ ++  I     +++   ++  + AE+ R +  K C   +  A +      G    +
Sbjct: 329 VNMKQIILPI-----ESKEQAKEVKEQAEKLR-KSIKSCGDFQARAKETGMPESGDMGTM 382

Query: 238 LESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLG----------------- 279
              D+ P  QNL L       +   ++      + +C KRD+                  
Sbjct: 383 RVKDMAPGLQNLALGIPLGQASPVLMSPAAAVILIVC-KRDVPMIQPPPEAQPAPPPPAP 441

Query: 280 -----GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                 ++  +  +  +    + E     Y++ LR +A + 
Sbjct: 442 TPIQEAKLPGRDEIERELVNERSELLSRRYLRDLRRSAFVE 482


>gi|121956444|sp|Q4ZMG7|SURA_PSEU2 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 99/276 (35%), Gaps = 12/276 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++               L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEALQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI      +N      A+   +S E F + L   G+  N  ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVEQFRAALAHDGLSYNDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + I   V +     +    + E+         K     E+ +  +L + PD+   +
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKAQLSEEFHLANILIATPDSASSD 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKS 253
                         +L+   D  +L   +S   +    G   +   + L P F ++L   
Sbjct: 184 AIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMGWRKAAQLPPPFGDMLSSM 243

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
              + T P  T  G   + + +KR   G+  ++  +
Sbjct: 244 PVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 279



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 41/315 (13%), Positives = 97/315 (30%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 108 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDMGKAQLS-E 165

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 166 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATSSSSENALEGGDMG 225

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 226 WRKAAQLPPPFGDMLSSMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 285

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+      R+   +D  +L K  S+    +   G   ++  + L
Sbjct: 286 IKPSEIRNEEE---TKRLAQKIYDRIENGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 342

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ TQ G   + +  +R     + A +          K ++ 
Sbjct: 343 VPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 402

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 403 LQTWLRQIRDEAYVE 417


>gi|83591773|ref|YP_425525.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodospirillum
           rubrum ATCC 11170]
 gi|83574687|gb|ABC21238.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 444

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/314 (17%), Positives = 120/314 (38%), Gaps = 12/314 (3%)

Query: 8   SLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ- 66
           +L   + +    +V ++ C  P+ + ++   + RI   +N + ++  D++ RI ++    
Sbjct: 26  ALGRLLGIALLAWVAVLGCGWPVHTAQAAVPTQRIAAVVNEDAVSLYDLNARIDIVMATG 85

Query: 67  ------KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                 ++   L    ++ LI ETLK QE +++ +T  +  +N    +  R   L     
Sbjct: 86  GMPNSPEVRQRLAPQILRALIDETLKIQEAKRANVTVSTEDINGGIERLERQNKLPPGGL 145

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-NITVREYL 179
                  G+        +  +  W   V++    +    E EI   +Q ++ N+   EYL
Sbjct: 146 EKAFKAAGLDQQSLIHQIRAELGWIKAVQSTLGPRVNVSEDEISLYQQNLQRNLGKPEYL 205

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLE 239
           +  +   + DN  Q+   +    +  E+ RL         ++F+        G   ++  
Sbjct: 206 VADIFLPV-DNAAQDAEVLTAAQRMIEQMRL-GANFAALAQQFSRGPAAQRGGDLGWVGP 263

Query: 240 SDL-HPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIE 298
            ++     Q L   +  N + P  T  G   + + D+R   G  +    +S    P +  
Sbjct: 264 GEIDAEVLQALGAMAPGNLSQPIRTFGGYHILLLRDQRIASGGASSLLKMSRIVIPLRGP 323

Query: 299 KH-EAEYVKKLRSN 311
           +    E +  LR  
Sbjct: 324 RMPTPERLADLRQR 337



 Score = 52.3 bits (124), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 53/152 (34%), Gaps = 9/152 (5%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
            +++           +  ++  +   ++        R+ D  + R+   + C   +  A 
Sbjct: 298 RDQRIASGGASSLLKMSRIVIPLRGPRMPTPE----RLADLRQ-RIAATRSCEAFDALAG 352

Query: 225 KIHDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           ++   S G    +  + L  + QN++        + P         + ICD+    G + 
Sbjct: 353 EVGPPS-GSMGSIDPARLPAEAQNVIRDLPAGQPSTPLTMDNAEIRLMICDR--PTGGLP 409

Query: 284 LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +  L  +    K++      ++ LR  AII 
Sbjct: 410 GRDILRERLIEQKLQNLAQRRLRDLRQQAIID 441


>gi|167031450|ref|YP_001666681.1| SurA domain-containing protein [Pseudomonas putida GB-1]
 gi|166857938|gb|ABY96345.1| SurA domain [Pseudomonas putida GB-1]
          Length = 441

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/268 (18%), Positives = 98/268 (36%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           VL+   ++    + +     R+   ++ +V+    + +R+  ++             G L
Sbjct: 14  VLLGAALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTGAL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L   G+  +
Sbjct: 74  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALAHDGLSFD 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+    N    K     EY +  +L   P+ 
Sbjct: 134 DAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLNSDMGKMQMSEEYRLANILIPTPEA 193

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNL 249
              +      R       +LR   D  ++    S   +    G+  +     L P F  +
Sbjct: 194 ANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKM 253

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           L        T P     G   + + +KR
Sbjct: 254 LSSMPVGEITQPIRIPNGFIILKLEEKR 281



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 98/301 (32%), Gaps = 60/301 (19%)

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS-------------- 116
           +  +   +E+I+  ++++ + +  I      V  F         +S              
Sbjct: 134 DAREQVKREMIISRVRQRRVAER-IQVSEQEVKNFLNSDMGKMQMSEEYRLANILIPTPE 192

Query: 117 ---AEDFSSFLDKQGIGDNHFKQ-----YLA------------IQSIWPDV--------- 147
              ++D      K G      +Q      +A             +  W            
Sbjct: 193 AANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAK 252

Query: 148 ---------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFV 198
                    +     +  G + +++   +   +N+   E  +R +L    +         
Sbjct: 253 MLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSE---IRSEAA 309

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-N 255
            +++ +    R++  +D  +L K  S+    +   G   ++  + L P+F+  +  +Q  
Sbjct: 310 TEQLAERLYDRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQG 369

Query: 256 NTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAII 314
             T P+ TQ G   + +  +R     E A +    +     K ++    +++++R  A +
Sbjct: 370 VVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQTWLRQIRDEAYV 429

Query: 315 H 315
            
Sbjct: 430 E 430


>gi|254294289|ref|YP_003060312.1| SurA domain protein [Hirschia baltica ATCC 49814]
 gi|254042820|gb|ACT59615.1| SurA domain protein [Hirschia baltica ATCC 49814]
          Length = 426

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 105/279 (37%), Gaps = 11/279 (3%)

Query: 33  YKSWAMSSRIRTTINGEVITDGDISKRIAL----LKLQKINGELEKI---AVQELIVETL 85
                        +N + I+  D+ +R       L +Q     + +    A++ LI E L
Sbjct: 36  VPQIEAVEGTVAIVNDQPISYSDVRQRAQFILVSLGVQPNAETIRQAQTRAIEGLIDEKL 95

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + QE E   +  +   ++      A  +  + EDF   L + G+     +  +     W 
Sbjct: 96  QLQEAETYELVVEEAEIDDSIANIAARSNATPEDFLQGLAQVGLSPRTLRDQIRADIAWR 155

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKM-KNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
            +V   F  +     ++I  N +++ K++   +Y I  + F     + +     Q   + 
Sbjct: 156 RLVGGRFGSRVRISSLQIDDNLERLNKSMEEPQYRIAEI-FLPGITQEEISVVYQGAEEL 214

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
             +   +         +F++     + G+  +L ES L  ++ + ++  S+   T+P VT
Sbjct: 215 KRQIENQAAPFEAVARQFSAAPTASAGGEIGWLGESQLKKEYADQVRALSKPGLTDPIVT 274

Query: 264 QKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA 302
             GV  +++ +K     E AL  +   Q   T  +    
Sbjct: 275 DNGVYLVSLMNK-QAPVEEALVGFKLKQIYATGADAVSK 312


>gi|122070657|sp|Q48NT5|SURA_PSE14 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score =  149 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 100/276 (36%), Gaps = 12/276 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++               L+   
Sbjct: 4   ALLLSGAVHAAVQPLESVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEALQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    N +N      A+   +S E F + L   G+  N  ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDNELNQAIGTIAQRNNMSVEQFRAALAHDGLSYNDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + I   V +     +    + E+       + K     E+ +  +L + PD+   +
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKS 253
                         +L+   D  +L    S   +    G   +   + L P F ++L   
Sbjct: 184 AIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSAM 243

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
              + T P  T  G   + + +KR   G+  ++  +
Sbjct: 244 PVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 279



 Score = 76.6 bits (187), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 108 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 165

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 166 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 225

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 226 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 285

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 286 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 342

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 343 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 402

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 403 LQTWLRQIRDEAYVE 417


>gi|298485302|ref|ZP_07003394.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160152|gb|EFI01181.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 428

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 100/276 (36%), Gaps = 12/276 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIA 76
             ++    + +      +   ++ +VI    + +R+  ++               L+   
Sbjct: 4   ALLLSGAVHAAVQPLDSVVAIVDNDVIMKSQMDQRVREVQQTIAKRGSGVPPAEALQPQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           +  LI+E L+ Q  E+SGI    + +N      A+   +S E F + L   G+  N  ++
Sbjct: 64  LDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVEQFRAALAHDGLSYNDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + I   V +     +    + E+       + K     E+ +  +L + PD+   +
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKAQLSEEFHLANILIATPDSASSD 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKS 253
                         +L+   D  +L    S   +    G   +   + L P F ++L   
Sbjct: 184 AIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMGWRKAAQLPPPFGDMLSAM 243

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
              + T P  T  G   + + +KR   G+  ++  +
Sbjct: 244 PVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEV 279



 Score = 76.6 bits (187), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 98/315 (31%), Gaps = 63/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 108 RAALAHDGLSYNDAREQVRREMIISRVRQRRVAER-IQVSQQEVKNFLASDQGKAQLS-E 165

Query: 119 DF--------------SSFLDKQGIGDNHFKQYLA---------------------IQSI 143
           +F              S  +    +        L                          
Sbjct: 166 EFHLANILIATPDSASSDAIQAAAVKAKGIYDQLKKGADFTRLAATTSSSENALEGGDMG 225

Query: 144 WPDVVK-----NDFMLKYGNLEMEIPAN--------------KQKMKNITVREYLIRTVL 184
           W    +      D +      ++  PA                 + +     E  +R +L
Sbjct: 226 WRKAAQLPPPFGDMLSAMPVGDVTPPARTPGGFIILKLLEKRGGQGQAQMRDEVHVRHIL 285

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
               + + + +    KR+ +    R++  +D  +L K  S+    +   G   ++  + L
Sbjct: 286 IKPSEIRNEEE---TKRLAEKIYDRIQNGEDFAELAKSFSEDPGSALNGGDLNWVDPNSL 342

Query: 243 HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKH 300
            P+F+ ++ ++     + P+ T  G   + +  +R     + A +          K ++ 
Sbjct: 343 VPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNRKYDEE 402

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 403 LQTWLRQIRDEAYVE 417


>gi|70732935|ref|YP_262706.1| survival protein SurA [Pseudomonas fluorescens Pf-5]
 gi|68347234|gb|AAY94840.1| survival protein SurA [Pseudomonas fluorescens Pf-5]
          Length = 440

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 57/322 (17%), Positives = 116/322 (36%), Gaps = 20/322 (6%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           V T LSD ++ L    +      +   +  +     ++   ++ +V+    + +R+  ++
Sbjct: 3   VKTKLSDCLRPLMLGAL-----FLSTAASAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQ 57

Query: 65  --LQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
             + K  G       LE+  ++ LIVE L+ Q  E+SGI      +N      A+   +S
Sbjct: 58  QTIAKRGGGVPPTSVLEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNSMS 117

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNIT 174
            E F + L   G+     +  +  + I   V +     +    E E+         K   
Sbjct: 118 IEQFRAALAHDGLSYEDARDQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQL 177

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGK 233
             E  +  +L   P++          R       +L+   D  +L    +   + +  G 
Sbjct: 178 SEELHLANILIPTPESANSEAIQSAARQAMEVYQQLKQGADFAQLAIARSGSDNALEGGD 237

Query: 234 AQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLS 289
             +   + L P F + L   +  + T P  T  G   + + DKR  G    +     ++ 
Sbjct: 238 MGWRKAAQLPPPFDRELSAMAVGDITQPARTPGGFIILKLLDKRGGGNQVRDEVHVRHIL 297

Query: 290 AQNTPTKIEKHEAEYVKKLRSN 311
            + +  + E+      +KL   
Sbjct: 298 IKPSEIRSEEETKRLAQKLYDR 319



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 99/316 (31%), Gaps = 60/316 (18%)

Query: 56  ISK-RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114
           I + R AL        +      +E+I+  ++++ + +  I      V  F         
Sbjct: 118 IEQFRAALAHDGLSYEDARDQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDLGKMQ 176

Query: 115 LSAE-DFSSFL----------------DKQGIGDNHFKQ-----YLA------------I 140
           LS E   ++ L                 +        KQ      LA             
Sbjct: 177 LSEELHLANILIPTPESANSEAIQSAARQAMEVYQQLKQGADFAQLAIARSGSDNALEGG 236

Query: 141 QSIWPDVVK-----NDFMLKYGNLEMEIPAN------------KQKMKNITVREYLIRTV 183
              W    +     +  +      ++  PA             K+   N    E  +R +
Sbjct: 237 DMGWRKAAQLPPPFDRELSAMAVGDITQPARTPGGFIILKLLDKRGGGNQVRDEVHVRHI 296

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESD 241
           L    + + + +    KR+      R+   +D  +L K  S+    +   G   ++  + 
Sbjct: 297 LIKPSEIRSEEE---TKRLAQKLYDRIEAGEDFAELAKSYSEDPGSALNGGDLNWIDPNA 353

Query: 242 LHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-NTPTKIEK 299
           L P+F+ ++ K+     + P+ +  G   + +  +R        +   +       K ++
Sbjct: 354 LVPEFREVMAKTPQGQLSKPFKSPYGWHVLEVLGRRATDSTSQAREQQAMTVLRNRKYDE 413

Query: 300 HEAEYVKKLRSNAIIH 315
               +++++R  A + 
Sbjct: 414 ELQTWLRQIRDEAYVE 429


>gi|253995959|ref|YP_003048023.1| SurA domain-containing protein [Methylotenera mobilis JLW8]
 gi|253982638|gb|ACT47496.1| SurA domain protein [Methylotenera mobilis JLW8]
          Length = 434

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 107/310 (34%), Gaps = 16/310 (5%)

Query: 18  TYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN-------- 69
           + F+ + F  +  ++        RI   ++  VIT+ ++  RI  L  Q           
Sbjct: 9   SLFIALSFSQLNCLAAADVTKMDRIVAIVDQSVITEQELESRIVSLSAQLKKQGTELPEA 68

Query: 70  GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGI 129
             L K  ++ LI + L+ Q   ++GI  D   ++    + A    ++  +F   L++ GI
Sbjct: 69  SILRKQILERLISDALQLQYAAQTGIKVDDMQLDKTIERIAEQNKMTVREFYDALNQDGI 128

Query: 130 GDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSI 187
               F+  +  +     + + +   +    E EI      Q   N    EY I  +L  +
Sbjct: 129 SVRKFRSDIRNEITIARLREREVESRVNVSESEIDNYLTTQASTNQNQDEYEISHILIRV 188

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF 246
           P++         K   D   + L       K+    S   +    G   +   + +   F
Sbjct: 189 PEDAATEDVQKAKTKVDEIFAALASGTSFAKVSASFSDAPNALEGGNIGWKQGAQMPALF 248

Query: 247 QNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG----EIALKAYLSAQNTPTKIEKHE 301
            + LK  Q    +    +  G   + + DKR        E     ++  + +    EK  
Sbjct: 249 LDALKAMQKGEVSAALRSPNGFHILKLTDKRGGSSPLIIEQTHARHILIKLSEVMSEKDA 308

Query: 302 AEYVKKLRSN 311
              +  ++  
Sbjct: 309 KTKMDGIKER 318



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 92/298 (30%), Gaps = 41/298 (13%)

Query: 54  GDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSG----------ITFDSNT-- 101
            DI   I + +L++   E      +  I   L  Q                I    +   
Sbjct: 135 SDIRNEITIARLREREVESRVNVSESEIDNYLTTQASTNQNQDEYEISHILIRVPEDAAT 194

Query: 102 ---------VNYFFVQHARNTGL-----SAEDFSSFLDKQGIG-------DNHFKQYLAI 140
                    V+  F   A  T       S  D  + L+   IG          F   L  
Sbjct: 195 EDVQKAKTKVDEIFAALASGTSFAKVSASFSDAPNALEGGNIGWKQGAQMPALFLDALKA 254

Query: 141 QSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
             +    V        G   +++   +     + + +   R +L  + +   +      K
Sbjct: 255 --MQKGEVSAALRSPNGFHILKLTDKRGGSSPLIIEQTHARHILIKLSEVMSEKDA---K 309

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKK-SQNNTT 258
              D  + RL   +    L +  S+    S  G   ++   D  PQF+  +     N  +
Sbjct: 310 TKMDGIKERLDNGEKFEVLARQFSEDGTASNGGDLGWVNPGDTVPQFEKAMNSLQPNEIS 369

Query: 259 NPYVTQKGVEYIAICD-KRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            P ++  G   I + + K+    + A +     +    K ++   +++++LR  A + 
Sbjct: 370 APVLSPFGWHVIQVLERKKQDMSKEAARLKARQEIRARKADEAYQDWIRELRDRAFVE 427


>gi|114328860|ref|YP_746017.1| peptidyl-prolyl cis-trans isomerase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317034|gb|ABI63094.1| peptidyl-prolyl cis-trans isomerase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 468

 Score =  149 bits (375), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 101/262 (38%), Gaps = 13/262 (4%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQ-------KINGELEKIAVQELIVETLKKQEIE 91
            + I   +NG+VI+ GD+  R  L  +        ++   L    +++L+ E L+ QEI+
Sbjct: 69  ETSIVAVVNGDVISKGDVDARRRLFAMSTGLPMSKEVLDRLTPQVLRQLVDEKLRLQEIQ 128

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           + GI    + + +      +  G+  +     L   G+        + +Q  W  V++  
Sbjct: 129 RRGIVITDSDIAHSIQGMEQRNGMQPDALRHKLAADGVSMRTLIDQIRVQLGWTRVLRQQ 188

Query: 152 FMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
              +    + EI   ++ + +     EY +  +   + D    ++        D    +L
Sbjct: 189 LGERVRISDKEIQDEEELLASQKGQTEYRVSEIFIPVDD---PSRAQAAHDFADTVIQQL 245

Query: 211 RLPKDC-NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVE 268
           R          +F+     +  G   ++  + L PQ  ++LK+      +NP     G+E
Sbjct: 246 RSGAPFPVVAAQFSQSQTALEGGDLGWVQPNQLDPQVVSVLKEMPPGAISNPIDVAGGIE 305

Query: 269 YIAICDKRDLGGEIALKAYLSA 290
            +A+  KR +G +      +  
Sbjct: 306 IVALRGKRIIGNDQGTALSIRQ 327



 Score = 51.2 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 53/336 (15%), Positives = 101/336 (30%), Gaps = 71/336 (21%)

Query: 48  GEVITDGDISKRIALLKLQ--------KINGELEKIAVQELIVET---------LKKQEI 90
           G VITD DI+  I  ++ +        +     + ++++ LI +          L++Q  
Sbjct: 131 GIVITDSDIAHSIQGMEQRNGMQPDALRHKLAADGVSMRTLIDQIRVQLGWTRVLRQQLG 190

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL---------DKQGIGDNHFKQYLAIQ 141
           E+  +      +       A   G +    S                   +   Q L   
Sbjct: 191 ER--VRISDKEIQDEEELLASQKGQTEYRVSEIFIPVDDPSRAQAAHDFADTVIQQLRSG 248

Query: 142 SIWPDVVKNDFMLK---------------------------------------YGNLEME 162
           + +P VV   F                                           G +E+ 
Sbjct: 249 APFP-VVAAQFSQSQTALEGGDLGWVQPNQLDPQVVSVLKEMPPGAISNPIDVAGGIEIV 307

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIK-DAEESRLRLPKDCNKLEK 221
               K+ + N       IR V +             Q+R   +  ++      DC  +E 
Sbjct: 308 ALRGKRIIGNDQGTALSIRQVFYPFTTPLNPAAPTDQQRKTLEHAKAAAAAMHDCAAVEA 367

Query: 222 FASKIHDVSIGKAQYLLESDL-HPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            +  +          L    +  PQF+ LL        + P V+Q G+  + +C +    
Sbjct: 368 ASKAMGGSRPSDPGELRLESINPPQFRALLASLPVGQPSQPIVSQDGIAIMMVCSRTQKN 427

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             +  K  +S Q    ++E    +  ++LR  A+I 
Sbjct: 428 FGLPGKEDISNQILGERVETASRQLQRELRRRALID 463


>gi|62178657|ref|YP_215074.1| peptidyl-prolyl cis-trans isomerase SurA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|75505914|sp|Q57TG8|SURA_SALCH RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|62126290|gb|AAX63993.1| peptidyl-prolyl cis-trans isomerase, survival protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
          Length = 428

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 46/268 (17%), Positives = 101/268 (37%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +L+   ++   S+ +  +  ++   +N  V+ + D+   +  +KL              L
Sbjct: 7   LLLGIAMIANTSFAAPQVVDKVAAIVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G+      ++      A+   ++ +   S L   G+  +
Sbjct: 67  RHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMDQMRSRLAYDGLNYS 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQ-KMKNITVREYLIRTVLFSIPDN 190
            ++  +  + I  +V  N+   +   L  E+ A  KQ   +N    E  +R +L ++P+N
Sbjct: 127 TYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQNDASTELNLRHILIALPEN 186

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQNL 249
               Q    +R  ++     R   D  KL    S        G+  +    +L   F   
Sbjct: 187 PTSEQVNDAQRQAESIVEEARNGADFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQA 246

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKR 276
           L    + +   P  +  G   + + D R
Sbjct: 247 LSTAKKGDIVGPIRSGVGFHILKVNDLR 274



 Score = 77.0 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/337 (13%), Positives = 99/337 (29%), Gaps = 75/337 (22%)

Query: 48  GEVITDGDISKRIALLKLQKIN----------------GELEKIAVQELIVETLKKQEIE 91
           G  ITD  + + IA +  Q                           +E+I+  ++  E+ 
Sbjct: 88  GVKITDEQLDQAIANIAKQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVR 147

Query: 92  KSGITFDSNTVNYFFVQHARNT-----------------GLSAEDFSSFLDKQ------- 127
           +  IT     V+    Q                        ++E  +    +        
Sbjct: 148 RR-ITVLPQEVDALAKQIGTQNDASTELNLRHILIALPENPTSEQVNDAQRQAESIVEEA 206

Query: 128 ---------GIGDNHFKQYLAI-QSIWPDV------------------VKNDFMLKYGNL 159
                     I  +  +Q L   Q  W  +                  +        G  
Sbjct: 207 RNGADFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFH 266

Query: 160 EMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKL 219
            +++   + + ++I+V E   R +L     + + N    + ++++               
Sbjct: 267 ILKVNDLRGQSQSISVTEVHARHILLK--PSPIMNDQQARLKLEEIAADIKSGKTTFAAA 324

Query: 220 EKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR 276
            K  S+    +   G   +       P F++ L K  +   + P  +  G   I + D R
Sbjct: 325 AKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTR 384

Query: 277 DLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
            +    A +   + +     K  +  A ++++ R++A
Sbjct: 385 KVDKTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASA 421


>gi|325276043|ref|ZP_08141858.1| SurA domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324098828|gb|EGB96859.1| SurA domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 428

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/268 (17%), Positives = 99/268 (36%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +L+   ++    + +     R+   ++ +V+    + +R+  ++             G L
Sbjct: 1   MLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGSVPPAGAL 60

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L   G+  +
Sbjct: 61  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALAHDGLSFD 120

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             +  +  + I   V +     +    E E+    N    K     EY +  +L   P+ 
Sbjct: 121 DARDQVKREMIISRVRQRRVAERIQVSEQEVKNFLNSDMGKMQMSEEYRLANILIPTPEA 180

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNL 249
                     R       +L+   D  +L    ++  + +  G+  +   + L P F  +
Sbjct: 181 ANSADIQKAARQVGEVYQQLKQGADFGQLAIARSASENALEGGEMGWRKAAQLPPDFAKM 240

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           L        T P     G   + + +KR
Sbjct: 241 LSSMPVGEITQPIRIPNGFIILKLEEKR 268



 Score = 72.8 bits (177), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 95/290 (32%), Gaps = 33/290 (11%)

Query: 56  ISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT----FDSNTVNYF-FVQHA 110
           I  R+   ++ +     E+     L  +  K Q  E+  +           N     + A
Sbjct: 131 IISRVRQRRVAERIQVSEQEVKNFLNSDMGKMQMSEEYRLANILIPTPEAANSADIQKAA 190

Query: 111 RNTGLSAEDFSSF--LDKQGIGDNHFKQYLAI-QSIWPDVVK-----NDFMLKYGNLE-- 160
           R  G   +         +  I  +  +  L   +  W    +        +      E  
Sbjct: 191 RQVGEVYQQLKQGADFGQLAIARSASENALEGGEMGWRKAAQLPPDFAKMLSSMPVGEIT 250

Query: 161 -----------MEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
                      +++   +   +N+   E  +R +L    +          +++ +    R
Sbjct: 251 QPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIKPSE---IRSDAATEQLAERLYER 307

Query: 210 LRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKG 266
           ++  +D  +L K  S+    +   G   ++  + L P+F+  +  +Q    T P+ TQ G
Sbjct: 308 IKNGEDFAELAKSYSEDPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYG 367

Query: 267 VEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              + +  +R     E A +          K ++    +++++R  A + 
Sbjct: 368 WHVLEVLGRRATDSTEQAREQQALNVLRNRKYDEELQTWLRQIRDEAYVE 417


>gi|154253778|ref|YP_001414602.1| SurA domain-containing protein [Parvibaculum lavamentivorans DS-1]
 gi|154157728|gb|ABS64945.1| SurA domain [Parvibaculum lavamentivorans DS-1]
          Length = 443

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/285 (15%), Positives = 108/285 (37%), Gaps = 14/285 (4%)

Query: 17  TTYFVLIIFCIVP---IVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ------- 66
           T +  L    + P    ++  + + +  I   +N  +I+  D+ +R+ L+ L        
Sbjct: 25  TAFIFLAGLAVTPADMPLAQNAPSNTQGIAAVVNDRIISSYDLDQRVKLVMLSSGIPDTP 84

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
           +    +    ++ L+ E L++QE  +  I      ++    + A+   +S +   +FL  
Sbjct: 85  ENISRIRGQVLRSLVDEYLQQQEAARLNIEVQQEEIDSALQRIAQRANMSVDQIEAFLKD 144

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT-VREYLIRTVLF 185
            G+     +  +     W  V++  F       ++EI    ++++  +    YL+  +L 
Sbjct: 145 GGVSRAALEAQIRSDIAWNRVIQQQFGPSVTVGDVEIDEVLRRLEEESDQPRYLVSEILI 204

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           +  D+    +       +  E+ R   P +     +F+      + G+  ++  S L   
Sbjct: 205 TF-DSPQHAEEIAGGAQRLVEQIRQGAPFE-AVAHQFSQSASAANGGEIGWVHASQLPEG 262

Query: 246 FQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS 289
             +++ K      ++P  T  G   + +   +   G   ++   S
Sbjct: 263 VGSVVAKMQPGMVSDPIRTLNGFYIMQLKAMQTGSGADPMRDQYS 307



 Score = 66.2 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 52/136 (38%), Gaps = 4/136 (2%)

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
                   +    +Y +  VL   P         V +R ++AEE R R    C+   +  
Sbjct: 292 AMQTGSGADPMRDQYSLMQVLL--PLTPDAEPQAVSRRAREAEEFR-RQTNSCDDAARNI 348

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEI 282
           +K    +    + ++   L P+ +  L      NTT P  +++G+E + +C  +   GE 
Sbjct: 349 TKYLSGAASPKRDVIAGQLDPRLRQALSGLKAGNTTAPIRSERGIEMVVVCGHKAAEGER 408

Query: 283 ALKAYLSAQNTPTKIE 298
             +  + +     ++ 
Sbjct: 409 PTREQIDSSLYEQQLS 424


>gi|26987145|ref|NP_742570.1| survival protein SurA [Pseudomonas putida KT2440]
 gi|24981777|gb|AAN66034.1|AE016232_7 survival protein SurA [Pseudomonas putida KT2440]
          Length = 439

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/268 (18%), Positives = 100/268 (37%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--LQKING------EL 72
           VL+   ++    + +     R+   ++ +V+    + +R+  ++  + K  G       L
Sbjct: 12  VLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+  +
Sbjct: 72  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFD 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+         K     EY +  +L   P+ 
Sbjct: 132 DAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQMSEEYRLANILIPTPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNL 249
              +      R       +LR   D  ++    S   +    G+  +     L P F  +
Sbjct: 192 ANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           L        T P     G   + + +KR
Sbjct: 252 LSSMPVGEITQPIRIPNGFIILKLEEKR 279



 Score = 73.5 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 102/313 (32%), Gaps = 60/313 (19%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS-- 116
           R AL +      +  +   +E+I+  ++++ + +  I      V  F         +S  
Sbjct: 120 RAALARDGLSFDDAREQVKREMIISRVRQRRVAER-IQVSEQEVKNFLASDLGKMQMSEE 178

Query: 117 ---------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------IQSIW 144
                          ++D      K G      +Q      +A             +  W
Sbjct: 179 YRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGW 238

Query: 145 PDV------------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
                                +     +  G + +++   +   +N+   E  +R +L  
Sbjct: 239 RKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIK 298

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHP 244
             +          +++ +    R++  +D  +L K  S+    +   G   ++  + L P
Sbjct: 299 PSE---IRSEAATEQLAERLYDRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVP 355

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEA 302
           +F+  +  +Q    T P+ TQ G   + +  +R     E A +    +     K ++   
Sbjct: 356 EFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQ 415

Query: 303 EYVKKLRSNAIIH 315
            +++++R  A + 
Sbjct: 416 TWLRQIRDEAYVE 428


>gi|90020386|ref|YP_526213.1| L-ribulokinase [Saccharophagus degradans 2-40]
 gi|121956457|sp|Q21MS8|SURA_SACD2 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|89949986|gb|ABD80001.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Saccharophagus
           degradans 2-40]
          Length = 430

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 44/315 (13%), Positives = 106/315 (33%), Gaps = 15/315 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
            IK     F  I F      +        R+   ++   IT  ++  R+  ++++     
Sbjct: 3   IIKTTIATFTAIAFTGAASFTSAEVVPLDRVVAVVDNRAITQTELDSRVQDVQVRSQAAG 62

Query: 72  LE--------KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
           +         K  + +LI ETL+ +  ++ G+      VN       +N  ++ + F   
Sbjct: 63  MRLPEADILNKQIIDQLISETLQLEMADRYGVQVSDQEVNASIGNIIQNAQMTEQQFVQQ 122

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIR 181
           L  +G+  N F+  +  Q     + +     +    E E+         +     +Y + 
Sbjct: 123 LASEGVSINEFRASIRRQLTMRSITEGLVSRRIRISEQEVDNFLKSADAQFWVSPDYHLG 182

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLES 240
            +L ++P +         +   +A   +L+   +  +     ++    +  G   +   +
Sbjct: 183 HILVALPSSPSSEAIVEAEEKANALYEKLKAGANFAEVAIAESNGPSALQGGDLGWRKSA 242

Query: 241 DLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAI---CDKRDLGGEIALKAYLSAQNTPTK 296
           +L   F  LL   +  + T P  +Q G   I +      +          ++  + +   
Sbjct: 243 ELPTLFAELLPSLNNGDVTKPTRSQAGFHIIKLYESRGGQKQIVNQTRARHILVKTSEIL 302

Query: 297 IEKHEAEYVKKLRSN 311
            +      +K +R  
Sbjct: 303 NDAKAEAKLKDIRQQ 317



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 60/154 (38%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
             +  +   V +   R +L  +  +++ N    + ++KD  +  L    D  +L K  S+
Sbjct: 277 ESRGGQKQIVNQTRARHIL--VKTSEILNDAKAEAKLKDIRQQILD-GADFAELAKTHSE 333

Query: 226 IHDV--SIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLG-GE 281
                 S G   +       P F+  + +  +   + P+ ++ G   + + ++R+    +
Sbjct: 334 DIGSRMSGGDLGWATPGTFVPAFEKTMAETKEGEISQPFKSRFGWHIMKVEERREEDMTQ 393

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            AL+          + E     ++++LR  A I 
Sbjct: 394 EALRQKARNMIMSRRFEDETQIWLQELRDEAFID 427


>gi|148545689|ref|YP_001265791.1| SurA domain-containing protein [Pseudomonas putida F1]
 gi|148509747|gb|ABQ76607.1| SurA N-terminal domain [Pseudomonas putida F1]
          Length = 439

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/268 (18%), Positives = 100/268 (37%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--LQKING------EL 72
           VL+   ++    + +     R+   ++ +V+    + +R+  ++  + K  G       L
Sbjct: 12  VLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+  +
Sbjct: 72  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFD 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+         K     EY +  +L   P+ 
Sbjct: 132 DAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQMSEEYRLANILIPTPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNL 249
              +      R       +LR   D  ++    S   +    G+  +     L P F  +
Sbjct: 192 ANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           L        T P     G   + + +KR
Sbjct: 252 LSSMPVGEITQPIRIPNGFIILKLEEKR 279



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 102/313 (32%), Gaps = 60/313 (19%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS-- 116
           R AL +      +  +   +E+I+  ++++ + +  I      V  F         +S  
Sbjct: 120 RAALARDGLSFDDAREQVKREMIISRVRQRRVAER-IQVSEQEVKNFLASDLGKMQMSEE 178

Query: 117 ---------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------IQSIW 144
                          ++D      K G      +Q      +A             +  W
Sbjct: 179 YRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGW 238

Query: 145 PDV------------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
                                +     +  G + +++   +   +N+   E  +R +L  
Sbjct: 239 RKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIK 298

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHP 244
             +          +++ +    R++  +D  +L K  S+    +   G   ++  + L P
Sbjct: 299 PSE---IRSEAATQQLAERLYDRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVP 355

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEA 302
           +F+  +  +Q    T P+ TQ G   + +  +R     E A +    +     K ++   
Sbjct: 356 EFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQ 415

Query: 303 EYVKKLRSNAIIH 315
            +++++R  A + 
Sbjct: 416 TWLRQIRDEAYVE 428


>gi|313496769|gb|ADR58135.1| Chaperone surA [Pseudomonas putida BIRD-1]
          Length = 439

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/268 (18%), Positives = 99/268 (36%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--LQKING------EL 72
           VL+   ++    + +     R+   ++ +V+    + +R+  ++  + K  G       L
Sbjct: 12  VLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+   
Sbjct: 72  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFE 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+         K     EY +  +L   P+ 
Sbjct: 132 DAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQMSEEYRLANILIPTPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNL 249
              +      R       +LR   D  ++    S   +    G+  +     L P F  +
Sbjct: 192 ANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           L        T P     G   + + +KR
Sbjct: 252 LSSMPVGEITQPIRIPNGFIILKLEEKR 279



 Score = 75.5 bits (184), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 101/313 (32%), Gaps = 60/313 (19%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS-- 116
           R AL +      +  +   +E+I+  ++++ + +  I      V  F         +S  
Sbjct: 120 RAALARDGLSFEDAREQVKREMIISRVRQRRVAER-IQVSEQEVKNFLASDLGKMQMSEE 178

Query: 117 ---------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------IQSIW 144
                          ++D      K G      +Q      +A             +  W
Sbjct: 179 YRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGW 238

Query: 145 PDV------------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
                                +     +  G + +++   +   +N+   E  +R +L  
Sbjct: 239 RKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIK 298

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHP 244
             +          +++ +    R++  +D  +L K  S+    +   G   ++  + L P
Sbjct: 299 PSE---IRSEAATQQLAERLYDRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVP 355

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEA 302
           +F+  +  +Q    T P+ TQ G   + +  +R     E A +          K ++   
Sbjct: 356 EFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQALGVLRNRKYDEELQ 415

Query: 303 EYVKKLRSNAIIH 315
            +++++R  A + 
Sbjct: 416 TWLRQIRDEAYVE 428


>gi|77461354|ref|YP_350861.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           fluorescens Pf0-1]
 gi|121956432|sp|Q3K5T4|SURA_PSEPF RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|77385357|gb|ABA76870.1| putative chaperone [Pseudomonas fluorescens Pf0-1]
          Length = 426

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 47/299 (15%), Positives = 104/299 (34%), Gaps = 15/299 (5%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIA 76
              +   +  +     R+   ++ +V+    + +R+  ++             G L++  
Sbjct: 4   ALFLGTAANAAVQSIDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGLPPPGVLDQQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LIVE L+ Q  E+SGI      +N      A+   ++ E F   L + G+     ++
Sbjct: 64  LERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNNMTPEQFRIALSRDGLSYEDARE 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + +   V +     +    E E+         K     E  +  +L   P++    
Sbjct: 124 QIRREMVISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPESANSE 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF-QNLLKK 252
                 R       +L+   D  ++    S   +    G   +   + L P F + L   
Sbjct: 184 AIQSAARKAMEVYQQLKQGADFGQMAVANSASDNALEGGDMGWRKAAQLPPPFDRELSSM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKL 308
           +  + T P  T  G   + + +KR       +     ++  + +P + E    E  + L
Sbjct: 244 ATGDITQPARTPGGFIILKLLEKRGGESQMRDEVHVRHILVKPSPVRDEAKTKELAQSL 302



 Score = 72.8 bits (177), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 41/289 (14%), Positives = 92/289 (31%), Gaps = 38/289 (13%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGIT----FDSNTVNYFFVQHARNTG 114
           R+   ++ +     E+     L  +  K Q  E+  +         + N   +Q A    
Sbjct: 133 RVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPESANSEAIQSAARKA 192

Query: 115 LSAED-------FSSFLDKQGIGDNHFKQYLAIQSIWPDVVK-----NDFMLKYGNLEME 162
           +           F          DN  +        W    +     +  +      ++ 
Sbjct: 193 MEVYQQLKQGADFGQMAVANSASDNALEG---GDMGWRKAAQLPPPFDRELSSMATGDIT 249

Query: 163 IPA------------NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
            PA             K+  ++    E  +R +L               K +  +  +R+
Sbjct: 250 QPARTPGGFIILKLLEKRGGESQMRDEVHVRHILVKP---SPVRDEAKTKELAQSLYNRI 306

Query: 211 RLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGV 267
              +D  +L K  S+    +   G   ++  + L P+F+ ++ KS     + P+ TQ G 
Sbjct: 307 EAGEDFAELAKKYSEDPGSALNGGDLNWIDPNALVPEFRAVMAKSPQGQLSKPFQTQYGW 366

Query: 268 EYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + +  +R     E A +          K ++    +++++R  A + 
Sbjct: 367 HVLEVLGRRATDSTEQAREQQAMTVLRNRKYDEELQTWLRQIRDEAYVE 415


>gi|323495831|ref|ZP_08100899.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio
           sinaloensis DSM 21326]
 gi|323319047|gb|EGA71990.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio
           sinaloensis DSM 21326]
          Length = 431

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 43/275 (15%), Positives = 103/275 (37%), Gaps = 13/275 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +K      + ++      ++        +I   +NG VI + DI   I  LK        
Sbjct: 1   MKFWKQSLLAVLAASQFGLASAQPVALDKINVIVNGGVILESDIDTSIKTLKANAKKSGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LI++TL++QE E+ GI  D N +N    + A+N   + E  S  +
Sbjct: 61  GLPTADVLRQQVTEKLIIDTLQQQEAERIGIRIDDNRLNEAIEEIAKNNNQTIEQLSDSI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRT 182
             +G+  + F++ +  +    +        +   L  E+      +   T    +Y I  
Sbjct: 121 AAEGLEYSEFREQVRKEIAATEARNALVRRRINILPAEVDNLANILAQETNATVQYKIGH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +   +  N   +   ++++ K+                 ++     +  G   ++ + ++
Sbjct: 181 IQLRV--NDGDDASAIEQQAKEIVAKLNNGSDFATMAYTYSKGPKALQGGDWGWMRKEEM 238

Query: 243 HPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
              F + +  +++ +   P+ +  G   + I D +
Sbjct: 239 PTIFADQVGVQNKGSIIGPFRSGVGFHILKIEDVK 273



 Score = 70.1 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 59/151 (39%), Gaps = 6/151 (3%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
            ++ + V E   R +L  I    + +   VQK + +             +L +  S+   
Sbjct: 274 GLETVAVTEVNARHIL--IRPTVILSDDGVQKELNEIIARIQSGEATFGELARQYSQDPG 331

Query: 229 VSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
            +   G+  Y       P+F++ +        + P+ T  G   + + D+R +   + A+
Sbjct: 332 SAAQNGELGYQTSDLYVPEFKHQVDTLPEGKISQPFKTVHGWHIVEVLDRRQVDRTDSAM 391

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           K          K  +  + ++++LR++A + 
Sbjct: 392 KNKAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|104779703|ref|YP_606201.1| peptidyl-prolyl cis-trans isomerase A [Pseudomonas entomophila L48]
 gi|95108690|emb|CAK13384.1| putative peptidyl-prolyl cis-trans isomerase A [Pseudomonas
           entomophila L48]
          Length = 439

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/268 (17%), Positives = 103/268 (38%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           +++   ++    + +     R+   ++ +V+    + +R+  ++             G L
Sbjct: 12  LMLGAVLLSGAVHAAVQPIDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPAGAL 71

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S E F + L   G+  +
Sbjct: 72  EQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNGMSLEQFRAALAHDGLSYD 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+    N    K     EY +  +L   P++
Sbjct: 132 DAREQIKREMIISRVRQRRVAERIQVSEQEVKNFLNSDLGKMQLSEEYRLANILIPTPES 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNL 249
              +      R       +L+   D  +L    ++  + +  G+  +     L P F  +
Sbjct: 192 ANSDAIQAAARQAGDVYQQLKQGADFARLAIARSASENALEGGEMGWRKAGQLPPDFAKM 251

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKR 276
           L   +  + T P     G   + + +KR
Sbjct: 252 LSSMATGDVTQPIRIPNGFIILKLEEKR 279



 Score = 69.3 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 99/315 (31%), Gaps = 64/315 (20%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL        +  +   +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 120 RAALAHDGLSYDDAREQIKREMIISRVRQRRVAER-IQVSEQEVKNFLNSDLGKMQLSEE 178

Query: 119 -DFSSFL----------------DKQGIGDNHFK---QYLA--------------IQSIW 144
              ++ L                 + G      K    +                 +  W
Sbjct: 179 YRLANILIPTPESANSDAIQAAARQAGDVYQQLKQGADFARLAIARSASENALEGGEMGW 238

Query: 145 PDV------------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
                                V     +  G + +++   +    ++   E  +R +L  
Sbjct: 239 RKAGQLPPDFAKMLSSMATGDVTQPIRIPNGFIILKLEEKRGGESSVLRDEVHVRHILIK 298

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHP 244
             +          +++ +    R++  +D ++L K  S+    +   G   ++  + L P
Sbjct: 299 PSE---IRSDKATEQLAERLYDRIKNGEDFSELAKSFSEDPGSALNGGDLNWVDPNSLVP 355

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN---TPTKIEKH 300
           +F+  +  +Q    T P+ TQ G   + +  +R    +   +A            K ++ 
Sbjct: 356 EFREQMANAQQGEVTRPFRTQYGWHVLEVMGRRAT--DSTAQAREQQAMNVLRNRKYDEE 413

Query: 301 EAEYVKKLRSNAIIH 315
              +++++R  A + 
Sbjct: 414 LQTWLRQIRDEAYVE 428


>gi|89094171|ref|ZP_01167114.1| peptidyl-prolyl cis-trans isomerase SurA [Oceanospirillum sp.
           MED92]
 gi|89081646|gb|EAR60875.1| peptidyl-prolyl cis-trans isomerase SurA [Oceanospirillum sp.
           MED92]
          Length = 430

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 103/276 (37%), Gaps = 13/276 (4%)

Query: 14  KLLTTYFVLIIFCIVPIV-SYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           KL        +  ++P+  S+ +     RI   +N  +I   ++ +R ++ + Q  +   
Sbjct: 4   KLHKLISAAALSLLLPVSHSHAAEIPLDRIAAVVNEGIILQSELEQRTSITREQLQSRNT 63

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L K  +  LI+E+++KQ  E++G+    + +N      A   GLS + F   L
Sbjct: 64  RIPPEHILRKQVLNRLIIESIQKQMAEQNGVRVSDSQLNGAIANIAAQNGLSIDQFREAL 123

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRT 182
             +G   N  ++ +  + +   V +N    +    E E+    N +  K+    E+L+  
Sbjct: 124 IAEGRDYNQAREQIRNEMLINSVQQNLVNRRIRVSEQELSNFLNSEDGKSQASAEFLLGH 183

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L + P           +        +L    D  +     S   +    G   +   ++
Sbjct: 184 ILIATPSQASPEIIQQAESKAKEIFDKLNNGADFAETAVEFSNAPNALKGGDLGWRKANE 243

Query: 242 LHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR 276
           L       ++K S    + P  +  G   +   DKR
Sbjct: 244 LPEALSKAVRKLSPGEFSKPVRSPSGFHILLAKDKR 279



 Score = 62.7 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 59/157 (37%), Gaps = 7/157 (4%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +  +K+      + + L+  +L    + +   Q    KR       R+   +D   L K 
Sbjct: 274 LAKDKRGGAVQLIDQRLVSHILLKPTEIRTNEQA---KRQISQLYQRIASGEDFAALAKE 330

Query: 223 ASK--IHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR-DL 278
            S         G   +     + P+F+ ++  +     + P+ ++ G   + + D R + 
Sbjct: 331 FSDDPASGSEGGSLGWTQNGQMVPEFEQVMNSTAVGQVSEPFESRFGWHILTVLDTRTED 390

Query: 279 GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            GE   +    A     K  +  + +++++RS A + 
Sbjct: 391 MGETMQENRARATIRKRKFNEELSNWLREIRSQAYVD 427


>gi|218509345|ref|ZP_03507223.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium
           etli Brasil 5]
          Length = 147

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 80/150 (53%), Gaps = 11/150 (7%)

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQ 235
            EY+++ ++F IP+ K        KR  +AE SR + P  C++ + FA+ + DV++    
Sbjct: 1   TEYMLQQIIFVIPEAK--RGAITGKRKGEAEASRSKFP-GCDQAKVFAATMRDVAVRDLG 57

Query: 236 YLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT 295
            +L  ++ P ++ L+++++ NTT   VT KGVEY+AIC +R +  + A +     ++   
Sbjct: 58  RMLAPEIPPDWKPLVEQAKGNTTGTRVTDKGVEYLAICSQRQVSDDQAAEMVFRQEDLDK 117

Query: 296 KIE--------KHEAEYVKKLRSNAIIHYY 317
                      ++  +Y+ +LR  A I Y+
Sbjct: 118 SKAGKNGPPENENSKKYLDELRKKAQIAYH 147


>gi|121956435|sp|Q88QT4|SURA_PSEPK RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 427

 Score =  145 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 48/263 (18%), Positives = 97/263 (36%), Gaps = 12/263 (4%)

Query: 26  CIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--LQKING------ELEKIAV 77
            ++    + +     R+   ++ +V+    + +R+  ++  + K  G       LE+  +
Sbjct: 5   ALLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSALEQQVL 64

Query: 78  QELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQY 137
           + LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+  +  ++ 
Sbjct: 65  ERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFDDAREQ 124

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
           +  + I   V +     +    E E+         K     EY +  +L   P+    + 
Sbjct: 125 VKREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQMSEEYRLANILIPTPEAANSDD 184

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKSQ 254
                R       +LR   D  ++    S   +    G+  +     L P F  +L    
Sbjct: 185 IQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMP 244

Query: 255 -NNTTNPYVTQKGVEYIAICDKR 276
               T P     G   + + +KR
Sbjct: 245 VGEITQPIRIPNGFIILKLEEKR 267



 Score = 73.1 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 102/313 (32%), Gaps = 60/313 (19%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS-- 116
           R AL +      +  +   +E+I+  ++++ + +  I      V  F         +S  
Sbjct: 108 RAALARDGLSFDDAREQVKREMIISRVRQRRVAER-IQVSEQEVKNFLASDLGKMQMSEE 166

Query: 117 ---------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------IQSIW 144
                          ++D      K G      +Q      +A             +  W
Sbjct: 167 YRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGW 226

Query: 145 PDV------------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFS 186
                                +     +  G + +++   +   +N+   E  +R +L  
Sbjct: 227 RKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGGSENVLRDEVHVRHILIK 286

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHP 244
             +          +++ +    R++  +D  +L K  S+    +   G   ++  + L P
Sbjct: 287 PSE---IRSEAATEQLAERLYDRIKNGEDFGELAKSFSEDPGSALNGGDLNWVDPNSLVP 343

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEA 302
           +F+  +  +Q    T P+ TQ G   + +  +R     E A +    +     K ++   
Sbjct: 344 EFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQALSVLRNRKYDEELQ 403

Query: 303 EYVKKLRSNAIIH 315
            +++++R  A + 
Sbjct: 404 TWLRQIRDEAYVE 416


>gi|167646489|ref|YP_001684152.1| SurA domain-containing protein [Caulobacter sp. K31]
 gi|167348919|gb|ABZ71654.1| SurA domain [Caulobacter sp. K31]
          Length = 452

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/266 (16%), Positives = 104/266 (39%), Gaps = 23/266 (8%)

Query: 29  PIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL----KLQKINGEL---EKIAVQELI 81
             V+ ++  +S  +   +N ++I+  D+ +R+ LL     LQ     L   E+ A++ LI
Sbjct: 47  APVAPRANPLSESVAAVVNDDIISSYDLMQRMRLLMVTSGLQPTQENLPQLEQEALRSLI 106

Query: 82  VETLKKQE------IEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            E ++ QE       +K  I      V       A+   L+ +  +  L  QG+G + +K
Sbjct: 107 DEHVQMQELRRVEKAQKITIISTDKEVEEQIEDIAKGNNLTGQQLTQQLRAQGVGIDTWK 166

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
             +   S W   +   +  +    + +I A  +++ +  +  +Y +  V           
Sbjct: 167 AQIRADSSWQAWISGRYGSRLRIGDDQIKAFERRQAEAASKPQYQVSEVFIDAGRVGGME 226

Query: 195 QGFVQKRIKDAEESRLRLPKDC---NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
                     A++   ++ +         +F++     + G A ++   ++ P+    ++
Sbjct: 227 TAV-----NGAKQLVTQMQQGAPFPAVARQFSASPTAANGGDAGWISPGEMPPEVDAAIE 281

Query: 252 KS-QNNTTNPYVTQKGVEYIAICDKR 276
           +      + P   + GV  I + +KR
Sbjct: 282 QLRPGQLSAPIPVRDGVYIIYLREKR 307



 Score = 78.9 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 62/150 (41%), Gaps = 4/150 (2%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           ++K          ++ V  ++P +   +Q  V    K   + + ++  +C  LE  A K+
Sbjct: 304 REKRSGAKTALVDLKQVALALPKDA--SQAQVDAANKVLLDLKPKIV-NCETLEATAGKV 360

Query: 227 HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
             V  G       +DL P FQ      +    ++P  T  G+  IA+C KR  G +   +
Sbjct: 361 EGVVAGDLGEAEITDLAPAFQQAANTLKVGQVSDPIRTDAGLHLIAVCGKRQSGAQAPTR 420

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             +  +    ++      Y++ LR++A I 
Sbjct: 421 DQIENRLRGQQLALISKRYLRDLRNSATIE 450


>gi|114569774|ref|YP_756454.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Maricaulis maris
           MCS10]
 gi|114340236|gb|ABI65516.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Maricaulis maris
           MCS10]
          Length = 435

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 106/292 (36%), Gaps = 21/292 (7%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSR-IRTTINGEVITDGDISKRIALLKL 65
           T++   +       + ++  + P+ +  + A ++  +   +N E IT  D+  R+ L+  
Sbjct: 8   TNMRLLMTCAKRIVLSLLAFVAPMCATNAHAQTTEGVAALVNDEPITTVDVRNRMRLIIA 67

Query: 66  QK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
                         ++  A++ L+ E L+ Q   +  I      +    +  A     + 
Sbjct: 68  STGMSQIDEGTLSRIQDQAMRGLVDEHLQLQAASEYDIEVSDAEITNSLLDLADRNNTTI 127

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR 176
           +     L   G+  +  +  L  +  W  +V   +  +    E +I  A ++   + +  
Sbjct: 128 DVIIQDLQSSGVDVSTLRHQLEAEIAWQIIVNGRYGSRIRISEQQIELALERLAASASQP 187

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
           ++ I  +LF +P    Q +  +Q+ I    + + +         +F+      + G   +
Sbjct: 188 QFRIFEMLFEVP-GPGQEEQTIQRVITVMNQLQ-QGATFPELARQFSDAPSAANGGDIGW 245

Query: 237 LLESDLHPQFQNLLKKSQNN---------TTNPYVTQKGVEYIAICDKRDLG 279
           +  S L P+   ++ + +            +NP     G   IA+   RD  
Sbjct: 246 ITASQLQPEVAAIMPQMRGQYDQSGGRGALSNPIEVPGGFMVIALVGARDGT 297



 Score = 38.5 bits (88), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/137 (13%), Positives = 44/137 (32%), Gaps = 9/137 (6%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           + A        T  +Y +  +            G   + +  +          C + E  
Sbjct: 287 VIALVGARDGTTTLQYDLVQITVPTSALTDTTAGTFARELDASP--------TCAQAEAV 338

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           AS+I          +    + P  ++ L+   +   T    +  G++ + +CD+   G  
Sbjct: 339 ASRIPGAIYTPLGSISAEAVLPAIRDALQPLDEGENTGVLQSGVGLQALIVCDRAIAGPG 398

Query: 282 IALKAYLSAQNTPTKIE 298
           +  +  L +Q    ++ 
Sbjct: 399 VPTRDDLESQLRGQQLS 415


>gi|91776502|ref|YP_546258.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Methylobacillus
           flagellatus KT]
 gi|122070650|sp|Q1GZC0|SURA_METFK RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|91710489|gb|ABE50417.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Methylobacillus
           flagellatus KT]
          Length = 437

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/278 (17%), Positives = 103/278 (37%), Gaps = 12/278 (4%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-KIN 69
            F  +     + + F           A   RI   ++  VIT+ ++  RI  +  Q +  
Sbjct: 5   VFKTIARHGLIALFFFFSISAMAAEVAKMDRIVAIVDQGVITEKELEDRIQTVIAQLEKQ 64

Query: 70  GE-------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
           G        L+K  ++ LI + L+ Q   ++G+  D   ++    + A    LS  +F  
Sbjct: 65  GTQLPPRDVLQKQILERLINDRLQLQYAAQTGLRVDDAQLDKTIERIAEQNKLSTGEFRK 124

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLI 180
            L+ +GI    F++ +  + I   + + +   +    E EI      Q  +N    E+ +
Sbjct: 125 ALEAEGIPYRKFREDIRNEIILARLREREVDNRVNVTESEIDNFLTTQSSRNDIQDEFEV 184

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLE 239
             +L   P+     +    K   +A    L+   D  ++   ++   + +  G   +   
Sbjct: 185 AHILIRAPEESTPEELQKLKAKAEAALKELQSGADFAQVSAGYSDAPNALEGGILGWKAS 244

Query: 240 SDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR 276
           S L   F + L+       +    +  G   + + ++R
Sbjct: 245 SQLPSLFVDALQALQPGQLSPVLRSPNGYHILKLLNRR 282



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/298 (10%), Positives = 90/298 (30%), Gaps = 57/298 (19%)

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL----------------- 115
            +    E+I+  L+++E++   +    + ++ F    +    +                 
Sbjct: 137 REDIRNEIILARLREREVDNR-VNVTESEIDNFLTTQSSRNDIQDEFEVAHILIRAPEES 195

Query: 116 SAEDFSSFLDKQGIGDNHFK-----QYLAIQ------------SIWPD-------VVKND 151
           + E+      K        +       ++                W          V   
Sbjct: 196 TPEELQKLKAKAEAALKELQSGADFAQVSAGYSDAPNALEGGILGWKASSQLPSLFVDAL 255

Query: 152 FMLKYGNLE-----------MEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
             L+ G L            +++   +     + V +  +R +L  + +  + ++   ++
Sbjct: 256 QALQPGQLSPVLRSPNGYHILKLLNRRGGSSPLVVDQTHVRHILIKLSE--VVSELEAEQ 313

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTN 259
           +I   +E             +++      + G   +    D  P F+  +     N  + 
Sbjct: 314 KINSIKERLDHGADFAELARQYSEDASANNGGDLGWTNAGDTVPAFEKAMNALDINEISA 373

Query: 260 PYVTQKGVEYIAICDKR-DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           P  T  G   I + ++R     + + +     +    K +    +++ +LR  A + Y
Sbjct: 374 PVRTPFGWHIIQVLERRKQDMTQESARLKARQEIRARKADDAFQDWLSELRDRAYVEY 431


>gi|152984838|ref|YP_001346133.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PA7]
 gi|150959996|gb|ABR82021.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PA7]
          Length = 430

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/268 (16%), Positives = 101/268 (37%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGELE----- 73
           + +   ++   ++       R+   ++ +VI    + +R+  +   L K    L      
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 74  -KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+   
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMATIAQRNGMSLEQFQAALTRDGLSYA 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             +  +  + +   V +     +    E E+         K     EY +  +L  +P+ 
Sbjct: 132 DARDQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNL 249
              +      R       +L+   D  +L    ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
           +      + T P  T  G   + + +KR
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKR 279



 Score = 69.7 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 62/154 (40%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+    +   E  +R +L     +++++    +K +      R++  +D  +L K  S+
Sbjct: 277 EKRGGSKMVRDEVHVRHILLK--PSEIRSDAETEK-LAQKLYERIQSGEDFGELAKSFSE 333

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G   ++    L P+F+ ++    Q   + P+ +Q G   + +  +R     E
Sbjct: 334 DPGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSE 393

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +     K ++    +++++R  A + 
Sbjct: 394 KFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVE 427


>gi|122070668|sp|Q4K4X7|SURA_PSEF5 RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 426

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/302 (16%), Positives = 107/302 (35%), Gaps = 15/302 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--LQKINGE------LEKIA 76
              +   +  +     ++   ++ +V+    + +R+  ++  + K  G       LE+  
Sbjct: 4   ALFLSTAASAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQQTIAKRGGGVPPTSVLEQQV 63

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LIVE L+ Q  E+SGI      +N      A+   +S E F + L   G+     + 
Sbjct: 64  LERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNSMSIEQFRAALAHDGLSYEDARD 123

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + I   V +     +    E E+         K     E  +  +L   P++    
Sbjct: 124 QVRREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEELHLANILIPTPESANSE 183

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQF-QNLLKK 252
                 R       +L+   D  +L    +   + +  G   +   + L P F + L   
Sbjct: 184 AIQSAARQAMEVYQQLKQGADFAQLAIARSGSDNALEGGDMGWRKAAQLPPPFDRELSAM 243

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
           +  + T P  T  G   + + DKR  G    +     ++  + +  + E+      +KL 
Sbjct: 244 AVGDITQPARTPGGFIILKLLDKRGGGNQVRDEVHVRHILIKPSEIRSEEETKRLAQKLY 303

Query: 310 SN 311
             
Sbjct: 304 DR 305



 Score = 74.3 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 98/316 (31%), Gaps = 60/316 (18%)

Query: 56  ISK-RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114
           I + R AL        +      +E+I+  ++++ + +  I      V  F         
Sbjct: 104 IEQFRAALAHDGLSYEDARDQVRREMIISRVRQRRVAER-IQVSEQEVKNFLASDLGKMQ 162

Query: 115 LS-----------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------I 140
           LS                 +E   S   +        KQ      LA             
Sbjct: 163 LSEELHLANILIPTPESANSEAIQSAARQAMEVYQQLKQGADFAQLAIARSGSDNALEGG 222

Query: 141 QSIWPDVVK-----NDFMLKYGNLEMEIPAN------------KQKMKNITVREYLIRTV 183
              W    +     +  +      ++  PA             K+   N    E  +R +
Sbjct: 223 DMGWRKAAQLPPPFDRELSAMAVGDITQPARTPGGFIILKLLDKRGGGNQVRDEVHVRHI 282

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESD 241
           L    + + + +    KR+      R+   +D  +L K  S+    +   G   ++  + 
Sbjct: 283 LIKPSEIRSEEE---TKRLAQKLYDRIEAGEDFAELAKSYSEDPGSALNGGDLNWIDPNA 339

Query: 242 LHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-NTPTKIEK 299
           L P+F+ ++ K+     + P+ +  G   + +  +R        +   +       K ++
Sbjct: 340 LVPEFREVMAKTPQGQLSKPFKSPYGWHVLEVLGRRATDSTSQAREQQAMTVLRNRKYDE 399

Query: 300 HEAEYVKKLRSNAIIH 315
               +++++R  A + 
Sbjct: 400 ELQTWLRQIRDEAYVE 415


>gi|170723956|ref|YP_001751644.1| SurA domain-containing protein [Pseudomonas putida W619]
 gi|169761959|gb|ACA75275.1| SurA domain [Pseudomonas putida W619]
          Length = 441

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/268 (18%), Positives = 101/268 (37%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GEL 72
           VL+   ++    + +     R+   ++ +V+    + +R+  ++               L
Sbjct: 14  VLLGAVLLSGAVHAAVQPLDRVVAIVDNDVVMQSQLDQRVQEVQQTIAKRGGGVPPTSAL 73

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           E+  ++ LIVE L+ Q  E+SGI      +N      A+  G+S + F + L + G+  +
Sbjct: 74  EQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLDQFRAALARDGLSFD 133

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + I   V +     +    E E+         K     +Y +  +L   P+ 
Sbjct: 134 DAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDMGKMQMSEDYRLANILIPTPEG 193

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNL 249
              +      R       +LR   D  ++    S   +    G+  +   + L P+F  L
Sbjct: 194 ANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGWRKAAQLPPEFAKL 253

Query: 250 LKK-SQNNTTNPYVTQKGVEYIAICDKR 276
           L   +  + T P     G   I + +KR
Sbjct: 254 LSSMATGDITQPLRIPSGFIIIKLEEKR 281



 Score = 73.9 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 41/313 (13%), Positives = 99/313 (31%), Gaps = 60/313 (19%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS-- 116
           R AL +      +  +   +E+I+  ++++ + +  I      V  F         +S  
Sbjct: 122 RAALARDGLSFDDAREQVKREMIISRVRQRRVAER-IQVSEQEVKNFLASDMGKMQMSED 180

Query: 117 ---------------AEDFSSFLDKQGIGDNHFKQ-----YLA------------IQSIW 144
                          ++D      K G      +Q      +A             +  W
Sbjct: 181 YRLANILIPTPEGANSDDIQKAARKVGDVYQQLRQGADFGQMAIANSASENALEGGEMGW 240

Query: 145 PDVVK-----NDFMLKYGNLEMEIPAN-------------KQKMKNITVREYLIRTVLFS 186
               +        +      ++  P               +   +N+   E  +R +L  
Sbjct: 241 RKAAQLPPEFAKLLSSMATGDITQPLRIPSGFIIIKLEEKRGGSENVLRDEVHVRHILIK 300

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHP 244
             +          +++ +    R++  +D  +L K  S+    +   G   ++  + L P
Sbjct: 301 PSE---IRSEAATEQLAERLYERIKGGEDFAELAKSFSEDPGSALNGGDLNWVDPNSLVP 357

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEA 302
           +F+  +  +Q    T P+ TQ G   + +  +R     E A +          K ++   
Sbjct: 358 EFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQAMNVLRNRKYDEELQ 417

Query: 303 EYVKKLRSNAIIH 315
            +++++R  A + 
Sbjct: 418 TWLRQIRDEAYVE 430


>gi|103486961|ref|YP_616522.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingopyxis
           alaskensis RB2256]
 gi|98977038|gb|ABF53189.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingopyxis
           alaskensis RB2256]
          Length = 446

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/264 (21%), Positives = 97/264 (36%), Gaps = 15/264 (5%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKINGEL--------EKIAVQELIVETLKKQEIEK 92
           R   T+NGE+IT  DI +R+AL+++   N EL               LI E L+ QE   
Sbjct: 54  RPSATVNGEIITATDIEQRMALIRIANNNVELPPEEEQRLRNQVFSNLIDEKLQIQEARA 113

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
           + IT D N VN  F + A     + E F+++L  +G      KQ +  +  W  ++  + 
Sbjct: 114 ADITIDENVVNEQFARLAARFKQTPEQFAAYLASKGSSAAAVKQQIRGEFAWDRLLSRNI 173

Query: 153 MLKYGNLEMEIPA-NKQKMKNITVREYLIRTVLF-SIPDNKLQNQGFVQKRIKDAEESRL 210
                    E+    KQ        E+ +  +   + PDN        +K I+  +    
Sbjct: 174 QSTTNVSTEEVDLIVKQMEAAKGQDEFHLGEIYLSATPDNIAAVTENARKIIQALQAG-- 231

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEY 269
                     +F+     V  G   ++  + L        ++        P     G+  
Sbjct: 232 --GSFAAYARQFSEASTAVVGGDLGWVKGAQLPASMAEAAMQMQPGQLVGPIEVPGGISI 289

Query: 270 IAICDKRDLGGEIALKAYLSAQNT 293
           + + D+R +       A LS +  
Sbjct: 290 MLLIDRRQVLTADPRDAILSLKQI 313



 Score = 53.5 bits (127), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 59/180 (32%), Gaps = 5/180 (2%)

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFV 198
           A+Q     +V    +    ++ + I   +    +       ++ +    P    + Q   
Sbjct: 269 AMQMQPGQLVGPIEVPGGISIMLLIDRRQVLTADPRDAILSLKQISLDFPAGTTEAQA-- 326

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTT 258
             ++        R    C   +  A ++    + +    + +   P    L+      TT
Sbjct: 327 -SQLASRFAQATRTIAGCGAADAVAEQLGASVVSRDNIAMRALPAPLQATLVDLQVGQTT 385

Query: 259 NPY-VTQKGVEYIAICDKR-DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            P+    +G+  + +C +             +  +    K+ K    Y++ LR +A+I Y
Sbjct: 386 QPFGAANEGISVLVLCGRDMPETATAPNLEQIEQKLLEEKVNKRAQRYLRDLRRDAVIEY 445


>gi|329903502|ref|ZP_08273518.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Oxalobacteraceae bacterium IMCC9480]
 gi|327548325|gb|EGF33013.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Oxalobacteraceae bacterium IMCC9480]
          Length = 475

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/284 (18%), Positives = 109/284 (38%), Gaps = 12/284 (4%)

Query: 5   VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK 64
           + +  +  ++  +  F                 +   I   +N +VIT  D++ R+AL++
Sbjct: 29  LISLAAACLQPASAQFTPAGQAAPAAPRKSEPQVIDSIVAVVNSDVITRLDLNSRVALVE 88

Query: 65  LQKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
            +             LEK  ++ +IV+  + Q    SGI  D   ++    + A    LS
Sbjct: 89  TRMKQQGSQLPQRALLEKQILERMIVDRAQLQLAADSGIKIDDVMLDRAMARLAEQNKLS 148

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI--T 174
            +DF + L+++G   + F++ +  +     + + +   K    E E+       KN    
Sbjct: 149 MQDFRNQLEREGTPFSRFREEIREEIAMQRIREREVDNKLQITESEVDNYLDAEKNAPQI 208

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGK 233
             EY +  +L  IP+N    Q   ++   D    +LR   D  K    ++  I  +  G+
Sbjct: 209 QPEYNLAQILIRIPENATAEQIAARRARADDVARQLRSGADFAKLAASYSDSIEALKGGE 268

Query: 234 AQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKR 276
             +     L   F + + + ++   +    +  G   + +  KR
Sbjct: 269 LGWRTADRLPQLFVDAVARLNEGELSAVIKSASGFHILKVAGKR 312



 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 54/146 (36%), Gaps = 7/146 (4%)

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK-IHDVSIGK 233
           V++   R +L  +  N +       +++ D ++          +L K  S  +     G 
Sbjct: 328 VQQTRARHILIKV--NTIVTAAEALRKLTDLKQRLDNKAATFEELAKLYSNDLSASKGGD 385

Query: 234 AQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAI--CDKRDLGGEIALKAYLSA 290
             ++   D  P+F+  +        + P  T  G   I +     +D+  E   +     
Sbjct: 386 LGWIYPGDTVPEFERAMNLLKPGEVSAPIETPFGYHLIEVIERKSQDVSQER-KRLSARQ 444

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHY 316
                K+E+   +++++LR  A + Y
Sbjct: 445 ALRERKLEEATQDWIRQLRDRAYVEY 470


>gi|254243688|ref|ZP_04937010.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           2192]
 gi|126197066|gb|EAZ61129.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           2192]
          Length = 430

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/306 (15%), Positives = 114/306 (37%), Gaps = 15/306 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGELE----- 73
           + +   ++   ++       R+   ++ +VI    + +R+  +   L K    L      
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 74  -KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+  +
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQAALTRDGLSYS 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + +   V +     +    E E+         K     EY +  +L  +P+ 
Sbjct: 132 DAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNL 249
              +      R       +L+   D  +L    ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +      + T P  T  G   + + +KR       +     ++  + +  + E    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLA 311

Query: 306 KKLRSN 311
           +KL   
Sbjct: 312 QKLYER 317



 Score = 69.7 bits (169), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 58/154 (37%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+    +   E  +R +L    +          +++      R++  +D  +L K  S+
Sbjct: 277 EKRGGSKMVRDEVHVRHILLKPSE---IRSEAETEKLAQKLYERIQSGEDFGELAKSFSE 333

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G   ++    L P+F+ ++    Q   + P+ +Q G   + +  +R     E
Sbjct: 334 DPGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSE 393

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +     K ++    +++++R  A + 
Sbjct: 394 KFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVE 427


>gi|53805075|ref|YP_113118.1| peptidyl-prolyl cis-trans isomerase SurA [Methylococcus capsulatus
           str. Bath]
 gi|81682783|sp|Q60B78|SURA_METCA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|53758836|gb|AAU93127.1| peptidyl-prolyl cis-trans isomerase SurA [Methylococcus capsulatus
           str. Bath]
          Length = 454

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 101/281 (35%), Gaps = 13/281 (4%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI----ALLKLQK 67
                   ++  +     +    + A   RI   ++  VI + ++ +++      L+  +
Sbjct: 3   ISSFRKGRWLGALALFAVVCWSMADAAVDRIVAVVDDGVILESELVRKVDEIKRSLRASR 62

Query: 68  IN----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
            +      L +  ++ +IV+ ++ Q  EK GI  D +T+     Q A+   L+ + F   
Sbjct: 63  ASLPPDSVLVRQVLERMIVDKIQIQMAEKMGIQVDDDTLRMAVSQIAQRNNLTPDQFRRS 122

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA---NKQKMKNITVREYLI 180
           L ++GI    F   +  +     +  +    +    + E+      +     +  REY +
Sbjct: 123 LAREGIDYGDFLDQVRSEIAMGRLRASQINNQIKISDREVEHYLEAQGGSGAVADREYRL 182

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLE 239
             +L + P     ++    +   D     L+   D      +++     +  G   +   
Sbjct: 183 GHILIATPREASPDEVKKARERADRVVKELKAGLDFKDASIRYSDDPQALEGGDLGWRKL 242

Query: 240 SDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
           S++      ++   +    ++P  +  G   + +   R +G
Sbjct: 243 SEIPSHIAEVVGGMKDGEVSDPIRSPGGYHIVKMLAMRGVG 283



 Score = 63.1 bits (152), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 59/155 (38%), Gaps = 7/155 (4%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
              + +    + +  +R +L    +          K    A ++R+    D  +L +  S
Sbjct: 277 LAMRGVGEAKLTKTHVRHILIRPNEVLSDEDA---KNKLLALKTRIENGDDFAELARGHS 333

Query: 225 KIHDVSI--GKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGG- 280
                +I  G   ++    L P F+  +    +N  ++P  TQ G   I + ++++    
Sbjct: 334 DDKGSAIKGGDLGWVKPGALVPPFEEAMNALDENQLSDPVQTQFGWHLIQVLERQESSDT 393

Query: 281 EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              LK     +    K+++    +++K+R  A + 
Sbjct: 394 NEVLKNRARDELFKRKVDEETELWLRKIRDEAYVE 428


>gi|116054322|ref|YP_788767.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889335|ref|YP_002438199.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           LESB58]
 gi|254237192|ref|ZP_04930515.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           C3719]
 gi|296387100|ref|ZP_06876599.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PAb1]
 gi|115589543|gb|ABJ15558.1| peptidyl-prolyl cis-trans isomerase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169123|gb|EAZ54634.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           C3719]
 gi|218769558|emb|CAW25318.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           LESB58]
          Length = 430

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 46/306 (15%), Positives = 113/306 (36%), Gaps = 15/306 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGELE----- 73
           + +   ++   ++       R+   ++ +VI    + +R+  +   L K    L      
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 74  -KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+   
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQAALTRDGLSYA 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + +   V +     +    E E+         K     EY +  +L  +P+ 
Sbjct: 132 DAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNL 249
              +      R       +L+   D  +L    ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +      + T P  T  G   + + +KR       +     ++  + +  + E    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLA 311

Query: 306 KKLRSN 311
           +KL   
Sbjct: 312 QKLYER 317



 Score = 69.7 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 58/154 (37%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+    +   E  +R +L    +          +++      R++  +D  +L K  S+
Sbjct: 277 EKRGGSKMVRDEVHVRHILLKPSE---IRSEAETEKLAQKLYERIQSGEDFGELAKSFSE 333

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G   ++    L P+F+ ++    Q   + P+ +Q G   + +  +R     E
Sbjct: 334 DPGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSE 393

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +     K ++    +++++R  A + 
Sbjct: 394 KFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVE 427


>gi|110834907|ref|YP_693766.1| survival protein SurA [Alcanivorax borkumensis SK2]
 gi|122070614|sp|Q0VMV4|SURA_ALCBS RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|110648018|emb|CAL17494.1| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Alcanivorax borkumensis SK2]
          Length = 435

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 44/270 (16%), Positives = 99/270 (36%), Gaps = 12/270 (4%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ--------KING 70
             + +   ++P+ S     M  RI   +N   I   ++ +RI  + LQ            
Sbjct: 14  GLLAMAVLMIPVWSQAKVQMLDRIVAVVNDGAIMASELDERINTIALQFQEKGQQLPSPA 73

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L +  +  +I+E L+ Q  E++GI  D  ++N      AR   +S EDF++ L + G  
Sbjct: 74  ILREQVLDRMILERLQLQLAERAGIKVDEASLNEALAGIARQNDMSLEDFAATLREDGYS 133

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIP 188
              F++ +    +   + +     +    + E+    + +  K +   ++ +  +L  +P
Sbjct: 134 WTQFREQIRQDMVISRLQQRSVASRIQITDREVDRFLSSELGKQMFQEDFRLGHILIRVP 193

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQ 247
                 Q    +        RL    D  +L    +   + +  G   +   +     F 
Sbjct: 194 SEARPQQISQARAKAKEIIERLEAGSDFQQLAIALSDGPNALEGGDLGWRPAAQWPTLFA 253

Query: 248 N-LLKKSQNNTTNPYVTQKGVEYIAICDKR 276
              +   +   + P  +  G   + + D++
Sbjct: 254 ENAINLKKGEFSQPLRSGAGFHILKMIDRK 283



 Score = 63.9 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/149 (12%), Positives = 55/149 (36%), Gaps = 6/149 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI--KDAEESRLRLPKDCNKLEKFA 223
           +++      V +Y +R VL          Q   +      +    + +  +   +     
Sbjct: 281 DRKGGAEKVVTQYHVRHVLIKADALTSAEQAQQRAIRLHDEVAAGKRQFKETAAEFSDDP 340

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEI 282
               +   G+  ++ + ++ P+F+ ++  +     +  + +Q G  ++ + D RD     
Sbjct: 341 GSARN--GGELGWVNKGEMVPEFEQVMLNTPVGELSPVFESQFGWHFLRVDDIRDADMST 398

Query: 283 ALKAYLSAQNTPT-KIEKHEAEYVKKLRS 310
             +   + Q     + E+    +V++ RS
Sbjct: 399 EFRRMQATQALQKRRFEEELETWVQEKRS 427


>gi|15595791|ref|NP_249285.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PAO1]
 gi|9946466|gb|AAG03983.1|AE004495_7 peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           PAO1]
          Length = 430

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 46/306 (15%), Positives = 113/306 (36%), Gaps = 15/306 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGELE----- 73
           + +   ++   ++       R+   ++ +VI    + +R+  +   L K    L      
Sbjct: 12  LALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVL 71

Query: 74  -KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
            +  ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+   
Sbjct: 72  TQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQTALTRDGLSYA 131

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDN 190
             ++ +  + +   V +     +    E E+         K     EY +  +L  +P+ 
Sbjct: 132 DAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEA 191

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNL 249
              +      R       +L+   D  +L    ++  + +  G+  +   + L   F ++
Sbjct: 192 ASSDVIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSM 251

Query: 250 LKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYV 305
           +      + T P  T  G   + + +KR       +     ++  + +  + E    +  
Sbjct: 252 IGSLAVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLA 311

Query: 306 KKLRSN 311
           +KL   
Sbjct: 312 QKLYER 317



 Score = 69.7 bits (169), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 58/154 (37%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+    +   E  +R +L    +          +++      R++  +D  +L K  S+
Sbjct: 277 EKRGGSKMVRDEVHVRHILLKPSE---IRSEAETEKLAQKLYERIQSGEDFGELAKSFSE 333

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G   ++    L P+F+ ++    Q   + P+ +Q G   + +  +R     E
Sbjct: 334 DPGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSE 393

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +     K ++    +++++R  A + 
Sbjct: 394 KFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVE 427


>gi|326386746|ref|ZP_08208367.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208799|gb|EGD59595.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 467

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 53/266 (19%), Positives = 93/266 (34%), Gaps = 17/266 (6%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKINGE---------LEKIAVQELIVETLKKQEIE 91
           R    +NGE+IT  DI +R+AL+      G          L    ++ LI ETL+ QE +
Sbjct: 73  RATAIVNGEIITGTDIDQRLALIINANGGGNKIPAEEQERLRAQVLRNLIDETLQIQEAK 132

Query: 92  KSGITFDSNTVNYFFVQHARNT-GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
             GI  D   VN  F + A+   G +      +L   G      K+ +  +  W  +++ 
Sbjct: 133 GVGIEIDEEEVNQSFDRVAQQNFGQNTAALEKYLTSIGSSAASLKRQIKGEMAWQRLLRR 192

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLF-SIPDNKLQNQGFVQKRIKDAEES 208
           +        + E+     +MK      EY I  +   +  +N+ Q      K ++  +  
Sbjct: 193 NVQPYINVSDSEVREMMDRMKAAKGTEEYHIGEIFLSATDENRSQVLANADKIVEQLK-- 250

Query: 209 RLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
             +         +F+        G   ++    L  +               P     G 
Sbjct: 251 --KGGSFTAYARQFSEASTAAVGGDLGWIRLVQLPQELATSATTMGPGQLAGPIALAGGY 308

Query: 268 EYIAICDKRDLGGEIALKAYLSAQNT 293
             I + DKR +    A  + LS +  
Sbjct: 309 SIIYVIDKRQVLTADARDSILSLKQV 334



 Score = 45.8 bits (107), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 49/110 (44%), Gaps = 4/110 (3%)

Query: 210 LRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPY-VTQKGV 267
           ++    C +++  A++I   S+     +   DL    Q+ +LK +    T P+   + GV
Sbjct: 358 VKAIHGCGQVDAAATQI-GASVVANDQIRARDLPVALQDTVLKLAVGEATPPFGSIEDGV 416

Query: 268 EYIAICDKRDLGGEI-ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             + +C + D   E       L +Q    ++ K    Y++ LR +A+I Y
Sbjct: 417 RVLMLCGRDDPKVENGPSFEQLQSQIEDDRVNKRAQTYLRDLRRDAVIEY 466


>gi|83945293|ref|ZP_00957642.1| peptidyl-prolyl cis-trans isomerase family protein [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851463|gb|EAP89319.1| peptidyl-prolyl cis-trans isomerase family protein [Oceanicaulis
           alexandrii HTCC2633]
          Length = 411

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 41/274 (14%), Positives = 103/274 (37%), Gaps = 11/274 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL-------KL 65
           +       +L    ++      S      I   +N + IT  D+  R+ L+         
Sbjct: 1   MAFRLALTILAGIALMSAAPTASAQQVEGIAAVVNDQPITTLDVRDRMRLIISSAGVQPT 60

Query: 66  QKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
           +++   ++  +++ L+ ETL+ Q+  +  +  +   V+      A  +G + ++    L 
Sbjct: 61  EEMLARIQDQSIRGLVDETLQLQQAAEFDLEVEEAEVDDAIADIATRSGATVQEVEDDLA 120

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK-MKNITVREYLIRTVL 184
             GI  N  +Q +  +  W  +V   +  +    + +I     + +++ +  +Y +  + 
Sbjct: 121 ASGIDINTLRQQVKAEIAWQILVSGRYRSRIRISDQQIETALDRYIQSASQPQYRLGEIF 180

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
             I     + +      I+   +   +        ++F+      + G   YL  S ++ 
Sbjct: 181 VEITPQGGEERAV--GIIQTIYDQLRQGAPFQAVAQQFSDAASASAGGDTGYLPLSGINA 238

Query: 245 QFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRD 277
           Q    + +      +NP     G + +A+ D+RD
Sbjct: 239 QVAEAVTQMEPGQISNPIRVPGGFQIVALIDRRD 272


>gi|297537786|ref|YP_003673555.1| SurA domain-containing protein [Methylotenera sp. 301]
 gi|297257133|gb|ADI28978.1| SurA domain protein [Methylotenera sp. 301]
          Length = 448

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 56/273 (20%), Positives = 99/273 (36%), Gaps = 16/273 (5%)

Query: 20  FVLIIFCIVPIVSYKSWAMS----SRIRTTINGEVITDGDISKRIALLKLQKIN------ 69
           F+L+   +     + + A       RI   ++  VIT+ ++  RIA +  Q         
Sbjct: 21  FILLASVLFIGNQFNAQAADIVKLDRIVAIVDQTVITEQELESRIATVTAQFKKQGTELP 80

Query: 70  --GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               L K  ++ LI +TL+ Q   + G+  D N ++    + A    L+  +FS  L K 
Sbjct: 81  EESVLRKQILERLITDTLQIQYAAQIGLKVDDNQLDKTVERIADQNNLTLTEFSEALAKD 140

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLF 185
           GI    F+  +  +     + + +   +    E EI      Q   N    E+ I  +L 
Sbjct: 141 GISMRKFRADIRNEITVARLREREVDGRVNVSESEIDNYLTSQASLNENTDEFEISHILI 200

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHP 244
             P+          K   D   S+L       K+    S   +    G   +   S +  
Sbjct: 201 RTPEEGATEDIQKAKAKVDEALSQLNSGVSFAKVSASFSDAPNALEGGSLGWKKGSQMPA 260

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
            F + LK  Q    + P  +  G   + + +KR
Sbjct: 261 LFLDALKNMQAGEVSAPLRSPNGFHLLKLTNKR 293



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 64/171 (37%), Gaps = 6/171 (3%)

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
           V        G   +++   +     + +++   R +L  I +     +   +    DA +
Sbjct: 274 VSAPLRSPNGFHLLKLTNKRGGNSPLVIQQTHARHILIKITEVMSDKEAETKI---DAIK 330

Query: 208 SRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQK 265
            RL   +    L +  S+    S  G   ++   D  P F+N +   +    + P  +Q 
Sbjct: 331 ERLDNGEKFEVLARQFSEDSTASNGGDLNWVNPGDTVPPFENAMNALKDGQISAPVRSQF 390

Query: 266 GVEYIAICDKR-DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           G   I + ++R     + + +     +    K ++   +++++LR  A + 
Sbjct: 391 GWHIIQVMERRSQDMSKESARLKARQEIRARKADEAYQDWIRELRDRAYVE 441


>gi|294634977|ref|ZP_06713494.1| peptidylprolyl cis-trans isomerase SurA [Edwardsiella tarda ATCC
           23685]
 gi|291091576|gb|EFE24137.1| peptidylprolyl cis-trans isomerase SurA [Edwardsiella tarda ATCC
           23685]
          Length = 434

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 50/318 (15%), Positives = 119/318 (37%), Gaps = 20/318 (6%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---- 68
           +K   T  + ++ C     ++ +  +  ++   ++  V+ + D+   +  +KL       
Sbjct: 1   MKNWRTLILGVVLCANT--AFAAPQVVDKVVAIVDNGVVLESDVDGMMKSVKLNAQQAGQ 58

Query: 69  ----NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               N  L    ++ LI++ ++ Q  ++ G+    + ++      A    L+ +   S L
Sbjct: 59  QLPDNATLRHQILERLIMDNIQLQMAKRMGLEVSDSELDNAINGIAAQNHLTPQQLRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQK-MKNITVREYLIRT 182
              G+    ++  +  + +  +V  N+   +   L  E+ A  KQ   +N       +  
Sbjct: 119 AADGLDYKAYRAQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQISSQNSGETAVNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    ++  ++   +LR   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPTQQQVSEAQQQAESLVQQLRHGADFAKLAATYSADPQALKGGEMGWGRLQE 238

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK----AYLSAQNTPTK 296
           L   F   L+   + +   P  +  G   + + D R     +A+      ++  + +P  
Sbjct: 239 LPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVAVTEVHARHILLRTSPVM 298

Query: 297 IEKHEAEYVKKLRSNAII 314
            +      ++ L   A I
Sbjct: 299 SDAQARAKLEAL--AAQI 314



 Score = 69.7 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 35/301 (11%), Positives = 86/301 (28%), Gaps = 69/301 (22%)

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT------GLS---------- 116
                +E+++  ++  E+ +  +T     V+    Q +          LS          
Sbjct: 129 RAQIRKEMLISEVRNNEVRRR-VTILPQEVDALAKQISSQNSGETAVNLSHILIPLPENP 187

Query: 117 -----------AEDFSSFLDKQG----------IGDNHFKQYLAIQSIWPDV-------- 147
                      AE     L                    K     +  W  +        
Sbjct: 188 TQQQVSEAQQQAESLVQQLRHGADFAKLAATYSADPQALKG---GEMGWGRLQELPTLFA 244

Query: 148 ----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
                     +        G   + +   +    N+ V E   R +L     + + +   
Sbjct: 245 EALQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVAVTEVHARHILLRT--SPVMSDAQ 302

Query: 198 VQKRIKDAEESRLRLPK-DCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-LLKKS 253
            + ++ +A  ++++  +    +  K  S     +   G   + + S   P F++ L+K +
Sbjct: 303 ARAKL-EALAAQIKSGQITFEQAAKQYSDDPGSAQKGGDLGWAVPSMYDPAFRDALMKLN 361

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDL--GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           +   + P  +  G   I +   R +    E   +          K  +    ++++ R+ 
Sbjct: 362 KGEISQPVHSNFGWHLIQLLGTRQVDRTDEAQKERAYRI-LFNRKFAEEAQTWLQEQRAA 420

Query: 312 A 312
           A
Sbjct: 421 A 421


>gi|295689679|ref|YP_003593372.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Caulobacter segnis
           ATCC 21756]
 gi|295431582|gb|ADG10754.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Caulobacter segnis
           ATCC 21756]
          Length = 452

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 47/292 (16%), Positives = 105/292 (35%), Gaps = 21/292 (7%)

Query: 39  SSRIRTTINGEVITDGDISKRIALL----KLQKINGEL---EKIAVQELIVETLKKQEIE 91
           S  +   +N ++I+  D+ +R+ LL     +Q     L   ++ A++ LI E L+ QE+ 
Sbjct: 57  SESVAAVVNDDIISSYDLMQRMRLLMATSGMQPTQENLPQIQQEALRSLIDERLQMQELR 116

Query: 92  KSG------ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           +        I      V+      A++  ++++     L +QGIG + ++  L   S W 
Sbjct: 117 RVEKQQKITIISTDKEVDEQVADIAQSNKMTSDQLKQSLVQQGIGLDTWRAQLRADSSWQ 176

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             ++  +  +    E +I A ++++       +Y I  V                     
Sbjct: 177 SWIQGRYGSRLRIGEDQIKAYQRRLAESAAKPQYQISEVFLDASRVGGMEVAVNGAAQLI 236

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVT 263
           A+  +           +F+      + G   ++ + ++  +    L++      + P   
Sbjct: 237 AQMQQG--APFAAVARQFSGSATAANGGDVGWVNQGEMPTEVDEALEQLRPGQLSRPIQV 294

Query: 264 QKGVEYIAICDKRDLG----GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
           + GV  I + DKR        ++   A     +          + +  LR  
Sbjct: 295 KDGVYIIYLRDKRAGSKTAIVDLKQVAAPLPADATEAQVAAATKLLTDLRPK 346



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 49/133 (36%), Gaps = 2/133 (1%)

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
             + P      +  V    K   + R ++   C  LE  A K+  +  G       +DL 
Sbjct: 319 QVAAPLPADATEAQVAAATKLLTDLRPKI-NSCQTLETVAGKVDGLVAGDLGEAEITDLA 377

Query: 244 PQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA 302
           P FQ    K      ++P  T  G+  IA+C KR  G        +  +    ++     
Sbjct: 378 PAFQEAASKLDIGQISDPIRTDAGLHLIAVCGKRQGGANAPTHDQIENRLRGQQLALISK 437

Query: 303 EYVKKLRSNAIIH 315
            Y++ LR+ A I 
Sbjct: 438 RYLRDLRNQATIE 450


>gi|121596392|ref|YP_988288.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidovorax sp. JS42]
 gi|120608472|gb|ABM44212.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Acidovorax sp. JS42]
          Length = 471

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 48/309 (15%), Positives = 109/309 (35%), Gaps = 17/309 (5%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI-ALLKLQKINGE------- 71
               +       +  +   +  I   +N E IT+ ++ +R   +++     G        
Sbjct: 47  SAATLLPPAGATASNAPRQADYIVAVVNSEPITNNEVRQRTERVVQQIASQGGQVPPQEL 106

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L K  ++ LI+E ++ Q+ +++GI  D   VN      AR   +S ++    L   GI  
Sbjct: 107 LAKEVLERLILEKIQVQQAKETGIKVDDYAVNQAEQSVARQNSISVDEMHRRLAADGISK 166

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR---EYLIRTVLFSIP 188
             F++ L  Q +   + + D   +    ++E+    ++ +        E  +  +L  +P
Sbjct: 167 ERFREELRNQLLALRLRERDVESRVRVSDLEVDQYLREQRQAAGPGKLELNLGHILVKVP 226

Query: 189 DNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           +N   ++      R ++A               +++      + G             F 
Sbjct: 227 ENAGPDEVAQRSARAQEALAKVQAGGDFGAVAREYSDAPEGANGGLLGLRPADRYPELFV 286

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIAL----KAYLSAQNTPTKIEKHEA 302
           N  +++   +   P  +  G   + + DK   G           ++  +      E+  A
Sbjct: 287 NATQQASVGSVVGPVRSPSGFHILKVVDKTQSGVPTTAVQSHARHILLRTNANLSERQAA 346

Query: 303 EYVKKLRSN 311
           E ++ LR  
Sbjct: 347 ERLEDLRDR 355



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 56/152 (36%), Gaps = 5/152 (3%)

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
           Q     T  +   R +L     N   ++    +R++D  +   R   D   L +  S+  
Sbjct: 317 QSGVPTTAVQSHARHILLRT--NANLSERQAAERLEDLRDRVARGGADFAALAREYSQDG 374

Query: 228 DVS-IGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
                G   +       P+F+  L        + P V++ GV  I + ++R+       +
Sbjct: 375 SAKDGGDLGWASPGRYVPEFEEALNALRPGEISRPVVSRFGVHLIQLLERREAKLTQREQ 434

Query: 286 AYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             +        K+++  A ++++ R  A + Y
Sbjct: 435 REMVRDTVREKKLDEAFATWIQEARGRAYVEY 466


>gi|157368971|ref|YP_001476960.1| peptidyl-prolyl cis-trans isomerase SurA [Serratia proteamaculans
           568]
 gi|157320735|gb|ABV39832.1| SurA domain [Serratia proteamaculans 568]
          Length = 432

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 101/276 (36%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING-- 70
           +K   T  + ++ C     ++ +     ++   ++  V+ + D+S  +  +KL       
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLESDVSTLLQSVKLNAQQAGQ 58

Query: 71  ------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GI      ++      A    +S +   S L
Sbjct: 59  QLPDDKTLRHQILERLIMDNIQLQMAKKMGINVSDADLDKAIGNIAAQNKMSIDQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
             +G+  N ++  +  + +  +V  N+   +   L  E+   A +   +N +  E  I  
Sbjct: 119 AYEGLNYNTYRSQIRKEMLISEVRNNEVRRRVTILPQEVDSLAAQVGAQNGSDTEMNISH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +       +    D  KL    S        G   +    +
Sbjct: 179 ILIPLPENPSQAQVDDAEALAKKLMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQE 238

Query: 242 LHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F   L+   + +   P  +  G   + + D R
Sbjct: 239 IPTLFAERLVNAKKGDVVGPIRSGVGFHILKVNDIR 274



 Score = 73.5 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 39/295 (13%), Positives = 86/295 (29%), Gaps = 57/295 (19%)

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE-------------- 118
                +E+++  ++  E+ +  +T     V+    Q     G   E              
Sbjct: 129 RSQIRKEMLISEVRNNEVRRR-VTILPQEVDSLAAQVGAQNGSDTEMNISHILIPLPENP 187

Query: 119 ---DFSSF----------------LDKQGIGDNHFKQYLAIQ-SIWP-----------DV 147
                                     K  I  +   Q L      W             +
Sbjct: 188 SQAQVDDAEALAKKLMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQEIPTLFAERL 247

Query: 148 VKNDFMLKYGNLEM-------EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
           V        G +         ++   +   ++++V E   R +L   P   L +     K
Sbjct: 248 VNAKKGDVVGPIRSGVGFHILKVNDIRGANQSVSVTEVHARHILLK-PSVVLTDDQARAK 306

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQN-LLKKSQNNTT 258
             + AE  +    K  ++ ++ +         G   +       P F++ L+K S+   +
Sbjct: 307 LQEVAEAIKSGRAKFADEAKQLSQDPGSALQGGDLGWASPDIYDPAFRDALMKLSKGEVS 366

Query: 259 NPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
            P  +  G   I + D R +    A +   + +     K  +    ++++ R+ A
Sbjct: 367 QPVHSSFGWHLIQLLDTRQVDKTDAAQKDRAYRMLFNRKFAEEAQTWMQEQRAQA 421


>gi|238918641|ref|YP_002932155.1| peptidyl-prolyl cis-trans isomerase SurA [Edwardsiella ictaluri
           93-146]
 gi|238868209|gb|ACR67920.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 434

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 37/268 (13%), Positives = 102/268 (38%), Gaps = 12/268 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +    ++ +  +  ++   ++  V+ + D+   +  +KL              L
Sbjct: 7   LILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGMMKSVKLNAQQAGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  ++ G+    + ++      A+   +S +   S L   G+   
Sbjct: 67  RHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIAQQNHISMQQLRSRLAADGLDYK 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQ-KMKNITVREYLIRTVLFSIPDN 190
            ++  +  + +  +V  N+   +   L  E+ A  KQ   +N       +  +L  +P+N
Sbjct: 127 TYRDQIRKEMLISEVRNNEVRSRVTILPQEVDALAKQIGSQNSGETAVNLSHILIPLPEN 186

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
             Q Q    ++  ++   +L       K    +++    +  G+  +    +L   F   
Sbjct: 187 PTQQQVSEAQKQAESLIQQLHQGASFAKLAAAYSADPQALKGGEMGWGRLQELPTLFAEA 246

Query: 250 LK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           L+   + +   P  +  G   + + D R
Sbjct: 247 LQSAKKGDIVGPIRSGVGFHILRVNDLR 274



 Score = 67.0 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 39/328 (11%), Positives = 93/328 (28%), Gaps = 67/328 (20%)

Query: 46  INGEV----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           ING      I+   +  R+A   L            +E+++  ++  E+ +S +T     
Sbjct: 100 INGIAQQNHISMQQLRSRLAADGLDYK--TYRDQIRKEMLISEVRNNEV-RSRVTILPQE 156

Query: 102 VNYFFVQHARNT-----------------GLSAEDFSSFLDKQGIGDNHFKQ-----YLA 139
           V+    Q                        + +  S    +         Q      LA
Sbjct: 157 VDALAKQIGSQNSGETAVNLSHILIPLPENPTQQQVSEAQKQAESLIQQLHQGASFAKLA 216

Query: 140 I------------QSIWPDV------------------VKNDFMLKYGNLEMEIPANKQK 169
                        +  W  +                  +        G   + +   +  
Sbjct: 217 AAYSADPQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDLRGD 276

Query: 170 MKNITVREYLIRTVLFSIPD--NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
             +++V E   R +L       +  Q +  ++      +  ++   +   +  +      
Sbjct: 277 QASVSVTEVHARHILLRPSPVMSDTQARAKLEALSAQIKSGQITFEQAAKEYSQDPGSAQ 336

Query: 228 DVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDL--GGEIAL 284
               G   + + S   P F++ L+K ++   + P  +  G   I + D R +    E   
Sbjct: 337 --KGGDLGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQLLDTRQVDRTDEAQK 394

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
           +          K  +    ++++ R+ A
Sbjct: 395 ERAYRM-LFNRKFAEEAQTWLQEQRAAA 421


>gi|209964864|ref|YP_002297779.1| peptidyl-prolyl cis-trans isomerase family protein, putative
           [Rhodospirillum centenum SW]
 gi|209958330|gb|ACI98966.1| peptidyl-prolyl cis-trans isomerase family protein, putative
           [Rhodospirillum centenum SW]
          Length = 433

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/315 (15%), Positives = 102/315 (32%), Gaps = 12/315 (3%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL----K 64
           L     L        +       + +      R    +N EVI+  D+  R+ +      
Sbjct: 13  LPTAAALCGVLLCAGVLLAGRPAAAQGQGPVERAAALVNEEVISMSDLMNRLQMALSSSG 72

Query: 65  LQKINGELEK---IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFS 121
           L       ++     ++ LI E L+ QE  +  I      ++      A+   LS  +F 
Sbjct: 73  LPDTPETRQRLLPQVLRLLIDEVLQIQEARRLEIRVTEQDIDRALENLAQQNRLSLGEFQ 132

Query: 122 SFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK-NITVREYLI 180
             LD  G+     +Q L     W  +V+          + E+ A  +++K N    EYL+
Sbjct: 133 RLLDASGVPVASLRQQLLASVAWSRLVQRRIRPTVSVSDDEVQAQLERIKANAGKPEYLV 192

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLES 240
             +  ++ D+   N+  V +      E             +F+      + G   +L + 
Sbjct: 193 SEIFLAVDDDA--NEAEVSRLADRLVEQIAGGANFGAVARQFSQSAGAFTGGDLGWLQQG 250

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS-AQNTPTKIE 298
            L       +++      + P     G   + + D+R +         ++  Q       
Sbjct: 251 QLEQALDTAVQQLQPGQFSRPIRGVNGYHILWLRDQRAVAAGNPADIQVAVGQLVLPADP 310

Query: 299 KHEAEYVKKLRSNAI 313
            +    ++  R  A 
Sbjct: 311 ANPEAGLEAARQIAQ 325



 Score = 46.6 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 56/155 (36%), Gaps = 10/155 (6%)

Query: 164 PANKQKMKNITVREYLIRTVLFSI-PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
                   N    +  +  ++    P N        ++  ++A          C+ L   
Sbjct: 285 DQRAVAAGNPADIQVAVGQLVLPADPANPEAGLEAARQIAQEA--------ASCDALSAA 336

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
           A +I     G+A      DL  +  +++        T P++T +G+  + +CD+    G 
Sbjct: 337 AQRIPGAQQGQAPLTRLGDLPAEISSIVGALGVGTPTQPFLTDRGIMILMVCDRMVPEGS 396

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I     +       +IE  +  Y++ LR +A I Y
Sbjct: 397 IPPADQVRDAIAGERIEMLQRRYLRDLRRDATIEY 431


>gi|154706423|ref|YP_001425383.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii Dugway
           5J108-111]
 gi|154355709|gb|ABS77171.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii Dugway
           5J108-111]
          Length = 321

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 67/327 (20%), Positives = 117/327 (35%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK-- 58
           M  K+ TS+   + +  T         +P  +        +I   +N E+IT  +++   
Sbjct: 1   MWKKILTSMVIILSV--TSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 59  ---RIALLKLQ---KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
              +   ++ Q         +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMK 171
             LS       L ++GI    F+  L  Q I   +            + +I A  KQ   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
            I   EY I T+L  +P +  Q Q    K        +L+         K      D   
Sbjct: 179 QIASTEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMKMHPGSAD--- 235

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 236 --LGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|71909270|ref|YP_286857.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Dechloromonas
           aromatica RCB]
 gi|122070644|sp|Q479U4|SURA_DECAR RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|71848891|gb|AAZ48387.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Dechloromonas
           aromatica RCB]
          Length = 438

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/313 (15%), Positives = 116/313 (37%), Gaps = 21/313 (6%)

Query: 20  FVLIIFCIVPIVSYKSWAM------SSRIRTTINGEVITDGDISKR--IALLKLQKINGE 71
            +L+I C+  +++    A       + RI   +  +VIT  ++  R   AL +LQK    
Sbjct: 11  LILLICCLGGMLAQPLSAAPQDPVEADRIVAVVGSDVITYFELRTRLTAALKQLQKQGTP 70

Query: 72  L------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
           L      E+  ++ LI+E  + Q   ++G+  D   ++    + A    ++   F + L+
Sbjct: 71  LPPQDVLERQMLERLIMERAQLQYGRETGMKIDDTQLDLAIGRIAAGNKMTVPQFRAALE 130

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNITVREYLIRTVL 184
           K G+    F++ +  + +   + + +   K    E EI      +    +  EY +  +L
Sbjct: 131 KDGVQYAQFREEIRNEMVTVRLREREVDSKLVISEGEIDNYLANQTATGSEEEYQLAHIL 190

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLH 243
              P++    Q    ++  +    R R  ++  +L    S   D    G   +   + L 
Sbjct: 191 LRAPESATPEQLQKLRQRGEQALKRARAGENFAQLTAAFSDAPDALQGGDLGWRPLARLP 250

Query: 244 PQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIE 298
             +     +      ++   +  G   + +  KR        +     ++  +++    E
Sbjct: 251 ALYAEAGSRLQSGEVSDLLRSSAGFHIVKLVSKRGGSAPASVQQTHARHILIRSSEVLSE 310

Query: 299 KHEAEYVKKLRSN 311
                 ++ +R  
Sbjct: 311 AEATRKLEAVRER 323



 Score = 58.1 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/172 (14%), Positives = 63/172 (36%), Gaps = 8/172 (4%)

Query: 148 VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEE 207
           V +      G   +++ + +      +V++   R +L     +          R  +A  
Sbjct: 265 VSDLLRSSAGFHIVKLVSKRGGSAPASVQQTHARHILI---RSSEVLSEAEATRKLEAVR 321

Query: 208 SRLRLPKDCNKLEKFASKI-HDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQK 265
            R+    D  +  +  S+       G+  +L   D  P+F+  +   + N  +    +  
Sbjct: 322 ERIANGVDFAEQARLYSQDGSAAKGGELGWLNPGDTVPEFERAMDALKINEVSQVVQSPF 381

Query: 266 GVEYIAI--CDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           G+  I +    +RD+  E   +A         K+++   +++++LR    + 
Sbjct: 382 GMHLIQVLERRERDVSAER-QRAVARQALRERKLDEAYQDWLRQLRDRTYVE 432


>gi|83648743|ref|YP_437178.1| parvulin-like peptidyl-prolyl isomerase [Hahella chejuensis KCTC
           2396]
 gi|122070647|sp|Q2S9C1|SURA_HAHCH RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|83636786|gb|ABC32753.1| Parvulin-like peptidyl-prolyl isomerase [Hahella chejuensis KCTC
           2396]
          Length = 434

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/287 (15%), Positives = 115/287 (40%), Gaps = 21/287 (7%)

Query: 40  SRIRTTINGEVITDGDISKRIALLK--LQKINGELEKIA------VQELIVETLKKQEIE 91
            R+   +N +++   ++  R + +K  L++    L   A      + +L++E+++ Q  +
Sbjct: 35  DRVVAVVNDDIVLYSELQDRASRIKDKLRQQKTPLPPEAVLHEKVLDQLVLESIQMQMAD 94

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           + GI    + +N      A+  G++ + F   L ++G+     ++ +  + I   V +  
Sbjct: 95  RGGIRVSDSQLNQTMQNIAKQNGMTLDQFQQALSEEGVTYQSAREQIRREMIISRVQQRS 154

Query: 152 FMLKYGNLEMEIP--ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
              +    E E+         K     EY +  +L ++P+N   +    ++     E+ R
Sbjct: 155 VDSRVRVTEKEVNDFLKSASAKEQRAEEYHLAHILIALPENP--SDAQRKEAESKVEKIR 212

Query: 210 LRLPKDCNKLEKFASKIHDVS----IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQ 264
            +L +     ++ A    D S     G   +     +   F ++  K +   T+ P    
Sbjct: 213 SQLDQG-VDFKQLAITYSDASTATQGGDLGWRKPDQVPSLFADVAPKLAPGQTSEPIRNS 271

Query: 265 KGVEYIAICDKRDLGGEIALKAYLSAQNTPT---KIEKHEAEYVKKL 308
            GV ++A+ +KR    ++  ++ +          + E    + ++++
Sbjct: 272 SGVHFVAMLEKRGGVSKVVEQSKVRHILVQQNELRDEIAAKKLIEEI 318



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 62/155 (40%), Gaps = 7/155 (4%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
             K+   +  V +  +R +L               K++ +    +++  +D  +L K  S
Sbjct: 280 LEKRGGVSKVVEQSKVRHILV---QQNELRDEIAAKKLIEEIYGKVQAGEDFAELAKAYS 336

Query: 225 --KIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-G 280
              +   + G   ++   D+ P+F  +++++     + P+ +  G   + + D+R+   G
Sbjct: 337 DDAVSAAAGGSLDWVNPGDMVPEFDQMMRETPVGAVSKPFQSTFGWHILQVQDRREADIG 396

Query: 281 EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +  + +         K E+    ++ ++R  A + 
Sbjct: 397 DRLMASQARQVLHRRKYEEELQNWLSEIRDEAFVQ 431


>gi|122070665|sp|Q9I5U3|SURA_PSEAE RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 417

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/302 (15%), Positives = 111/302 (36%), Gaps = 15/302 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGELE------KIA 76
             ++   ++       R+   ++ +VI    + +R+  +   L K    L       +  
Sbjct: 3   AALLCSFAHAEVVPLDRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVLTQQV 62

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LI+E +++Q  ++SGI      +N      A+  G+S E F + L + G+     ++
Sbjct: 63  LERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLEQFQTALTRDGLSYADARE 122

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQN 194
            +  + +   V +     +    E E+         K     EY +  +L  +P+    +
Sbjct: 123 QVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEAASSD 182

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS 253
                 R       +L+   D  +L    ++  + +  G+  +   + L   F +++   
Sbjct: 183 VIQAAARQAQELYQQLKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSL 242

Query: 254 Q-NNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLR 309
              + T P  T  G   + + +KR       +     ++  + +  + E    +  +KL 
Sbjct: 243 AVGDVTEPVRTPGGFIILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLAQKLY 302

Query: 310 SN 311
             
Sbjct: 303 ER 304



 Score = 69.3 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 58/154 (37%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+    +   E  +R +L    +          +++      R++  +D  +L K  S+
Sbjct: 264 EKRGGSKMVRDEVHVRHILLKPSE---IRSEAETEKLAQKLYERIQSGEDFGELAKSFSE 320

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G   ++    L P+F+ ++    Q   + P+ +Q G   + +  +R     E
Sbjct: 321 DPGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSE 380

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +     K ++    +++++R  A + 
Sbjct: 381 KFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVE 414


>gi|212213438|ref|YP_002304374.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuG_Q212]
 gi|212011848|gb|ACJ19229.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuG_Q212]
          Length = 321

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 67/327 (20%), Positives = 117/327 (35%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK-- 58
           M  K+ TS+   + +  T         +P  +        +I   +N E+IT  +++   
Sbjct: 1   MWKKILTSMVVILSV--TSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 59  ---RIALLKLQ---KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
              +   ++ Q         +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKKVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMK 171
             LS       L ++GI    F+  L  Q I   +            + +I A  KQ   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
            I   EY I T+L  +P +  Q Q    K        +L+         K      D   
Sbjct: 179 QIASTEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMKMHPGSAD--- 235

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 236 --LGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|164685824|ref|ZP_01945801.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165918731|ref|ZP_02218817.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 334]
 gi|212219488|ref|YP_002306275.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuK_Q154]
 gi|164601340|gb|EAX33680.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165917559|gb|EDR36163.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 334]
 gi|212013750|gb|ACJ21130.1| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii CbuK_Q154]
          Length = 321

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/327 (20%), Positives = 117/327 (35%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK-- 58
           M  K+ TS+   + +  T         +P  +        +I   +N E+IT  +++   
Sbjct: 1   MWKKILTSMVIILSV--TSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 59  ---RIALLKLQ---KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
              +   ++ Q         +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMK 171
             LS       L ++GI    F+  L  Q I   +            + +I A  KQ   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
            I   EY I T+L  +P +  Q Q    K        +L+         K      D   
Sbjct: 179 QIASTEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMKMHPGSAD--- 235

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   + + DK            +  
Sbjct: 236 --LGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIVKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|163802667|ref|ZP_02196558.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Vibrio sp. AND4]
 gi|159173555|gb|EDP58375.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Vibrio sp. AND4]
          Length = 427

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/267 (17%), Positives = 114/267 (42%), Gaps = 15/267 (5%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELE 73
           LI+  ++      + A   ++   +N  VI   DI   +  L+             G L+
Sbjct: 7   LIVTTLLSCGVTAAPAELDKVAVIVNDGVILQSDIDTAMKTLQANARQSGKSLPSAGVLK 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  V++LI++TL+ QE ++ G+  D N +N    + ARN   S E  ++ +  +G+  + 
Sbjct: 67  EQVVEKLIIDTLQGQEAKRIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQMEGLNYSE 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+ +   ++   T    +Y I  +     D+K
Sbjct: 127 FREQIRKEIAASEARNALVRRRINILPAEVDSLTDQLAQETNATVQYKIGHIQLRFSDDK 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
            +++   +    +A   +L+   D +++   ++     +  G   ++ + ++   F + +
Sbjct: 187 DKSEVEAE---ANALVKKLKAGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQI 243

Query: 251 K-KSQNNTTNPYVTQKGVEYIAICDKR 276
           K +++ N   P+ +  G   + I D +
Sbjct: 244 KMQNKGNIIGPFRSGIGFHILKIEDVK 270



 Score = 66.2 bits (160), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 59/154 (38%), Gaps = 12/154 (7%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH- 227
            ++ + V E   R +L   P   L + G      K+  E   R+        + A++   
Sbjct: 271 GLETVAVTEVNARHILIK-PTVILSDDGA----KKELNEFIRRIKAGEASFGQLATQYSQ 325

Query: 228 ----DVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GE 281
                   G+  +       P+F++ ++     + + P+ T  G   + + D+R +   +
Sbjct: 326 DPGSAAQNGELGFQTPDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTD 385

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            A+K          K  +    ++++LR++A + 
Sbjct: 386 SAIKNKAYRILFNRKFNEEAGAWMQELRASAFVE 419


>gi|215919309|ref|NP_820955.2| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 493]
 gi|206584194|gb|AAO91469.2| peptidyl-prolyl cis-trans isomerase [Coxiella burnetii RSA 493]
          Length = 321

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 67/327 (20%), Positives = 118/327 (36%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK-- 58
           M  K+ TS+   + +  T         +P  +        +I   +N E+IT  +++   
Sbjct: 1   MWKKILTSMVIILSV--TSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 59  ---RIALLKLQ---KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
              +   ++ Q         +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMK 171
             LS       L ++GI    F+  L  Q I   +            + +I A  KQ   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
            I  +EY I T+L  +P +  Q Q    K        +L+         K      D   
Sbjct: 179 QIASKEYHIATILIPLPASATQAQINHAKGKAALVLKQLQKGSSFETAMKMHPGSAD--- 235

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 236 --LGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|254509382|ref|ZP_05121467.1| chaperone SurA [Vibrio parahaemolyticus 16]
 gi|219547690|gb|EED24730.1| chaperone SurA [Vibrio parahaemolyticus 16]
          Length = 431

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/275 (16%), Positives = 104/275 (37%), Gaps = 13/275 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL-QKINGE 71
           +K      + +       ++Y       +I   +N  VI + DI   I  LK   + NG+
Sbjct: 1   MKFWKKSLLALFAASQFTLAYAQPVALDKINVIVNSGVILESDIDTSIKTLKANARKNGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +   ++LI++TL++QE E+ G+  D N +N    + A+N   + E  S  +
Sbjct: 61  GLPEQEVLRQQVTEKLIIDTLQQQEAERIGVRIDDNRLNQAIEEIAKNNNQTIEQLSDSI 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRT 182
             +G+  + F++ +  +    +        +   L  E+      +   T    +Y I  
Sbjct: 121 AAEGLEYSEFREQVRKEIAATEARNALVRRRINILPAEVDNLANILAQETNATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +   +  N   +   ++K+ KD                 ++     +  G   ++ + ++
Sbjct: 181 IQLRV--NDGDDASALEKQAKDIVAKLKEGADFATMAYTYSKGPKALQGGDWGWMRKEEM 238

Query: 243 HPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR 276
              F + +    + +   P+ +  G   + I D +
Sbjct: 239 PTIFADNINLENKGSVIGPFRSGVGFHILKIDDVK 273



 Score = 69.3 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 60/151 (39%), Gaps = 6/151 (3%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
            ++ + V E   R +L  I    + +   VQK + +  E          +L +  S+   
Sbjct: 274 GLETVAVTEVNARHIL--IRPTVILSDEGVQKELNEIIERIQAGEATFGELARQYSQDPG 331

Query: 229 VSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
            +   G+  Y       P+F++ +        + P+ T  G   + + D+R +   + A+
Sbjct: 332 SAAQNGELGYQTSDLYVPEFKHQVDTLPEGQISEPFKTVHGWHIVEVLDRRQVDRTDSAM 391

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           K          K  +  + ++++LR++A + 
Sbjct: 392 KNKAYRILFNRKFNEEASAWLQELRASAFVE 422


>gi|269137960|ref|YP_003294660.1| peptidyl-prolyl cis-trans isomerase SurA [Edwardsiella tarda
           EIB202]
 gi|267983620|gb|ACY83449.1| peptidyl-prolyl cis-trans isomerase SurA [Edwardsiella tarda
           EIB202]
 gi|304558008|gb|ADM40672.1| Survival protein SurA precursor [Edwardsiella tarda FL6-60]
          Length = 435

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 117/310 (37%), Gaps = 18/310 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------L 72
           +++   +    ++ +  +  ++   ++  V+ + D+   +  +KL     +        L
Sbjct: 7   LILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGMMKSVKLNAQQADQQLPDNATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ ++ Q  ++ G+    + ++      A+   +S +   S L   G+   
Sbjct: 67  RHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIAQQNHISMQQLRSRLAADGLDYK 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQ-KMKNITVREYLIRTVLFSIPDN 190
            ++  +  + +  +V  N+   +   L  E+ A  KQ   +N       +  +L  +P+N
Sbjct: 127 TYRAQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQIGSQNSGETAVNLSHILIPLPEN 186

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNL 249
             Q Q    ++  ++   +L       K    +++    +  G+  +    +L   F   
Sbjct: 187 PTQQQVSEAQQQAESLIQQLHQGASFAKLAAAYSADPQALKGGEMGWGRLQELPTLFAEA 246

Query: 250 LK-KSQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPTKIEKHEAEY 304
           L+   + +   P  +  G   + + D R    ++        ++  + +P   +      
Sbjct: 247 LQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVSVTEVHARHILLRTSPVMSDAQARAK 306

Query: 305 VKKLRSNAII 314
           ++ L  +A I
Sbjct: 307 LEAL--SAQI 314



 Score = 71.6 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 41/331 (12%), Positives = 92/331 (27%), Gaps = 73/331 (22%)

Query: 46  INGEV----ITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNT 101
           ING      I+   +  R+A   L            +E+++  ++  E+ +  +T     
Sbjct: 100 INGIAQQNHISMQQLRSRLAADGLDYK--TYRAQIRKEMLISEVRNNEVRRR-VTILPQE 156

Query: 102 VNYFFVQHARNT------GLS---------------------AEDFSSFLDKQGI----- 129
           V+    Q            LS                     AE     L +        
Sbjct: 157 VDALAKQIGSQNSGETAVNLSHILIPLPENPTQQQVSEAQQQAESLIQQLHQGASFAKLA 216

Query: 130 -----GDNHFKQYLAIQSIWPDV------------------VKNDFMLKYGNLEMEIPAN 166
                     K     +  W  +                  +        G   + +   
Sbjct: 217 AAYSADPQALKG---GEMGWGRLQELPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDL 273

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           +    N++V E   R +L     + + +    + +++              +  K  S+ 
Sbjct: 274 RGDQANVSVTEVHARHILLRT--SPVMSDAQARAKLEALSAQITSGKITFEQAAKEYSQD 331

Query: 227 HDVS--IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDL--GGE 281
              +   G   + + S   P F++ L+K ++   + P  +  G   I +   R +    E
Sbjct: 332 PGSAQKGGDLGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQLLGTRQVDRTDE 391

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
              +          K  +    ++++ R+ A
Sbjct: 392 AQKERAYRM-LFNRKFAEEAQTWLQEQRAAA 421


>gi|307294654|ref|ZP_07574496.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingobium
           chlorophenolicum L-1]
 gi|306879128|gb|EFN10346.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingobium
           chlorophenolicum L-1]
          Length = 461

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 95/270 (35%), Gaps = 14/270 (5%)

Query: 44  TTINGEVITDGDISKRIALLKLQK-------INGELEKIAVQELIVETLKKQEIEKSGIT 96
             +NG +IT  D+ +R+AL+               L    ++ LI ETL+ QE   + I 
Sbjct: 73  AIVNGRIITGTDVDQRLALILTANGGKVSDEEKERLRVQVLRNLIDETLQIQEAAANDIK 132

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
            D   ++  + + A N   S   F  +L  QG      K+ +  +  W  +++ +     
Sbjct: 133 VDKAEIDQSYERVAANFRQSPSQFDQYLRAQGSSSASIKRQIEGELAWSRLLRRNIQPFV 192

Query: 157 GNLEMEIPANKQKMKNITVR-EYLIRTVLF-SIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
              E E+ +   +M       EY I  +   + P+N+ Q     +  I+  ++       
Sbjct: 193 NVSEDEVKSVVDRMNAAKGSDEYRIGEIYLSATPENQQQIVANARNIIEQIKQG----GS 248

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
                 +F+        G   ++  + L  +      + Q      P     GV  I + 
Sbjct: 249 FAAYARQFSEASTAAVGGDLGWVRPAQLPDELAQAAAEMQVGQLAGPIAVPGGVSIIYVM 308

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAE 303
           DKR +       A LS +           +
Sbjct: 309 DKRKVLTADPRDALLSLKQLSVSFPAGTTK 338



 Score = 56.2 bits (134), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 44/288 (15%), Positives = 93/288 (32%), Gaps = 33/288 (11%)

Query: 39  SSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQ-ELIVETLKK----QEIEKS 93
              +++ ++      G    RI  + L       ++I      I+E +K+        + 
Sbjct: 196 EDEVKSVVDRMNAAKGSDEYRIGEIYLSATPENQQQIVANARNIIEQIKQGGSFAAYARQ 255

Query: 94  GITFDSNTV--NYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
                +  V  +  +V+               L +            A +     +    
Sbjct: 256 FSEASTAAVGGDLGWVR--------PAQLPDELAQA-----------AAEMQVGQLAGPI 296

Query: 152 FMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
            +    ++   +   K    +       ++ +  S P    + Q            +++R
Sbjct: 297 AVPGGVSIIYVMDKRKVLTADPRDALLSLKQLSVSFPAGTTKEQASA---KAADFAAQIR 353

Query: 212 LPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPY-VTQKGVEY 269
             K C +  +   KI    +     +   DL PQ Q++L   Q    T P+     GV  
Sbjct: 354 TIKGCGQANELGGKI-GADVVDNDNVKLRDLPPQLQDILLNLQVGEATPPFGSISDGVRV 412

Query: 270 IAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           + +C + +     A  A  + AQ    ++ K    Y++ LR +A+I Y
Sbjct: 413 LVVCGRDEASSAAAPNAEQIMAQLEEERVNKRARIYLRDLRRDAVIDY 460


>gi|237749066|ref|ZP_04579546.1| chaperone SurA [Oxalobacter formigenes OXCC13]
 gi|229380428|gb|EEO30519.1| chaperone SurA [Oxalobacter formigenes OXCC13]
          Length = 459

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/295 (15%), Positives = 103/295 (34%), Gaps = 11/295 (3%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGEL--- 72
              +F   +             +   I   +N +VIT G++++R+ L++ Q     +   
Sbjct: 21  FGVFFSATVLAQDNQAQPSKQVVVDSIAAIVNSDVITKGELNERVTLVEAQLKQQNIALP 80

Query: 73  -----EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
                +K  ++ +IVE  + Q  +  G+  D   ++      A    +S   F    ++ 
Sbjct: 81  PRTEFQKQVLEHMIVERAQLQLAKDMGLRVDDTQLDRTIALMAEQNHMSLAQFKRQTEQN 140

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE-YLIRTVLFS 186
           G     F++ +  +     +   + + K    + E+         + + E   +  +L  
Sbjct: 141 GTPFEKFREKVREEITMSRLRDREVVNKIQINDAEVDNLLGADSQLQMPEQLRLGHILIR 200

Query: 187 IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQ 245
           IP+N    Q   ++   +     L+   D  +    ++     +S G   +     L   
Sbjct: 201 IPENASPEQIAEKRARAEKVLDVLKSGGDFQQTAASYSDADEGLSGGDIGWRSTDRLPKS 260

Query: 246 FQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEK 299
           F + L      N T    +  G   + + D+R +       A  S +NT  +I  
Sbjct: 261 FVDALAGVKPGNVTGIIKSPNGFHILKVLDRRKMTNGAESVASASDKNTVQQIHA 315



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 61/150 (40%), Gaps = 9/150 (6%)

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS- 230
             TV++   R +L  +  N+L +    ++++ D  +  +       +L K  S     S 
Sbjct: 307 KNTVQQIHARHILIKV--NQLVSADEAKRKLIDLRQRIINKSATFEELAKTYSNDGSASR 364

Query: 231 IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL- 288
            G   ++   D  P+F+  ++       + P  TQ G   I + DK+    +++ +    
Sbjct: 365 GGDLGWIYPGDTVPEFEKAMVALKPGEISEPIETQFGFHLIQVLDKK--TDDVSAERKRI 422

Query: 289 --SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                    K+ +   E++++LR  A + Y
Sbjct: 423 AAKQALRERKVAEATEEWLRQLRDKAYVEY 452


>gi|261855875|ref|YP_003263158.1| SurA domain protein [Halothiobacillus neapolitanus c2]
 gi|261836344|gb|ACX96111.1| SurA domain protein [Halothiobacillus neapolitanus c2]
          Length = 465

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/301 (17%), Positives = 109/301 (36%), Gaps = 17/301 (5%)

Query: 27  IVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ--------KINGELEKIAVQ 78
              +       M  RI   +N  VIT   ++ RI  +  Q            +LE+  + 
Sbjct: 40  AADLTPAAGEQMFDRIVAVVNQSVITQRQLNDRIQQVSSQINIQALSPSDFKQLEERVLD 99

Query: 79  ELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYL 138
            +I E ++ Q  ++ GIT D   ++      A+  G+S +     + +QG   N ++  +
Sbjct: 100 RMITEEVELQRAKQIGITVDEQRLDSALDGIAQRNGMSLDQLQQAVTRQGEDWNAYRDNI 159

Query: 139 AIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
             Q I  ++ + +   +    + +I     +    +    EY +  +L S+P+N   +Q 
Sbjct: 160 RKQIIIDELKRREVYERVDITDRDIDEYLKQYMGADTDTTEYHLAQILISVPENATPSQV 219

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLLKKSQ- 254
              K+  D   + L+  +D  K+    S   D +  G   +   S +   F + +K  + 
Sbjct: 220 ENAKKRADDVMAALKAGQDFAKVSAERSDAPDATKGGDLGWRDMSRIPGLFTDTVKSLKT 279

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNT-----PTKIEKHEAEYVKKLR 309
              +    +  G   + +  +R             A++        +         +KLR
Sbjct: 280 GEISGLIRSPNGFHILKLLGERKRTAGNTQLTEYEAEHVLIQVNGKRDATAAKAQAEKLR 339

Query: 310 S 310
            
Sbjct: 340 Q 340



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 59/157 (37%), Gaps = 12/157 (7%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+   N  + EY    VL  +   +             AE+ R  +        + ASK
Sbjct: 301 RKRTAGNTQLTEYEAEHVLIQVNGKRDATAA-----KAQAEKLRQEIISGKATFAEIASK 355

Query: 226 IHDVSI-----GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
             D        G   ++  SD+ P+F  +L+++     +  + TQ G  ++ +   R++ 
Sbjct: 356 YSDDKGSAQQGGLLGWVNPSDMVPEFATMLEQTPVGKISPVFQTQFGFHFLEVLKTREVQ 415

Query: 280 GEIAL-KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
                 +A         + ++    Y+++LR+ A I 
Sbjct: 416 VPTDKLRAQARQAIGQRRADEDLVNYIRRLRAEAYID 452


>gi|332185309|ref|ZP_08387058.1| PPIC-type PPIASE domain protein [Sphingomonas sp. S17]
 gi|332015033|gb|EGI57089.1| PPIC-type PPIASE domain protein [Sphingomonas sp. S17]
          Length = 475

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/268 (17%), Positives = 101/268 (37%), Gaps = 20/268 (7%)

Query: 44  TTINGEVITDGDISKRIALLKLQKI--------NGELEKIAVQELIVETLKKQEIEKSGI 95
             +N  V+T  D+ +R+AL                 L    +++LI ETL+ QE + + I
Sbjct: 85  AIVNDTVLTGTDLDQRMALAMALNNVTKLSPEDRDRLRMQILRQLIDETLQIQEAKSAEI 144

Query: 96  TFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLK 155
           T  +  ++  + + ++  G +    ++FL + G  +   ++ +  +  W   ++      
Sbjct: 145 TVTAPEIDQAYARFSQQFGKTPTQMTAFLRQVGSSERSMRRQIEGELAWNRYLRKRVEPF 204

Query: 156 YGNLEMEIPANKQKMKNITVR-EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
               + E+ A + +++      EY ++ +          N+   Q+   +A +    + K
Sbjct: 205 INVGDEEVNAIRARLEAAKGTEEYNLKEIFL------SANEATQQQVFANARQIIAEIQK 258

Query: 215 DCNKLEKFASKIHDVSIG----KAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEY 269
                E FA    + S         ++  + L P+ Q+  +  Q      P     G   
Sbjct: 259 GQQPFEYFARSFSEASTRAVNGDLGWVRAAQLPPELQSAAQSMQVGQVAGPIPIPGGFSI 318

Query: 270 IAICDKRDLGGEIALKAYLSAQNTPTKI 297
           + + DKR +       + LS +    K 
Sbjct: 319 LYLTDKRQVLTADPRDSRLSLKQLTIKF 346



 Score = 48.1 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 47/113 (41%), Gaps = 4/113 (3%)

Query: 207 ESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVT-Q 264
               +  + C  +E+ A+ +    +     +    L    Q +L K Q    T P+ + +
Sbjct: 363 AKATQAIRGCGDVERVATSLKAEVV-DNDQVTIRQLPAPLQEILLKMQIGQATPPFGSPE 421

Query: 265 KGVEYIAICDKRDL-GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +GV  + +CD+ +   G +     +  Q    ++     + ++ LR +A+I Y
Sbjct: 422 QGVRSLVLCDREEPRSGNLPTSDQIQNQVEQQRVNLRANQKMRDLRRDAVIEY 474


>gi|161830191|ref|YP_001595995.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 331]
 gi|161762058|gb|ABX77700.1| putative peptidyl-prolyl cis-trans isomerase surA [Coxiella
           burnetii RSA 331]
          Length = 321

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 67/327 (20%), Positives = 118/327 (36%), Gaps = 19/327 (5%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK-- 58
           M  K+ TS+   + +  T         +P  +        +I   +N E+IT  +++   
Sbjct: 1   MWKKILTSMVIILSV--TSISAFAQSTLPAPNATHEQSLDQIVAVVNDEIITQSELNHAL 58

Query: 59  ---RIALLKLQ---KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
              +   ++ Q         +K  + +LI + L+ Q  + + I   +N +N    + ++ 
Sbjct: 59  TAAKQQFMQRQISLPDQKTFKKQVLDQLIYQKLQLQVAKHNQIKVTNNEINAAVARISQA 118

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMK 171
             LS       L ++GI    F+  L  Q I   +            + +I A  KQ   
Sbjct: 119 NHLSQTALKQKLTQEGISYKEFRSQLQKQLIISKLQHQALQDTISINKSDIAAFQKQHAG 178

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI 231
            I  +EY I T+L  +P +  Q Q    K        +L+         K      D   
Sbjct: 179 QIASKEYHIATILIPLPASATQAQINHAKGKAALILKQLQKGSSFETAMKMHPGSAD--- 235

Query: 232 GKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSA 290
               +    +L   F + +LK   N  T P     G   I + DK            +  
Sbjct: 236 --LGWRSAKELPQVFVKTVLKMKPNEVTGPIQAPNGFHIIKLLDKE--AKNTVSDQQIQR 291

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHYY 317
                K+EK   +++ +LRS+A IH Y
Sbjct: 292 IVYQQKVEKALQKWLTQLRSSAYIHIY 318


>gi|255020576|ref|ZP_05292639.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Acidithiobacillus caldus ATCC 51756]
 gi|254969961|gb|EET27460.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Acidithiobacillus caldus ATCC 51756]
          Length = 479

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 109/278 (39%), Gaps = 14/278 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGE---------LEKIAVQELIVETLKKQEI 90
            ++   +N ++IT   +++R+A ++ +    +         L +  +Q++I++ ++ Q  
Sbjct: 74  DKVVAVVNDDIITSLQLAQRVAAIRARLQQQDPNALPPEEVLRRQVLQQMILQDVELQIA 133

Query: 91  EKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
           +++GI  D  T++      AR   L+ +     L +QG     F+  L  + +   + + 
Sbjct: 134 KRAGIKVDQATLDQAIGNIARANNLTPDQLRQALAQQGQSWTQFEDDLRDRILVDRLTQQ 193

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
           +   +      E+    +++K +    + ++ +   +PDN   +     +R       RL
Sbjct: 194 EVESRIHIGPDEVKTFARQLKELGGVSFDLQQIFIPLPDNPTPDAISAARRQAQEIRDRL 253

Query: 211 RLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVE 268
                 ++L    S   D    G+  ++  ++L P   Q L+       +       G  
Sbjct: 254 EAGASFSRLAAEVSSSRDALQGGRLGWVKAAELPPAISQTLMSLKPGEISPVIPGPTGFH 313

Query: 269 YIAICDKR---DLGGEIALKAYLSAQNTPTKIEKHEAE 303
              + D +       E+   A +   +   ++++ EA 
Sbjct: 314 IFKVLDTKHEEPTVTEVKAAAIVLRASNGLQLQEAEAR 351



 Score = 49.7 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/150 (12%), Positives = 51/150 (34%), Gaps = 5/150 (3%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH- 227
           K +  TV E     ++    +     +   + R +D E +     +      +++     
Sbjct: 321 KHEEPTVTEVKAAAIVLRASNGLQLQEA--EARAQDIETALQGGTRFSELARRYSQDPST 378

Query: 228 DVSIGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALK 285
             + G+  ++    L  +  + LL       ++P      +  +    +R +  G+  + 
Sbjct: 379 AAAGGELGWVAPGKLPDELERTLLALQPGAVSSPVRVGDAIYILQAQAQRQVPVGDEQIL 438

Query: 286 AYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           A    Q       +   E+ +++R  A + 
Sbjct: 439 AAARMQLYNRIARQRLEEWQRRIRDGAYVE 468


>gi|222112631|ref|YP_002554895.1| sura domain-containing protein [Acidovorax ebreus TPSY]
 gi|221732075|gb|ACM34895.1| SurA domain protein [Acidovorax ebreus TPSY]
          Length = 471

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/309 (15%), Positives = 109/309 (35%), Gaps = 17/309 (5%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI-ALLKLQKINGE------- 71
               +       +  +   +  I   +N E IT+ ++ +R   +++     G        
Sbjct: 47  SAATLLPPAGATASNAPRQADYIVAVVNSEPITNNEVRQRTERVVQQIASQGGKVPPQEL 106

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L K  ++ LI+E ++ Q+ +++GI  D   V+      AR   +S ++    L   GI  
Sbjct: 107 LAKEVLERLILEKIQVQQAKETGIKVDDYAVSQAEQSVARQNSISVDEMHRRLAADGISK 166

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR---EYLIRTVLFSIP 188
             F++ L  Q +   + + D   +    ++E+    ++ +        E  +  +L  +P
Sbjct: 167 ERFREELRNQLLALRLRERDVESRVRVSDLEVDQYLREQRQAAGPGKLELNLGHILVKVP 226

Query: 189 DNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQ 247
           +N   ++      R ++A               +++      + G             F 
Sbjct: 227 ENAGPDEVAQRSARAQEALAKVQAGGDFGAVAREYSDAPEGANGGLLGLRPADRYPELFV 286

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIAL----KAYLSAQNTPTKIEKHEA 302
           N  +++   +   P  +  G   + + DK   G           ++  +      E+  A
Sbjct: 287 NATQQASVGSVVGPVRSPAGFHILKVVDKTQSGVPTTAVQSHARHILLRTNANLSERQAA 346

Query: 303 EYVKKLRSN 311
           E ++ LR  
Sbjct: 347 ERLEDLRDR 355



 Score = 68.1 bits (165), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 57/152 (37%), Gaps = 5/152 (3%)

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
           Q     T  +   R +L     N   ++    +R++D  +   R   D   L +  S+  
Sbjct: 317 QSGVPTTAVQSHARHILLRT--NANLSERQAAERLEDLRDRVARGGADFAALAREYSQDG 374

Query: 228 DVS-IGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
                G   +       P+F+  L        + P V++ GV  I + ++R+    +   
Sbjct: 375 SAKDGGDLGWASPGRYVPEFEEALNALRPGEISRPVVSRFGVHLIQLLERREAKLTQREQ 434

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +  +       K+++  A ++++ R  A + Y
Sbjct: 435 RDMVRDTVREKKLDEAFATWIQEARGRAYVEY 466


>gi|296532230|ref|ZP_06894978.1| peptidyl-prolyl cis-trans isomerase [Roseomonas cervicalis ATCC
           49957]
 gi|296267447|gb|EFH13324.1| peptidyl-prolyl cis-trans isomerase [Roseomonas cervicalis ATCC
           49957]
          Length = 401

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/267 (19%), Positives = 94/267 (35%), Gaps = 13/267 (4%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------LEKIAVQELIVETLK 86
            + A  + I   +NG+V+T G+++ R  L  L    G        L     + L+ E L+
Sbjct: 2   AAPAQVNSIVAVVNGDVVTAGEVAGRARLFALNAGMGPAPDVVQRLRPQVTRLLVDERLR 61

Query: 87  KQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD 146
            QE+++ GI      V     +     GL        L   GI        +  Q  W  
Sbjct: 62  MQEVQRRGIPVPDEDVAEAVQEIESRNGLPRGGLVGQLRAAGIPPRALFDQIRNQIGWSR 121

Query: 147 VVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
           +V+     +      E+       K  T   EYL+  +   + D+         +R  + 
Sbjct: 122 LVRAQLGQQAQISPAEVAEFVAAHKARTGQPEYLVSEIFIPV-DDPGAEPEV--RRFVED 178

Query: 206 EESRLRLPKDC-NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
              +LR          +F+     +  G   ++   +  P   ++L++       NP   
Sbjct: 179 VVGQLRRGVPFPAAATQFSQSQTALQGGDMGWVRGEEFDPGVASILERMPPGAIANPQRV 238

Query: 264 QKGVEYIAICDKRDLGGEIALKAYLSA 290
             G + +A+  KR+ G ++A    L  
Sbjct: 239 PGGFQIVALRQKRETGRDLATMVTLRQ 265


>gi|85711793|ref|ZP_01042849.1| Periplasmic parvulin-like peptidyl-prolyl isomerase [Idiomarina
           baltica OS145]
 gi|85694408|gb|EAQ32350.1| Periplasmic parvulin-like peptidyl-prolyl isomerase [Idiomarina
           baltica OS145]
          Length = 432

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/318 (16%), Positives = 122/318 (38%), Gaps = 16/318 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI 68
           +   +K  T+  + ++ CI   V+  +  +  R+   ++  VI +  I + I  +K  + 
Sbjct: 1   MKQLVKFSTSVSIALMMCITATVA-HAQQVLDRVAVIVDDGVILESQIEQLIKQVKQSEN 59

Query: 69  NGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
                      L   A + LI + L+ Q  E+ GI      ++    + A++ G+S ++ 
Sbjct: 60  FSSANAPSDKVLRTQATERLIQQELQLQMAERMGIEVSEAQLDQAISRIAQDRGMSVDEL 119

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ--KMKNITVREY 178
                  G     F++ +  + I   V +     +      E+       +  + +  EY
Sbjct: 120 RENTINSGQSWPAFREQIKTEIITSQVERAAVQRRVSVTPQEVENLVNLIEQNDASPTEY 179

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYL 237
            +R +L  +  +    +    KR   A   RL   +D ++L  + +S  + +  G   ++
Sbjct: 180 RLRQILIGVDSDAPNEKQEAAKRRAQAVIDRLEEGEDFSQLAIRSSSGSNALDGGDLGWM 239

Query: 238 LESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNT 293
            E+ +   F  ++K KS+     P  +  G   + + DKR    +  +     ++  + +
Sbjct: 240 TENSMPTLFAEVVKGKSKGEIIGPIRSGVGFHILQVADKRGEQVVEVQEVKARHILIKPS 299

Query: 294 PTKIEKHEAEYVKKLRSN 311
               +    E + + R  
Sbjct: 300 VILSDNKAKEMLAQFREQ 317



 Score = 63.9 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 57/154 (37%), Gaps = 6/154 (3%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
             A+K+  + + V+E   R +L  I  + + +    ++ +    E  L   K   +L K 
Sbjct: 274 QVADKRGEQVVEVQEVKARHIL--IKPSVILSDNKAKEMLAQFREQILSGEKTFAELAKE 331

Query: 223 ASKIHDVS--IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG 279
            S     +   G   +        +F+  +    +   + P+ TQ G   + + D+R L 
Sbjct: 332 HSADPGSASRGGDLGWSRPDRYAEEFKQRVSTLEKGVISEPFRTQFGWHIVEVTDRRTLD 391

Query: 280 GEIALKAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
                K   + Q     K  +    + +++R  A
Sbjct: 392 ATQESKRDKAYQMLFSRKYREEVDTWRQEMRDRA 425


>gi|114797858|ref|YP_760847.1| peptidyl-prolyl cis-trans isomerase domain-containing protein
           [Hyphomonas neptunium ATCC 15444]
 gi|114738032|gb|ABI76157.1| PPIC-type PPIASE domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 415

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 95/249 (38%), Gaps = 14/249 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKL--------QKINGELEKIAVQELIVETLKKQEIE 91
             I   +N + I+  D+ +R  LL L        Q+   ++   A+++LI E L+   + 
Sbjct: 35  EGIAAIVNDKPISYSDVRQRARLLLLTIGASQPTQEQVQQITGQALEQLIDEKLQLDRVS 94

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +  +  D   ++      A   G++ E     L   G+     ++ +  +  W  ++   
Sbjct: 95  EFEVEVDPVEIDAAVQNMASEAGVTGEVLREQLTSSGVNPASLEEQMRAEIAWNRLMSGL 154

Query: 152 FMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
           +  +    E ++     +++  +   +Y I  +    PD   + +        ++  S+L
Sbjct: 155 YGNRIRISENQVDDQMSRLRTASQKTQYRIGEIFLYAPDEATKTEALTA---AESIISQL 211

Query: 211 RLPKDC-NKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQN-NTTNPYVTQKGVE 268
           +   D     ++ +S     + G   ++   D+ P     ++ S       P  T+ G+ 
Sbjct: 212 QQGADFRVAAQRISSAPTAAAGGDMGWVTIEDIDPTIAEAVRNSSGNGLLEPIQTENGIY 271

Query: 269 YIAICDKRD 277
            I +  KR+
Sbjct: 272 IILLGGKRE 280


>gi|37678664|ref|NP_933273.1| parvulin-like peptidyl-prolyl isomerase [Vibrio vulnificus YJ016]
 gi|37197404|dbj|BAC93244.1| parvulin-like peptidyl-prolyl isomerase [Vibrio vulnificus YJ016]
          Length = 443

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 103/266 (38%), Gaps = 13/266 (4%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L++  +V   +  +     ++   +N  VI   DI      L+               L 
Sbjct: 22  LLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQALPDADVLN 81

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    
Sbjct: 82  EQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYEE 141

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+    + +   T    EY I  +     D  
Sbjct: 142 FREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDG- 200

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
            Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F + +K
Sbjct: 201 -QDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIK 259

Query: 252 -KSQNNTTNPYVTQKGVEYIAICDKR 276
            +++ +   P+ +  G   + I D +
Sbjct: 260 MQNKGSIIGPFRSGVGFHILKIEDVK 285



 Score = 66.6 bits (161), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 103/277 (37%), Gaps = 37/277 (13%)

Query: 52  TDGDISKRIALLKLQ----KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV 107
           T+  +  RI  ++L+    +    LE  A +  +VE LK+      G  F +    Y   
Sbjct: 182 TNASVEYRIGHIQLRFTDGQDKSALEAQAKE--LVEKLKQ------GADFSTMAYTYSKG 233

Query: 108 QHARNTG----LSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
             A   G    +  E+              F   + +Q      +   F    G   ++I
Sbjct: 234 PKALQGGDWGWMRKEEM----------PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKI 281

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD-CNKLEKF 222
              K  ++ + V E   R +L   P   L ++G   +R  +    R+R  +    +L + 
Sbjct: 282 EDVK-GLETVAVTEVNARHILLK-PTVILSDEGA--QRELNEFIRRIRAGEATFGELAQQ 337

Query: 223 ASKIHDVSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            S+    +   G+  Y       P+F++ ++       + P+ T  G   + + D+R++ 
Sbjct: 338 YSQDPGSAAQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVD 397

Query: 280 -GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + A+K          K  +    ++++LR+ A + 
Sbjct: 398 RTDSAMKNKAYRILFNRKFNEEVGAWMQELRAGAFVE 434


>gi|152982039|ref|YP_001352108.1| peptidyl-prolyl cis-trans isomerase SurA [Janthinobacterium sp.
           Marseille]
 gi|151282116|gb|ABR90526.1| peptidyl-prolyl cis-trans isomerase SurA [Janthinobacterium sp.
           Marseille]
          Length = 469

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/277 (18%), Positives = 104/277 (37%), Gaps = 13/277 (4%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGEL- 72
           LT   +  +       +     ++  I   +N EVIT  D  +R  ++  +LQ   G L 
Sbjct: 26  LTCGVMAHVQAQGQTAAAVQPRLADAIIVVVNNEVITRYDFLERYKMIEARLQSQGGNLP 85

Query: 73  -----EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
                ++  ++ +IVE  + Q+ +++GI  D   ++    + A    LS  +F   L++ 
Sbjct: 86  PREQLQRQLLERMIVERAQLQQAKETGIKIDDTMLDRAMGRIAEQNKLSMPEFRKRLEED 145

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA---NKQKMKNITVREYLIRTVL 184
           G+  + F+  +  +     + + +   K    ++EI A             +E  I  +L
Sbjct: 146 GLVYSKFRNEIRDEMAIQRLREREVDNKVQVSDVEIDAYMAAHNAPAATAPQELHIAQIL 205

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLH 243
             +P+N  Q Q    KR  D   ++L    D  K    ++     ++ G+  +     L 
Sbjct: 206 IRVPENATQKQLADSKRRADEVVAQLAAGADFAKLASAYSDGTDGLTGGELGWRSAERLP 265

Query: 244 PQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
             F +     Q         +  G   + +  +R   
Sbjct: 266 QLFVDATANLQDGQIAPIVKSGNGFHILKLLGRRTQS 302



 Score = 67.4 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/147 (12%), Positives = 57/147 (38%), Gaps = 9/147 (6%)

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK-IHDVSIGK 233
           V++     +L  +  N++ +    ++++ + ++          +L K  S        G 
Sbjct: 322 VKQTHASHILIKV--NQVVSAAEARRKLLELKQRLDNKAATFEELAKLYSNDFSAAKGGD 379

Query: 234 AQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL---S 289
             ++   D  P+F+  +        + P  +  G   I + +++    +++ +       
Sbjct: 380 LGWIYPGDTVPEFERAMDALPIGQVSEPIESPFGYHLILVTERK--SDDVSQERQRMIAR 437

Query: 290 AQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                 K+E+   ++++++R  A + Y
Sbjct: 438 QAIREQKVEEATQDWLRQVRDRAYVEY 464


>gi|254429963|ref|ZP_05043670.1| SurA N-terminal domain family [Alcanivorax sp. DG881]
 gi|196196132|gb|EDX91091.1| SurA N-terminal domain family [Alcanivorax sp. DG881]
          Length = 442

 Score =  140 bits (352), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/283 (14%), Positives = 101/283 (35%), Gaps = 12/283 (4%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NG 70
             + +   ++P  S     M  RI   +N   I   ++ +RI  + LQ            
Sbjct: 21  GLLAMAVLMLPAWSQAKVQMLDRIVAVVNDGAIMASELDERINTIALQFQEKGQQLPPPA 80

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            + +  +  +++E L+ Q  E+ GI  D  ++N      AR  G+S EDF++ L + G  
Sbjct: 81  VMREQVLDRMVLERLQLQLAERGGIKVDDASLNQALAGIARQNGMSLEDFAAALRQDGYD 140

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIP 188
              F++ +    +   + +     +    + E+    + +  K +   ++ +  +L  +P
Sbjct: 141 WPQFREQIREDMVISRLQQRSVASRIQVTDREVDRFLSSELGKQMFQEDFHLGHILVRVP 200

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQ 247
                      +   ++   +L    D  +L    +     +  G       +     F 
Sbjct: 201 AEASPEDVTQARSKAESIVKKLNDGGDFQQLAVAESDGPKALEGGDLGSRPAAQWPTLFA 260

Query: 248 N-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLS 289
              +   +   + P  +  G   + + D++    ++  +  + 
Sbjct: 261 ENAINLQKGEISEPLRSGAGFHILKMIDRKGGSEKVVTQYQVR 303



 Score = 64.3 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/149 (14%), Positives = 54/149 (36%), Gaps = 6/149 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI--KDAEESRLRLPKDCNKLEKFA 223
           +++      V +Y +R VL          Q   Q      +      +      +     
Sbjct: 288 DRKGGSEKVVTQYQVRHVLIKTDALTSAEQAHKQAIRLHDEIAAGERQFSDTAAEFSDDP 347

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEI 282
                 S G+  ++ + ++ P+F++++  +     +  + +Q G  ++ + D RD     
Sbjct: 348 GSAR--SGGELGWVNKGEMVPEFEDMMLNTPVGELSPVFESQFGWHFLRVDDVRDADMSA 405

Query: 283 ALKAYLSAQNTPT-KIEKHEAEYVKKLRS 310
             +   + Q     + E+    +V++ RS
Sbjct: 406 EFRRMQATQALQKRRFEEELETWVQEKRS 434


>gi|121956507|sp|Q7MP84|SURA_VIBVY RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 428

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 103/266 (38%), Gaps = 13/266 (4%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L++  +V   +  +     ++   +N  VI   DI      L+               L 
Sbjct: 7   LLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQALPDADVLN 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    
Sbjct: 67  EQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYEE 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+    + +   T    EY I  +     D  
Sbjct: 127 FREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDG- 185

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
            Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F + +K
Sbjct: 186 -QDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIK 244

Query: 252 -KSQNNTTNPYVTQKGVEYIAICDKR 276
            +++ +   P+ +  G   + I D +
Sbjct: 245 MQNKGSIIGPFRSGVGFHILKIEDVK 270



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 103/277 (37%), Gaps = 37/277 (13%)

Query: 52  TDGDISKRIALLKLQ----KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV 107
           T+  +  RI  ++L+    +    LE  A +  +VE LK+      G  F +    Y   
Sbjct: 167 TNASVEYRIGHIQLRFTDGQDKSALEAQAKE--LVEKLKQ------GADFSTMAYTYSKG 218

Query: 108 QHARNTG----LSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
             A   G    +  E+              F   + +Q      +   F    G   ++I
Sbjct: 219 PKALQGGDWGWMRKEEM----------PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKI 266

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD-CNKLEKF 222
              K  ++ + V E   R +L   P   L ++G   +R  +    R+R  +    +L + 
Sbjct: 267 EDVK-GLETVAVTEVNARHILLK-PTVILSDEGA--QRELNEFIRRIRAGEATFGELAQQ 322

Query: 223 ASKIHDVSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            S+    +   G+  Y       P+F++ ++       + P+ T  G   + + D+R++ 
Sbjct: 323 YSQDPGSAAQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVD 382

Query: 280 -GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + A+K          K  +    ++++LR+ A + 
Sbjct: 383 RTDSAMKNKAYRILFNRKFNEEVGAWMQELRAGAFVE 419


>gi|270263924|ref|ZP_06192192.1| chaperone SurA, precursor [Serratia odorifera 4Rx13]
 gi|270042117|gb|EFA15213.1| chaperone SurA, precursor [Serratia odorifera 4Rx13]
          Length = 432

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 100/276 (36%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING-- 70
           +K   T  + ++ C     ++ +     ++   ++  V+ + D++  +  +KL       
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLESDVNSLLQSVKLNAQQAGQ 58

Query: 71  ------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GI      ++      A    +S +   S L
Sbjct: 59  QLPDDATLRHQILERLIMDNIQLQMAKKMGIAVSDADLDKAIGNIAAQNKMSIDQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
             +G+  N ++  +  + +  +V  N+   +   L  E+   A +   +N +  E  I  
Sbjct: 119 AYEGLNYNTYRSQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQVGAQNGSDTEMNISH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +       +    D  KL    S        G   +    +
Sbjct: 179 ILIPLPENPSQQQVDEAEALAKKLMGEINGGADFGKLAISYSADSQALKGGNMGWGKLQE 238

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F   L    + +   P  +  G   + + D R
Sbjct: 239 IPTLFAERLASAKKGDVVGPIRSGVGFHILKVNDIR 274



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 56/149 (37%), Gaps = 4/149 (2%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           +   ++++V E   R +L   P   L +     K    AE  +    K  ++ ++ +   
Sbjct: 274 RGANQSVSVTEVHARHILLK-PSVVLTDDQARAKLQAVAEAIKSGNAKFADEAKQLSQDP 332

Query: 227 HDVS-IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL 284
                 G   +       P F++ L+K ++   + P  +  G   I + D R +    A 
Sbjct: 333 GSALQGGDLGWASPDIYDPAFRDALMKLNKGEVSKPVHSSFGWHLIQLLDTRQVDKTDAA 392

Query: 285 KAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
           +   + +     K  +    ++++ R+ A
Sbjct: 393 QKDRAYRMLFNRKFAEEAQTWMQEQRAQA 421


>gi|107099580|ref|ZP_01363498.1| hypothetical protein PaerPA_01000593 [Pseudomonas aeruginosa PACS2]
 gi|313111760|ref|ZP_07797553.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           39016]
 gi|310884055|gb|EFQ42649.1| peptidyl-prolyl cis-trans isomerase SurA [Pseudomonas aeruginosa
           39016]
          Length = 404

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 107/287 (37%), Gaps = 15/287 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALL--KLQKINGELE------KIAVQELIVETLKKQEIE 91
            R+   ++ +VI    + +R+  +   L K    L       +  ++ LI+E +++Q  +
Sbjct: 5   DRVVAIVDNDVIMQSQLDQRLREVHQTLLKRGAPLPPEHVLTQQVLERLIIENIQQQIGD 64

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +SGI      +N      A+  G+S E F + L + G+     ++ +  + +   V +  
Sbjct: 65  RSGIRISDEELNQAMGTIAQRNGMSLEQFQAALTRDGLSYADAREQVRREMVISRVRQRR 124

Query: 152 FMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
              +    E E+         K     EY +  +L  +P+    +      R       +
Sbjct: 125 VAERIQVSEQEVKNFLASDMGKIQLSEEYRLANILIPVPEAASSDVIQAAARQAQELYQQ 184

Query: 210 LRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGV 267
           L+   D  +L    ++  + +  G+  +   + L   F +++      + T P  T  G 
Sbjct: 185 LKQGADFGQLAISRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSLAVGDVTEPVRTPGGF 244

Query: 268 EYIAICDKRDLGG---EIALKAYLSAQNTPTKIEKHEAEYVKKLRSN 311
             + + +KR       +     ++  + +  + E    +  +KL   
Sbjct: 245 IILKLEEKRGGSKMVRDEVHVRHILLKPSEIRSEAETEKLAQKLYER 291



 Score = 68.9 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 58/154 (37%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+    +   E  +R +L    +          +++      R++  +D  +L K  S+
Sbjct: 251 EKRGGSKMVRDEVHVRHILLKPSE---IRSEAETEKLAQKLYERIQSGEDFGELAKSFSE 307

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G   ++    L P+F+ ++    Q   + P+ +Q G   + +  +R     E
Sbjct: 308 DPGSALNGGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSE 367

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +    +     K ++    +++++R  A + 
Sbjct: 368 KFREQQAVSVLRNRKYDEELQAWLRQIRDEAYVE 401


>gi|90580797|ref|ZP_01236600.1| putative survival protein SurA [Vibrio angustum S14]
 gi|90438065|gb|EAS63253.1| putative survival protein SurA [Vibrio angustum S14]
          Length = 433

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 124/314 (39%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---- 68
           +K      + ++   +   S  +     ++  T+N  VI   D+S  +  ++L       
Sbjct: 1   MKTWKYSVLSLMMMGMSATSMAAPQELDQVVMTVNDGVILQSDVSAMLKTVRLNAAEEHQ 60

Query: 69  ----NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               N  L +  + +LI+E L+ Q+ ++ GI  D + ++      A+   +S +     L
Sbjct: 61  QLPPNNILRQQVMDQLILENLQIQQAQQLGIRIDDSQLDQAIADVAKQRNMSVDQLRQSL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVK--NDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            K G+  + F++ +    +  +         +     E+E  A +   +     +Y I  
Sbjct: 121 AKAGVSYSMFREQMRNDMLASEARTIIVRKRVNVLPQEVESLAKQMAEQTQQNVQYNISQ 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + ++  + +    K+  +   ++L+   + ++L  +++     +  G+  ++ +++
Sbjct: 181 IQIRVDEDADKAERDKAKQEAEDIVAQLKKGANFSQLAYRYSKGPKALKGGEWGWMSKAE 240

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + ++   ++    P+ +  G   + I D +    +        ++  + +    
Sbjct: 241 MPTVFADQIQNNGKDAIIGPFRSGVGYHILKINDVKGMPSVSVVEVKARHILIKPSMILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +      ++K+R +
Sbjct: 301 DAAAKAELEKIRQS 314



 Score = 73.1 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 61/151 (40%), Gaps = 6/151 (3%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
            M +++V E   R +L  I  + + +    +  ++   +S +   +      K  S+   
Sbjct: 277 GMPSVSVVEVKARHIL--IKPSMILSDAAAKAELEKIRQSIISGKQTFAAAAKAYSEDPG 334

Query: 229 --VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
              + G+  + +     P F++ ++    +  + P+ +  G   + +  +R +   + A+
Sbjct: 335 SAANGGQLGWQVPDMYAPAFKDKVETLPVDKISEPFKSTFGWHIVEVEGRRKVDRTDAAM 394

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           K   +      K  +    ++++LR+ A I 
Sbjct: 395 KNRAAQIIFNRKFNEEAQTWLQELRAGAYIE 425


>gi|84393693|ref|ZP_00992443.1| parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus 12B01]
 gi|84375692|gb|EAP92589.1| parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus 12B01]
          Length = 431

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/275 (14%), Positives = 103/275 (37%), Gaps = 13/275 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           + L     + I       VSY +      ++  +N  VI   DI   +  L+        
Sbjct: 1   MTLWKRTLIAIAAACTVSVSYAAPVELDSVKVIVNEGVILQSDIDASMKTLRANAKKSGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++T++ QE E+ G+  D   ++      A++   + E  ++ +
Sbjct: 61  TLPSQDVLNEQVLEKLIIDTIQTQEAERIGVRIDDARLDQAIEGIAKDNNQTVEQLTASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRT 182
            ++G+  N F++ +  +    +        +   L  E+      +   T    +Y I  
Sbjct: 121 AEEGLSYNAFREQVRKEIAASEARNALVRRRINILPAEVDNLADILAQETNATVQYKIGH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +      N  Q +  ++ + K+  E              ++     +  G   ++ + ++
Sbjct: 181 IQLRF--NDDQTKEELEAQAKEVVEELNSGKDFSTMAYTYSKGPKALQGGDWGWMRKEEM 238

Query: 243 HPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
              F + +K +++ +   P+ +  G   + I D +
Sbjct: 239 PTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 273



 Score = 70.5 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/189 (14%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIEDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    ++++++             +L +  S+    ++  G+  Y       P+F++
Sbjct: 294 VILSDYGAKEQLEEITRRVNAGEASFGELAQQYSQDPGSAVQDGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +    +++
Sbjct: 354 QVETLPEGKISAPFKTVHGWHIVEVLDRREVDRTDSALKNKAYQILFNRKFNEEAGAWLQ 413

Query: 307 KLRSNAIIH 315
           ++R++A + 
Sbjct: 414 EVRASAFVE 422


>gi|307132630|ref|YP_003884646.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Dickeya dadantii
           3937]
 gi|306530159|gb|ADN00090.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Dickeya dadantii
           3937]
          Length = 430

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/269 (15%), Positives = 98/269 (36%), Gaps = 12/269 (4%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGE 71
            +++   +   +++ +    ++I   ++  V+ + DI+  +  +KL           +  
Sbjct: 6   ALVLGLALSANMAFAAPQEVNKIAAVVDNSVVLESDINSLLQSVKLNAQEAGQQLPDDAT 65

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L    ++ LI++ +  Q  +K G+      ++      A    +S +   S L  +G+  
Sbjct: 66  LRHQILERLIMDNIILQMAQKMGVQVTDEQLDRSIANIAAQNRMSVDQLRSRLAAEGVSF 125

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ--KMKNITVREYLIRTVLFSIPD 189
           + ++  +    I  +V  ++   +   L  E+ +  Q    +  +  E  +  +L  +P+
Sbjct: 126 DTYRSQIRKDMIIAEVRNSEVRRRVTVLPQEVDSLAQQIASQGASGPEVNLSQILIPLPE 185

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
           N  Q+Q    + + +          D  KL    S        G+  +    +L   F  
Sbjct: 186 NPTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQELPSLFAE 245

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
            L   Q      P  +  G   + + D R
Sbjct: 246 RLTNPQKGQVIGPIRSGVGFHILRVNDTR 274



 Score = 72.8 bits (177), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 82/299 (27%), Gaps = 65/299 (21%)

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE-DFSSFL------- 124
                +++I+  ++  E+ +  +T     V+    Q A       E + S  L       
Sbjct: 129 RSQIRKDMIIAEVRNSEVRRR-VTVLPQEVDSLAQQIASQGASGPEVNLSQILIPLPENP 187

Query: 125 ------------------DKQGIG-----------DNHFKQYLAIQSIWPD--------- 146
                               QG                 K     Q  W           
Sbjct: 188 TQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKG---GQMGWGRPQELPSLFA 244

Query: 147 ---------VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
                     V        G   + +   +   ++++V E   R +L     + + N   
Sbjct: 245 ERLTNPQKGQVIGPIRSGVGFHILRVNDTRGGDQSVSVTEVHARHILLRT--SVVMNDAQ 302

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKK-SQ 254
            + R++D                K  S+    +   G   +       P F++ L +  +
Sbjct: 303 ARARLEDIASQIKSGKLSFTNAAKQLSQDPGTANQGGDLGWSSPDMYDPSFRDALTQLKK 362

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
              + P  +  G   I + D R +    A +   + +     K  +    ++++ R+ A
Sbjct: 363 GEISAPVHSSFGWHLIQLLDTRQVDKTDAAQKDRAYRMLFNRKFAEEAQTWMQEKRAAA 421


>gi|220935878|ref|YP_002514777.1| SurA domain protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997188|gb|ACL73790.1| SurA domain protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 443

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 51/322 (15%), Positives = 117/322 (36%), Gaps = 23/322 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSR--------IRTTINGEVITDGDISKRIALLK 64
           I++  T F+L    +   +++    ++ R        I   +  +VI   ++  R+  ++
Sbjct: 2   IEIRNTLFLLSAMALTLALAWPLQGLAQRADDAPLDHIVALVEDDVIMHSELQNRLDTVR 61

Query: 65  --LQKINGELEK------IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
             +    G L          ++ LI+E L+ Q+  ++GI  D  T+N    + AR   +S
Sbjct: 62  QQILSRGGRLPPDDVLIPQVLERLIIERLQLQQATRAGIRIDDITLNQTMERIARENSMS 121

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR 176
             +F   L   GI    F++ +  +     + +     +    E EI            R
Sbjct: 122 LPEFRDRLVADGIDFQVFREQIRDEMTIGQLRRRQVENRIQVSEQEIDDLIASESGAIDR 181

Query: 177 --EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGK 233
             EY +  +L  +P+          +   +A   R    ++ ++L    ++    +  G 
Sbjct: 182 DVEYRLSHILVPLPEGANAADIQAARERAEAIRKRAVAGENFSELALSESAGQQALEGGD 241

Query: 234 AQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLS 289
             +   + +   F +N++   +   +    +  G   I + ++R             ++ 
Sbjct: 242 LGWRAAAQVPTLFARNVVLMREGEVSELIRSPSGFHLIKLQERRGGERAQITQTHARHIL 301

Query: 290 AQNTPTKIEKHEAEYVKKLRSN 311
            Q T    ++   E +  LR+ 
Sbjct: 302 IQPTAILSQEDARERIAGLRNR 323



 Score = 62.0 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 61/155 (39%), Gaps = 7/155 (4%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
             ++  +   + +   R +L  I    + +Q   ++RI      R+ +  D   L +  S
Sbjct: 282 QERRGGERAQITQTHARHIL--IQPTAILSQEDARERIAGLRN-RILMGNDFADLARAHS 338

Query: 225 KIHDVS--IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
                +   G   +    DL PQF+ ++   + N  + P+++  G   + + D+R     
Sbjct: 339 DDRGSAMRGGDLGWTDPGDLVPQFEEVMNALAPNTLSEPFLSPFGWHIVEVLDRRTYDSS 398

Query: 282 IA-LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              ++A         K E+    ++++LR  A + 
Sbjct: 399 RQLMRAQAREIIRERKREEETELWLRRLRDEAYVE 433


>gi|82701654|ref|YP_411220.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosospira
           multiformis ATCC 25196]
 gi|122070651|sp|Q2YBP3|SURA_NITMU RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|82409719|gb|ABB73828.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrosospira
           multiformis ATCC 25196]
          Length = 440

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 49/323 (15%), Positives = 119/323 (36%), Gaps = 19/323 (5%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI-ALLK 64
            +S S F     T  +L    I    ++        I   +N  VIT  ++ + + A+LK
Sbjct: 5   LSSRSPFSLPFLT--LLAGMAIAQQPAHSGVETIDHIVAVVNENVITRHELDEMLGAMLK 62

Query: 65  LQKINGE-------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
             +  G        LEK  ++ +I+  ++ Q   ++G+T     ++    + A+   +S 
Sbjct: 63  QLQKQGVQPPPPAVLEKQLLERIILNRVQLQLANETGLTVSDAELDQTLRRIAQENKMSL 122

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITV 175
           ++F   L + G+  + F+  +  + I   + + +   +    E E+      Q+      
Sbjct: 123 QEFDRALAEDGVSFSKFRDEIRDEIILVRLKEREVSNRVSVTEGEVDHFLETQEDSPSQS 182

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGK-A 234
            EY I  +L  + +     +    ++  ++  ++L+   +  ++    S   D   G   
Sbjct: 183 DEYRIAHILIQVSEGADPLKRDAARQRAESALAKLKAGTEFAQVAAEFSDAPDAMEGGLL 242

Query: 235 QYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRD-----LGGEIALKAYL 288
            +   + L  +F  +L        T    +  G   + + ++R+        +     ++
Sbjct: 243 NWRPAAQLTKKFAEILTPMKPGEITGIIPSPNGFHILKLVERRNQDTVTTMIDQTHARHI 302

Query: 289 SAQNTPTKIEKHEAEYVKKLRSN 311
             + +    E      V +L+  
Sbjct: 303 LIKISELTSEADAHRRVTELKER 325



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 57/157 (36%), Gaps = 6/157 (3%)

Query: 163 IPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKF 222
           +    Q      + +   R +L  I +  L ++    +R+ + +E      K     +  
Sbjct: 282 VERRNQDTVTTMIDQTHARHILIKISE--LTSEADAHRRVTELKERLDNGSKFEELAKLH 339

Query: 223 ASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR--DLG 279
           +      + G   ++   D  P+F+  +        ++P  +  G   I + ++R  D+ 
Sbjct: 340 SEDASAPTGGDLGWISPGDTVPEFEQAMSALKPGEISSPVQSPFGWHLIQVIERRTQDVS 399

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            E   +          K E    E++++LR  A + Y
Sbjct: 400 QER-KRQSARQAIRARKAETAFQEWLQRLRDRAYVEY 435


>gi|294012540|ref|YP_003546000.1| peptidyl-prolyl cis-trans isomerase SurA [Sphingobium japonicum
           UT26S]
 gi|292675870|dbj|BAI97388.1| peptidyl-prolyl cis-trans isomerase SurA [Sphingobium japonicum
           UT26S]
          Length = 461

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 94/270 (34%), Gaps = 14/270 (5%)

Query: 44  TTINGEVITDGDISKRIALLKLQK-------INGELEKIAVQELIVETLKKQEIEKSGIT 96
             +NG +IT  D+ +R+AL+               L    ++ LI ETL+ QE   + I 
Sbjct: 73  AIVNGRIITGTDVDQRLALIITANGGKVSDEEKERLRVQVLRNLIDETLQIQEAAANDIK 132

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
            D   ++  + + A N   S   F  +L +QG      K+ +  +  W  +++ +     
Sbjct: 133 VDKAEIDQSYERVAANFRQSPAQFDQYLRQQGSSSASIKRQIEGELAWSRLLRRNIQPFV 192

Query: 157 GNLEMEIPANKQKMKNITVR-EYLIRTVLF-SIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
              E E+ +   +M       E+ I  +   + P+N+ Q     +  I   ++       
Sbjct: 193 NVSEDEVKSVVDRMNAAKGSDEFRIGEIYLSATPENQQQIIANARNIIDQIKQG----GS 248

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
                 +F+        G   ++    L  +      + Q      P     GV  I + 
Sbjct: 249 FAAYARQFSEASTAAVGGDLGWVRPVQLPDELAQAAAEMQVGQIAGPIGVPGGVSIIYVM 308

Query: 274 DKRDLGGEIALKAYLSAQNTPTKIEKHEAE 303
           DKR +       A LS +           +
Sbjct: 309 DKRKVLTADPRDALLSLKQLSVSFPAGTTK 338



 Score = 54.7 bits (130), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 66/184 (35%), Gaps = 7/184 (3%)

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
              A +     +     +    ++   +   K    +       ++ +  S P    + Q
Sbjct: 281 AQAAAEMQVGQIAGPIGVPGGVSIIYVMDKRKVLTADPRDALLSLKQLSVSFPAGTTKEQ 340

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ- 254
                    A  ++++  K C +  +   KI    +     +   DL PQ Q++L   Q 
Sbjct: 341 AST---RAAAFAAQVKAVKGCGQANELGGKI-GADVVDNDNVKLRDLPPQLQDILLNLQV 396

Query: 255 NNTTNPY-VTQKGVEYIAICDKRDLGGEIALKAY-LSAQNTPTKIEKHEAEYVKKLRSNA 312
              T P+     GV  + +C + +     A  A  + AQ    ++ K    Y++ LR +A
Sbjct: 397 GEATPPFGSINDGVRVLVVCGRDEASSAAAPNAEQIMAQLEEERVNKRARIYLRDLRRDA 456

Query: 313 IIHY 316
           +I Y
Sbjct: 457 VIDY 460


>gi|224827238|ref|ZP_03700332.1| SurA domain protein [Lutiella nitroferrum 2002]
 gi|224600527|gb|EEG06716.1| SurA  domain protein [Lutiella nitroferrum 2002]
          Length = 428

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 44/262 (16%), Positives = 98/262 (37%), Gaps = 12/262 (4%)

Query: 33  YKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ--------KINGELEKIAVQELIVET 84
                   RI   +N   IT+ D+ KRI    ++             L +  ++++I E 
Sbjct: 21  AAPVRAVDRIVAVVNKSAITESDLQKRIKETVMELEARKVTPPAPDVLARQVLEQMITEE 80

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIW 144
           ++ Q    +G+    + +     + A    L+ E   + L K+G+  ++F++ +  Q + 
Sbjct: 81  VQVQYATSNGVRVSDDELQQTLERLASQNKLTLEAMKAQLAKEGVTFDNFREQIRRQILL 140

Query: 145 PDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             + + +   +    + E+    +  +     EY +  +L S+P+     Q   Q +   
Sbjct: 141 SRLKEREVESRVNVSDTEVEQVLKSEQTANRSEYRLANILVSVPERADAKQIDAQSQKAH 200

Query: 205 AEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYV 262
              + L   +   K    ++   + +  G   +   S L   F  LL+     + T    
Sbjct: 201 KALAELDAGQPFAKVAAAYSDAPNGLKGGDLGWRPASSLPLDFTKLLETMQPGSHTTVIR 260

Query: 263 TQKGVEYIAICDKRDLGGEIAL 284
           +Q+G     + +KR    +  L
Sbjct: 261 SQQGFFIFQLQEKR--SADTPL 280



 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 60/154 (38%), Gaps = 6/154 (3%)

Query: 162 EIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK 221
           ++   +     + V +Y +R +L     N+  ++   + R+    +   R        + 
Sbjct: 269 QLQEKRSADTPLIVEQYHVRHILLRT--NEAVSEADAKTRLLQIRDRIERGASFEEMAKL 326

Query: 222 FASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR--DL 278
           ++    +   G   ++   D  P F+  +     N  + P  +  G   I +  KR  D+
Sbjct: 327 YSEDASNTRGGDLGWVNLGDTVPTFEQAMTSLPLNTVSQPVRSPFGWHLIKVEGKRTQDV 386

Query: 279 GGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
             +   K  +  Q    KI++   ++V++LR +A
Sbjct: 387 AQDR-EKMMVKQQIRARKIDEAYLDWVRQLRDSA 419


>gi|293392898|ref|ZP_06637215.1| peptidylprolyl cis-trans isomerase SurA [Serratia odorifera DSM
           4582]
 gi|291424432|gb|EFE97644.1| peptidylprolyl cis-trans isomerase SurA [Serratia odorifera DSM
           4582]
          Length = 433

 Score =  139 bits (349), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 101/276 (36%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING-- 70
           +K   T  + ++ C     ++ +     ++   ++  V+ + D++  +  +KL       
Sbjct: 1   MKNWRTLILGLVVCANA--AFAAPQEVDKVAAVVDNGVVLESDVNGLLQSVKLNAQQAGQ 58

Query: 71  ------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GI      ++      A    +S +   S L
Sbjct: 59  QLPDDKTLRHQILERLIMDNIQLQMAKKMGINVTDADLDKAIGNIAAQNRMSIDQLRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
             +G+  N ++  +  + +  +V  N+   +   L  E+   A +   +N +  E  I  
Sbjct: 119 AYEGLNYNTYRSQIRKEMLITEVRNNEVRRRVTILPQEVDALAKQVGAQNGSDTEMNISH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +       +    D  KL    S        G   +    +
Sbjct: 179 ILIPLPENPSQQQVDEAETLAKRLIGEINSGADFGKLAITYSADSQALKGGNMGWGKLQE 238

Query: 242 LHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F   L+   + +   P  +  G   + + D R
Sbjct: 239 IPTLFAERLVSAKKGDVVGPIRSGVGFHILKVNDLR 274



 Score = 69.3 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 39/328 (11%), Positives = 97/328 (29%), Gaps = 66/328 (20%)

Query: 48  GEVITDGDISKRIALLKLQKING-------ELEKIAVQELIVETLKKQEIEKSGITFDSN 100
            + I +     R+++ +L+                  +E+++  ++  E+ +  +T    
Sbjct: 97  DKAIGNIAAQNRMSIDQLRSRLAYEGLNYNTYRSQIRKEMLITEVRNNEVRRR-VTILPQ 155

Query: 101 TVNYFFVQHARNTGLSAE-DFSSFL-------DKQGIG-DNHFKQYLAIQ---------- 141
            V+    Q     G   E + S  L        +Q +       + L  +          
Sbjct: 156 EVDALAKQVGAQNGSDTEMNISHILIPLPENPSQQQVDEAETLAKRLIGEINSGADFGKL 215

Query: 142 ---------------SIWP-----------DVVKNDFMLKYGNLEM-------EIPANKQ 168
                            W             +V        G +         ++   + 
Sbjct: 216 AITYSADSQALKGGNMGWGKLQEIPTLFAERLVSAKKGDVVGPIRSGVGFHILKVNDLRG 275

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
             ++I+V E   R +L     + +      + ++++   +            K  S+   
Sbjct: 276 ASQSISVTEVHARHILLK--PSVVMTDDQARAKLEEVAAAVKSGKAKFADEAKQLSQDPG 333

Query: 229 VS--IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALK 285
            +   G   +       P F++ LLK  +   + P  +  G   I + D R +    A +
Sbjct: 334 SALQGGDLGWASPDIYDPAFRDALLKLQKGEVSQPVHSAFGWHLIQLLDTRQVDKTDAAQ 393

Query: 286 AYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
              + +     K  +    ++++ R+ A
Sbjct: 394 KERAYRMLFNRKFAEEAQTWMQEQRAAA 421


>gi|217969876|ref|YP_002355110.1| SurA domain protein [Thauera sp. MZ1T]
 gi|217507203|gb|ACK54214.1| SurA domain protein [Thauera sp. MZ1T]
          Length = 438

 Score =  139 bits (349), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 52/308 (16%), Positives = 111/308 (36%), Gaps = 17/308 (5%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------L 72
           +      +P+ S        RI   +N EVIT  ++  RI   + Q             L
Sbjct: 16  LAATTLALPVHSAPRAVEVDRIVAVVNNEVITGLELRARIEQTRRQLARQGAQLPPEEVL 75

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
           ++  ++ LIVE  + Q   +S +  D  T++    + A N  LS +   + L+K G+  +
Sbjct: 76  QRQLLERLIVERAQLQLARESSLRVDDVTLDRAIERIASNNKLSIDQLRATLEKDGVTWS 135

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNITVREYLIRTVLFSIPDNK 191
            F+  +  + +   + + +   +    + EI           + +E+ +  +L   P+  
Sbjct: 136 RFRDEIRSEILLTRLREREVDSRIVVTDAEIDNFIANNPDAFSGQEFAVAHILLRTPEGA 195

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQNLL 250
              Q     R  +   +RLR  +D  ++    S   D    G   +     L   F + +
Sbjct: 196 SPQQVEAVARRAEQVMARLRSGEDFARVAAEVSDAPDGLQGGSLGWRPLDRLPALFADAV 255

Query: 251 KK-SQNNTTNPYVTQKGVEYIAICDKRDLGG------EIALKAYLSAQNTPTKIEKHEAE 303
           ++     T+    +  G+  + + D R  G       E     ++  + +    +     
Sbjct: 256 RRMRPGETSPVLRSAAGLHIVRLVDARGGGAAAVQKLEQTRARHILIKTSEVLSDADAEA 315

Query: 304 YVKKLRSN 311
            +  +R  
Sbjct: 316 RLLAIRER 323



 Score = 64.7 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/169 (12%), Positives = 55/169 (32%), Gaps = 6/169 (3%)

Query: 151 DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
                   + +             + +   R +L    +  + +    + R+    E  +
Sbjct: 268 RSAAGLHIVRLVDARGGGAAAVQKLEQTRARHILIKTSE--VLSDADAEARLLAIRERVV 325

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVTQKGVEY 269
                    +  ++ +     G   +L   D  P+F+  +        + P  +  G   
Sbjct: 326 NGADFAELAKASSADLSAARGGDLGWLNPGDTVPEFERAMNALRPGEVSAPVRSPFGWHL 385

Query: 270 IAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           I + ++R  D+  E   +A         K E+   +++++LR +  + Y
Sbjct: 386 IQLVERRMQDVTDER-KRAAARQALRERKAEQAYEDWLRQLRDSTYVDY 433


>gi|238764654|ref|ZP_04625599.1| Chaperone surA [Yersinia kristensenii ATCC 33638]
 gi|238697146|gb|EEP89918.1| Chaperone surA [Yersinia kristensenii ATCC 33638]
          Length = 424

 Score =  139 bits (349), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 42/264 (15%), Positives = 98/264 (37%), Gaps = 12/264 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN-----GELEKIA 76
             +    ++ +     ++   ++  V+   D+    + + L   Q          L    
Sbjct: 1   MVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQEVPDDATLRHQI 60

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LI++ ++ Q  +K GIT     ++      A    ++ +   S L   G+  + +++
Sbjct: 61  LERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPDQMRSRLAADGLNYDTYRE 120

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNITV-REYLIRTVLFSIPDNKLQN 194
            +  + +  +V  N+   +   L  E+ A  KQ     +   E  +  +L  +P+N  Q 
Sbjct: 121 QIRKEMLTSEVRNNEVRRRITILPQEVEALAKQVGNQTSGDTELNLSHILIPLPENPSQQ 180

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQNLLKKS 253
           Q    + + +   S ++   D  KL    S        G+  +    +L   F   L+ +
Sbjct: 181 QVDQAEDVANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAERLQSA 240

Query: 254 -QNNTTNPYVTQKGVEYIAICDKR 276
            + +   P  +  G   + + D R
Sbjct: 241 NKGDVVGPIRSGVGFHILKVNDIR 264



 Score = 66.2 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 69/244 (28%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+      A    L ++     DF              K     Q  W  +   
Sbjct: 176 NPSQQQVDQA-EDVA--NKLVSDIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 229

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          V        G   +++   +     ++V E   R +L     + +
Sbjct: 230 PSLFAERLQSANKGDVVGPIRSGVGFHILKVNDIRGGDNTVSVTEVHARHILLK--PSPV 287

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-L 249
                 + ++  A         D   + K  S+    +   G   +       P F++ L
Sbjct: 288 MTDDQARAKLAAAAADIKSGKTDFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDAL 347

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 348 MKLKKGEISTPVHSSFGWHLIQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQ 407

Query: 309 RSNA 312
           R+ A
Sbjct: 408 RAAA 411


>gi|320157503|ref|YP_004189882.1| survival protein SurA (Peptidyl-prolyl cis-trans isomerase SurA)
           [Vibrio vulnificus MO6-24/O]
 gi|319932815|gb|ADV87679.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase SurA) [Vibrio vulnificus MO6-24/O]
          Length = 432

 Score =  138 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 103/266 (38%), Gaps = 13/266 (4%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L++  +V   +  +     ++   +N  VI   DI      L+               L 
Sbjct: 11  LLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQALPDADVLN 70

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    
Sbjct: 71  EQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYAE 130

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+    + +   T    EY I  +     D  
Sbjct: 131 FREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDG- 189

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
            Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F + +K
Sbjct: 190 -QDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIK 248

Query: 252 -KSQNNTTNPYVTQKGVEYIAICDKR 276
            +++ +   P+ +  G   + I D +
Sbjct: 249 MQNKGSIIGPFRSGVGFHILKIEDVK 274



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 103/277 (37%), Gaps = 37/277 (13%)

Query: 52  TDGDISKRIALLKLQ----KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV 107
           T+  +  RI  ++L+    +    LE  A +  +VE LK+      G  F +    Y   
Sbjct: 171 TNASVEYRIGHIQLRFTDGQDKSALEAQAKE--LVEKLKQ------GADFSTMAYTYSKG 222

Query: 108 QHARNTG----LSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
             A   G    +  E+              F   + +Q      +   F    G   ++I
Sbjct: 223 PKALQGGDWGWMRKEEM----------PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKI 270

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD-CNKLEKF 222
              K  ++ + V E   R +L   P   L ++G   +R  +    R+R  +    +L + 
Sbjct: 271 EDVK-GLETVAVTEVNARHILLK-PTVILSDEGA--QRELNEFIRRIRAGEATFGELAQQ 326

Query: 223 ASKIHDVSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            S+    +   G+  Y       P+F++ ++       + P+ T  G   + + D+R++ 
Sbjct: 327 YSQDPGSAAQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVD 386

Query: 280 -GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + A+K          K  +    ++++LR+ A + 
Sbjct: 387 RTDSAMKNKAYRILFNRKFNEEVGAWMQELRAGAFVE 423


>gi|307825062|ref|ZP_07655283.1| SurA domain protein [Methylobacter tundripaludum SV96]
 gi|307733810|gb|EFO04666.1| SurA domain protein [Methylobacter tundripaludum SV96]
          Length = 434

 Score =  138 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 48/312 (15%), Positives = 117/312 (37%), Gaps = 16/312 (5%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIALLKLQKINGE--- 71
           +    V+ + C +   S+   A     I   +  +VI + ++ K +A+++ +        
Sbjct: 7   IKRTIVVALLCNLLFGSFLVHAEVLDTIIAVVEEDVILERELQKEVAVIEQRIQQSNAAI 66

Query: 72  -----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L K  ++++IV+ L++Q  EK+GIT     +N      AR   +  E F + L+ 
Sbjct: 67  PPAYVLRKQVLEKMIVDKLQRQLAEKAGITVSEEMLNSSAADIARRNNMDIEQFRAELEG 126

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI--TVREYLIRTVL 184
           QGI    F   +  + I   +   +   +    + E+    +    I     +Y +  +L
Sbjct: 127 QGISYQSFLDNMRNEIIINQLRGREIGGRIKVTDREVEHYMETQDKIGEESTQYHLGHIL 186

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLH 243
            ++ +     +        +     LR  +D ++     +   + +  G   +   S++ 
Sbjct: 187 IAVKEGASSTEIQKAMSKAEGIVGSLRGGQDFSQTAISDSDDANALKGGDLGWRTLSEVP 246

Query: 244 PQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTK---IEK 299
             F N +++  Q + + P  +  G   + + + +     +  K  +      T     + 
Sbjct: 247 TLFVNEIRQMKQGDVSEPIRSPSGFHIVKMLELKGTDNHMITKTKVRHILIKTNELVDDA 306

Query: 300 HEAEYVKKLRSN 311
              + +  L++ 
Sbjct: 307 EANKRLLALKAR 318



 Score = 61.6 bits (148), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 61/157 (38%), Gaps = 7/157 (4%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
              +   N  + +  +R +L     N+L +     KR+  A ++R+    D   L +  S
Sbjct: 277 LELKGTDNHMITKTKVRHILIKT--NELVDDAEANKRL-LALKARIADGDDFAALARAHS 333

Query: 225 KIHDVS--IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
                +   G   ++   DL   F+  ++K   N  ++P  TQ G   I +  + +    
Sbjct: 334 DDKGSALKGGSLDWVGPGDLVKPFEEAMVKLGINEVSDPVQTQFGWHIIQVLGRENKDDS 393

Query: 282 IALKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
              K  L        KIE+    +V++LR  A +  Y
Sbjct: 394 SEFKKNLVREAIRKRKIEEETELWVRRLRDEAFVEIY 430


>gi|326423746|ref|NP_759646.2| survival protein SurA [Vibrio vulnificus CMCP6]
 gi|121956501|sp|Q8DED4|SURA_VIBVU RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|319999108|gb|AAO09173.2| Survival protein surA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) [Vibrio vulnificus CMCP6]
          Length = 428

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 103/266 (38%), Gaps = 13/266 (4%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L++  +V   +  +     ++   +N  VI   DI      L+               L 
Sbjct: 7   LLLGMLVTGSAVSAPVELDKVAVIVNDGVILQSDIDTATKTLRANAKKSGQALPDADVLN 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  V +LI++TL+ QE ++ G+  D   +N    + ARN   + ++ S+ +  +G+    
Sbjct: 67  EQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYAE 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+    + +   T    EY I  +     D  
Sbjct: 127 FREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDG- 185

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLK 251
            Q++  ++ + K+  E   +          ++     +  G   ++ + ++   F + +K
Sbjct: 186 -QDKSALEAQAKELVEKLKQGADFSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIK 244

Query: 252 -KSQNNTTNPYVTQKGVEYIAICDKR 276
            +++ +   P+ +  G   + I D +
Sbjct: 245 MQNKGSIIGPFRSGVGFHILKIEDVK 270



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 103/277 (37%), Gaps = 37/277 (13%)

Query: 52  TDGDISKRIALLKLQ----KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV 107
           T+  +  RI  ++L+    +    LE  A +  +VE LK+      G  F +    Y   
Sbjct: 167 TNASVEYRIGHIQLRFTDGQDKSALEAQAKE--LVEKLKQ------GADFSTMAYTYSKG 218

Query: 108 QHARNTG----LSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEI 163
             A   G    +  E+              F   + +Q      +   F    G   ++I
Sbjct: 219 PKALQGGDWGWMRKEEM----------PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKI 266

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD-CNKLEKF 222
              K  ++ + V E   R +L   P   L ++G   +R  +    R+R  +    +L + 
Sbjct: 267 EDVK-GLETVAVTEVNARHILLK-PTVILSDEGA--QRELNEFIRRIRAGEATFGELAQQ 322

Query: 223 ASKIHDVSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG 279
            S+    +   G+  Y       P+F++ ++       + P+ T  G   + + D+R++ 
Sbjct: 323 YSQDPGSAAQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVD 382

Query: 280 -GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
             + A+K          K  +    ++++LR+ A + 
Sbjct: 383 RTDSAMKNKAYRILFNRKFNEEVGAWMQELRAGAFVE 419


>gi|322417707|ref|YP_004196930.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
 gi|320124094|gb|ADW11654.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Geobacter sp. M18]
          Length = 319

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 55/316 (17%), Positives = 114/316 (36%), Gaps = 15/316 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKL------Q 66
            K++    +L +  + P  ++      S I   +N EVIT  D+ +  AL++        
Sbjct: 2   AKIIMACTLLALLAVTPTFAHAKP--ISGIAAIVNDEVITSTDVDREYALMQKEAEKLPA 59

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
                L+  A+  L+ + L +Q+I +  I      V        +   L+ E     L  
Sbjct: 60  SEKMGLKSAALNRLVDKKLVEQKIRELDIKVSDEDVRLAIEDVKKQNNLTQEALEQALAT 119

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVL 184
           QG+    ++  L  Q     ++  +   K    E E+       +        +  R + 
Sbjct: 120 QGLTFAQYQVQLKEQLERMRLMSQEVRSKIQVGEREMREYYESHRADYGGSETFHARHIF 179

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDL 242
           F +            +++     ++ R  +D  +L K  S+    +   G       SD+
Sbjct: 180 FKVDPKASAEDAAKAEKLAGEVLAKARAGEDFAELAKKYSQDPSAAKDGGDLGTFKRSDM 239

Query: 243 HPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEI--ALKAYLSAQNTPTKIEK 299
            P+  + +      + ++   +  G+  I +  K    G     +K  +  Q    K ++
Sbjct: 240 LPEIGDTVAAMKPGDVSSIVSSPAGLHIIKLEQKSQEKGRSFEEVKDSIEEQLYKKKSDE 299

Query: 300 HEAEYVKKLRSNAIIH 315
              ++VK+LR+ A I 
Sbjct: 300 RFNQWVKELRNAASID 315


>gi|238752276|ref|ZP_04613756.1| Chaperone surA [Yersinia rohdei ATCC 43380]
 gi|238709544|gb|EEQ01782.1| Chaperone surA [Yersinia rohdei ATCC 43380]
          Length = 434

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 102/283 (36%), Gaps = 16/283 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                G L    ++ LI++ +  Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDGTLRHQVLERLIMDNILLQMAKKMGITVSDEALDKAIADIAAQNRMTPAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +     S ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEELAKKLASDIKAGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           L   F   L+   + +   P  +  G   + + D R  G +  
Sbjct: 239 LPSLFAERLQSAKKGDIVGPIRSGVGFHILKVNDIR--GADKT 279



 Score = 63.5 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/242 (11%), Positives = 68/242 (28%), Gaps = 31/242 (12%)

Query: 96  TFDSNTVNYFFVQHARNTGLSA---EDFSSFLDKQGIGDNHFKQYLAIQSIWPDV----- 147
                 V+    + A+          DF              K     Q  W  +     
Sbjct: 186 NPSQQQVDQA-EELAKKLASDIKAGADFGKLAIANSADSQALKG---GQMGWGKLQELPS 241

Query: 148 -------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
                        +        G   +++   +   K ++V E   R +L     + +  
Sbjct: 242 LFAERLQSAKKGDIVGPIRSGVGFHILKVNDIRGADKTVSVTELHARHILLK--PSPVMT 299

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-LLK 251
               + ++  A             + K  S+    +   G   +       P F++ ++K
Sbjct: 300 DDQARAKLSAAAADIKSGKASFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDAVMK 359

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRS 310
             +   + P  +  G   I + D R +    A +   + +     K  +    ++++ R+
Sbjct: 360 LQKGEISAPVHSSFGWHLIQLVDSRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRA 419

Query: 311 NA 312
            A
Sbjct: 420 AA 421


>gi|313200363|ref|YP_004039021.1| sura domain-containing protein [Methylovorus sp. MP688]
 gi|312439679|gb|ADQ83785.1| SurA domain protein [Methylovorus sp. MP688]
          Length = 438

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 112/280 (40%), Gaps = 22/280 (7%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMS----SRIRTTINGEVITDGDISKRIALLKLQ-KING 70
           L     L    ++P V+  +   S     RI   ++  V+T+ +++ RI ++  Q +  G
Sbjct: 7   LMAGLFLWAGALLPHVAIAAQDGSVNKIDRIVAVVDQGVVTEKELNDRIEIVSAQLEKQG 66

Query: 71  E-------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
                   LEK  ++ LI + L+ Q   ++G+  D + ++   ++ A    +   +F   
Sbjct: 67  NQLPPRNVLEKQILERLINDRLQLQYAAQTGLRVDDDQLDKTIMRIAEQNKMGVPEFKEA 126

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIR 181
           L  +GI    F++ +  + +   + + +   +    E E+      Q  +  +  EY I 
Sbjct: 127 LAAEGIVYKKFREDIRNEILLARLREREVDNRVNVTESEVDNFLTTQSSRQDSSDEYEIS 186

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV----SIGKAQYL 237
            +L   P++         KR+++  E  L+  +      + ++++ D       GK  + 
Sbjct: 187 HILIRAPEDGSPEDL---KRLREKAEDALKKLQAGEDFGQVSARVSDAPNALEGGKLGWK 243

Query: 238 LESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
             + +   F   LK  Q    +    +  G   + + D+R
Sbjct: 244 TAAQVPALFLEALKPMQVGQLSGILRSPNGFHILKLTDRR 283



 Score = 69.7 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/152 (11%), Positives = 58/152 (38%), Gaps = 4/152 (2%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            +    +  V++   R +L    +  + ++   +++I   ++            +++++ 
Sbjct: 282 RRGGNTSTMVQQTHTRHILIKTSE--VLSETEAKRKIDGIKQLIDNGEDFGEAAKRYSND 339

Query: 226 IHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIA 283
               + G   ++   D  PQF+  +        ++   +  G   I + ++R+      A
Sbjct: 340 GSAANGGDLGWVNPGDTVPQFEKAMNALQPGQISDAVRSPFGWHLIQVLERRNQDMTREA 399

Query: 284 LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +     +    K ++   ++V++LR  A + 
Sbjct: 400 ERMKARQEIRQRKADEAYQDWVRELRDRAYVE 431


>gi|253998290|ref|YP_003050353.1| SurA domain-containing protein [Methylovorus sp. SIP3-4]
 gi|253984969|gb|ACT49826.1| SurA domain protein [Methylovorus sp. SIP3-4]
          Length = 438

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 113/280 (40%), Gaps = 22/280 (7%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMS----SRIRTTINGEVITDGDISKRIALLKLQ-KING 70
           L     L +  ++P V+  +   S     RI   ++  V+T+ +++ RI ++  Q +  G
Sbjct: 7   LMAGVFLWLGALIPHVASAAQDGSVNKIDRIVAVVDQGVVTEKELNDRIEIVSAQLEKQG 66

Query: 71  E-------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSF 123
                   LEK  ++ LI + L+ Q   ++G+  D + ++   ++ A    +   +F   
Sbjct: 67  NQLPPRNVLEKQILERLINDRLQLQYAAQTGLRVDDDQLDKTIMRIAEQNKMGVPEFKEA 126

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIR 181
           L  +GI    F++ +  + +   + + +   +    E E+      Q  +  +  EY I 
Sbjct: 127 LAAEGIVYKKFREDIRNEILLARLREREVDNRVNVTESEVDNFLTTQSSRQDSSDEYEIS 186

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV----SIGKAQYL 237
            +L   P++         KR+++  E  L+  +      + ++++ D       GK  + 
Sbjct: 187 HILIRAPEDGSPEDL---KRLREKAEDALKKLQAGEDFGQVSARVSDAPNALEGGKLGWK 243

Query: 238 LESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
             + +   F   LK  Q    +    +  G   + + D+R
Sbjct: 244 TAAQVPALFLEALKPMQVGQLSGILRSPNGFHILKLTDRR 283



 Score = 69.7 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/152 (11%), Positives = 58/152 (38%), Gaps = 4/152 (2%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            +    +  V++   R +L    +  + ++   +++I   ++            +++++ 
Sbjct: 282 RRGGNTSTMVQQTHTRHILIKTSE--VLSETEAKRKIDGIKQLIDNGEDFGEAAKRYSND 339

Query: 226 IHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG-GEIA 283
               + G   ++   D  PQF+  +        ++   +  G   I + ++R+      A
Sbjct: 340 GSAANGGDLGWVNPGDTVPQFEKAMNALQPGQISDAVRSPFGWHLIQVLERRNQDMTREA 399

Query: 284 LKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
            +     +    K ++   ++V++LR  A + 
Sbjct: 400 ERMKARQEIRQRKADEAYQDWVRELRDRAYVE 431


>gi|242238056|ref|YP_002986237.1| peptidyl-prolyl cis-trans isomerase SurA [Dickeya dadantii Ech703]
 gi|242130113|gb|ACS84415.1| Peptidylprolyl isomerase [Dickeya dadantii Ech703]
          Length = 433

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/267 (14%), Positives = 96/267 (35%), Gaps = 11/267 (4%)

Query: 21  VLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING--------EL 72
           +++   +     + +  +  ++   ++  V+ + DI+  +  +K+              L
Sbjct: 7   LILGLALSANTVFAAPQVMDKVAAVVDNGVVLESDINSLMQSVKMNSQESGQQLPDDATL 66

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDN 132
               ++ LI++ +  Q  +K G     + ++      A+   ++ +   S L  +GI  +
Sbjct: 67  RHQILERLIMDNIVLQMAQKMGAQVSDDQLDRAIANIAQQNHMTLDQLRSRLAAEGINYD 126

Query: 133 HFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNITVREYLIRTVLFSIPDNK 191
            ++  +       DV  ++   +   L  E+ A  +Q     + +E  +  +L  +P+N 
Sbjct: 127 TYRSQIRKDMTIADVRNSEVRRRVTVLPQEVDALAQQIASQGSDKEVNLSQILLPLPENP 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQNLL 250
            Q Q    + + +      R   D  KL    S        G+  +    +L   F   L
Sbjct: 187 SQEQVDKAESLANRLVKDARQGADFGKLAITYSADPQALKGGQMGWGRPQELPSLFAERL 246

Query: 251 KKS-QNNTTNPYVTQKGVEYIAICDKR 276
               +     P  +  G   + + D R
Sbjct: 247 ANPEKGQVIGPIRSGVGFHILRVNDTR 273



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/241 (12%), Positives = 65/241 (26%), Gaps = 29/241 (12%)

Query: 96  TFDSNTVN--YFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPD------- 146
                 V+                 DF              K     Q  W         
Sbjct: 185 NPSQEQVDKAESLANRLVKDARQGADFGKLAITYSADPQALKG---GQMGWGRPQELPSL 241

Query: 147 -----------VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
                       V        G   + +   +   + I+V E   R +L     + + N 
Sbjct: 242 FAERLANPEKGQVIGPIRSGVGFHILRVNDTRGGNQAISVTETHARHILLKT--SVVMND 299

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-LLKK 252
              + +++D                K  S+    +   G   +       P F++ L++ 
Sbjct: 300 AQARTKLEDVARQIKSGSTSFAAQAKLLSQDPGSANQGGDLGWASPDMYDPAFRDALMQL 359

Query: 253 SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRSN 311
            +   + P  +  G   I + D R +    A +   + +     K  +    ++++ R++
Sbjct: 360 KKGEISAPVRSSFGWHLIQLLDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEKRAS 419

Query: 312 A 312
           A
Sbjct: 420 A 420


>gi|238786686|ref|ZP_04630487.1| Chaperone surA [Yersinia frederiksenii ATCC 33641]
 gi|238725054|gb|EEQ16693.1| Chaperone surA [Yersinia frederiksenii ATCC 33641]
          Length = 434

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/283 (16%), Positives = 105/283 (37%), Gaps = 16/283 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                G L    ++ LI++ +  Q  +K GIT     ++      A    ++ +   S L
Sbjct: 59  QVPDDGTLRHQVLERLIMDNILLQMAKKMGITVSDEALDKAIADIAAQNRMTPDQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  N +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYNTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + + +   S ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEDLANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           L   F   L+ + + +   P  +  G   + + D R  G +  
Sbjct: 239 LPSLFAERLQSANKGDVVGPIRSGVGFHILKVNDIR--GADKT 279



 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/244 (12%), Positives = 69/244 (28%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+      A    L ++     DF              K     Q  W  +   
Sbjct: 186 NPSQQQVDQA-EDLA--NKLVSDIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 239

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          V        G   +++   +   K ++V E   R +L     + +
Sbjct: 240 PSLFAERLQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEIHARHILLK--PSPV 297

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-L 249
                 + ++  A             + K  S+    +   G   +       P F++ +
Sbjct: 298 MTDEQARAKLSAAAADIKSGKSSFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDAV 357

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 358 MKLQKGEISAPVHSSFGWHLIQVIDNRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQ 417

Query: 309 RSNA 312
           R+ A
Sbjct: 418 RAAA 421


>gi|319940878|ref|ZP_08015217.1| hypothetical protein HMPREF9464_00436 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805760|gb|EFW02541.1| hypothetical protein HMPREF9464_00436 [Sutterella wadsworthensis
           3_1_45B]
          Length = 460

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/289 (19%), Positives = 105/289 (36%), Gaps = 21/289 (7%)

Query: 6   FTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMS---SRIRTTINGEVITDGDISKRIAL 62
            T+L+     +    ++      P    ++ A S    RI   +N ++IT+ ++ +R+  
Sbjct: 11  LTALALSGASVQAASIMDSVPATPSAGEQAPAASGELDRIVAVVNNDIITEHELEQRVHT 70

Query: 63  LKLQKINGE--------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTG 114
           + +              L    ++ LI E    Q   ++GI  D   VN    Q AR   
Sbjct: 71  VAINLRRQNIQLPAMELLRAQVLERLISERAILQRARQTGIRVDDQMVNASVEQIARQNN 130

Query: 115 LSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMK 171
           LS E+    L   G+    F+  +  +     + + +   K    E EI    A +  +K
Sbjct: 131 LSIEELRQRLAADGVNFASFRNEIRDEITTQRLREREVNEKIDISESEIDAYLAEQAGIK 190

Query: 172 NITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-S 230
                EY +  +L  + +   +N         ++   R R  ++ + L    S+  D   
Sbjct: 191 GDDKMEYHVEHILLPV-ETPAENDSVKTA--AESLAKRARDGENFSSLAASFSRADDAMK 247

Query: 231 IGKAQYLLESDLHPQFQNLLKK--SQNNTTNPYVTQKGVEYIAICDKRD 277
            G   +   +DL   F   L+   +  +      +Q+      + DKRD
Sbjct: 248 GGDLGWRSLNDLPATFAEALRANSTPGSVYV-VSSQRAWHVFKLEDKRD 295



 Score = 69.3 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 68/191 (35%), Gaps = 8/191 (4%)

Query: 131 DNHFKQYLAIQSIWPDV--VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIP 188
              F + L   S    V  V +        LE +    + K+    V +   R +L  + 
Sbjct: 260 PATFAEALRANSTPGSVYVVSSQRAWHVFKLEDKRDGVQAKLGGGPVEQTHARHILMFVS 319

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQ 247
           D   +      +R+ D +        D   + +  S     +  G   +L   D  P+F+
Sbjct: 320 DITPEGDVI--RRLNDIKNRVQSGEADFATMARLHSVDSTATRGGDLGWLQPGDTVPEFE 377

Query: 248 NLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ--NTPTKIEKHEAEY 304
            ++ K      ++P  T  G   I + ++R        +  ++A+      K+ +   E+
Sbjct: 378 GVMNKLKPGQISDPIRTPYGYHLIQVVERRTEKDGNPERMRVAARQAIRQKKLAEASYEW 437

Query: 305 VKKLRSNAIIH 315
            ++LR  A + 
Sbjct: 438 ERELRDQAFVE 448


>gi|330719900|gb|EGG98375.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [gamma proteobacterium IMCC2047]
          Length = 429

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/314 (17%), Positives = 118/314 (37%), Gaps = 16/314 (5%)

Query: 9   LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRI--ALLKLQ 66
           L+   K  TT  +L   C+ P + Y +     RI   +N ++I    + + I  A+  LQ
Sbjct: 2   LNSLRKYFTT--LLAALCLAPSMLYAAIQPLDRIAVIVNDDIIMQSQVQQAIDSAIRNLQ 59

Query: 67  KINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDF 120
           + N +      L +  V+ LI+E+L+ Q  E+ GI  D  ++N    + A    ++ E F
Sbjct: 60  QRNQQMPPKKVLIQQVVESLIMESLQLQIAERGGIRVDDTSLNEAISRIAAQNNMTLEQF 119

Query: 121 SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQK--MKNITVREY 178
              +  +G      ++ +  + +     +     +    + EI         K +   ++
Sbjct: 120 QQAIIAEGSDYAATREQIRRELLTTRARQGSVGPRIQITDQEIDNFLDSAEGKALLASKF 179

Query: 179 LIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
            I  +L    +N    +   +K+ +   +            ++++   +    G   +  
Sbjct: 180 HIAHILVKPDNNTQPARQKAKKQAQALYQQLQSGADFAALTKQYSDGPNAEQGGSMGWRD 239

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG---EIALKAYLSAQNTP 294
           ES L   F+N +K       + P  +  G   + + +KR       +     ++  Q   
Sbjct: 240 ESQLPSLFKNTVKALNDGEVSEPIASSNGFHLVKLLEKRGGTSIIQDQTQVRHILIQPNE 299

Query: 295 TKIEKHEAEYVKKL 308
            + E+   E +  L
Sbjct: 300 IRSERQAEEMIYDL 313



 Score = 70.1 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 71/153 (46%), Gaps = 9/153 (5%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
             K+   +I   +  +R +L  I  N+++++   ++ I D   +R++  +D  +L +  S
Sbjct: 275 LEKRGGTSIIQDQTQVRHIL--IQPNEIRSERQAEEMIYDL-FTRIQSGEDFAELARLYS 331

Query: 225 KIHD--VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKR--DLG 279
                    G+  ++  + L P F  ++K++  +  + P+ ++ G   + +  +R  D+G
Sbjct: 332 ADPGSRAKGGELGWITPAGLVPSFVKVMKETPVDGISAPFKSRYGWHILEVQGRRQQDIG 391

Query: 280 GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
            + A +          K  +    +++++R++A
Sbjct: 392 AD-AARQQAREVIYRRKFNEELQLWLREIRNDA 423


>gi|16125933|ref|NP_420497.1| peptidyl-prolyl cis-trans isomerase family protein [Caulobacter
           crescentus CB15]
 gi|13423099|gb|AAK23665.1| peptidyl-prolyl cis-trans isomerase family protein [Caulobacter
           crescentus CB15]
          Length = 501

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 98/256 (38%), Gaps = 17/256 (6%)

Query: 39  SSRIRTTINGEVITDGDISKRIALL----KLQKINGEL---EKIAVQELIVETLKKQEIE 91
           S  +   +N ++I+  D+ +R+ LL     +Q     L   E+ A++ LI E L+ QE++
Sbjct: 106 SESVAAVVNDDIISSYDLMQRMRLLMATSGMQPTQENLPQIEQEALRSLIDERLQMQELK 165

Query: 92  KSG------ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           +        I      V       A++  L  E     L  QGIG + ++  L  +S W 
Sbjct: 166 RVEKQQKITIISTDKEVEEQIGDIAQSNRLQPEQLKQQLVAQGIGLDTWRAQLRAESSWQ 225

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             ++  +  +    E +I A ++++ +     +Y I  V                   + 
Sbjct: 226 SWIQGRYGSRLRIGEDQIKAYQRRLADAAAKPQYQISEVFLDAARVGGMEVAVNGA-TQL 284

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS-QNNTTNPYVT 263
             + +   P       +F+      + G+  ++ + ++  +    L++      + P   
Sbjct: 285 INQMQQGAP-FAAVARQFSGSATAANGGEVGWVSQGEMPTEVDAALEQLRPGQLSRPIQV 343

Query: 264 QKGVEYIAICDKRDLG 279
           + GV  I + DKR   
Sbjct: 344 KDGVYIIYLRDKRAGS 359



 Score = 75.8 bits (185), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 51/133 (38%), Gaps = 2/133 (1%)

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
             + P      +  +    K   + + ++   C  LE  A+K+  +  G       +DL 
Sbjct: 368 QVAAPLAADATEAQIAAATKQLVDLKPKI-TSCQSLEATAAKVDGLVAGDLGEAEITDLA 426

Query: 244 PQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA 302
           P FQ    K +    ++P  T  G+  IA+C KR  G        +  +    ++     
Sbjct: 427 PAFQEAANKLEVGQISDPIRTDAGLHLIAVCGKRQGGANAPTHDQIENRLRGQQLALIAK 486

Query: 303 EYVKKLRSNAIIH 315
            Y++ LR+ A I 
Sbjct: 487 RYLRDLRNQATIE 499


>gi|156973131|ref|YP_001444038.1| hypothetical protein VIBHAR_00810 [Vibrio harveyi ATCC BAA-1116]
 gi|156524725|gb|ABU69811.1| hypothetical protein VIBHAR_00810 [Vibrio harveyi ATCC BAA-1116]
          Length = 427

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 110/267 (41%), Gaps = 15/267 (5%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L+   ++      +     ++   +N  VI   DI   +  L+               L+
Sbjct: 7   LLFTALLSCGVTAAPVELDKVAVIVNDGVILQSDIDTAMKTLQANARQSGKSLPSASVLK 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
              V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +G+  + 
Sbjct: 67  DQVVEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAEGLSYSE 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+ +   ++   T    +Y I  +     D+K
Sbjct: 127 FREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKETNATVQYKIGHIQLRFSDDK 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
            +++   +    +A   +L+   D +++   ++     +  G   ++ + ++   F + +
Sbjct: 187 DKSEVEAE---ANALVKKLKDGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQI 243

Query: 251 K-KSQNNTTNPYVTQKGVEYIAICDKR 276
           K +++ +   P+ +  G   + I D +
Sbjct: 244 KMQNKGSIIGPFRSGIGFHILKIEDVK 270



 Score = 69.3 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 70/192 (36%), Gaps = 15/192 (7%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L   P  
Sbjct: 236 PTIFADQIKMQ--NKGSIIGPFRSGIGFHILKIEDVK-GLETVAVTEVNARHILIK-PTV 291

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH-----DVSIGKAQYLLESDLHPQ 245
            L + G      K+  E   R+        + A++           G+  Y       P+
Sbjct: 292 ILSDDGA----KKELNEFIRRIKAGEATFGQLATQYSQDPGSAAQNGELGYQTPDLYVPE 347

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAE 303
           F++ ++     + + P+ T  G   + + D+R +   + A+K          K  +    
Sbjct: 348 FKHQVETLPVGSISAPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNRKFNEEAGA 407

Query: 304 YVKKLRSNAIIH 315
           ++++LR++A + 
Sbjct: 408 WMQELRASAFVE 419


>gi|148977503|ref|ZP_01814092.1| parvulin-like peptidyl-prolyl isomerase [Vibrionales bacterium
           SWAT-3]
 gi|145963298|gb|EDK28564.1| parvulin-like peptidyl-prolyl isomerase [Vibrionales bacterium
           SWAT-3]
          Length = 431

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/275 (14%), Positives = 102/275 (37%), Gaps = 13/275 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           + L     + I        S+        +R  +N  VI   DI   +  L+        
Sbjct: 1   MTLWKRTLIAIAAACTVSTSFADPVELDSVRVIVNEGVILQSDIDTSMKTLRANAKKSGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L++  +++LI++T++ QE E+ G+  D   ++      A++   + E  ++ +
Sbjct: 61  TLPSQDVLDEQVLEKLIIDTIQTQEAERIGVRIDDARLDQAIEGIAKDNNQTVEQLTASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRT 182
            ++G+  N F++ +  +    +        +   L  E+      +   T    +Y I  
Sbjct: 121 AEEGLSYNAFREQVRKEIAASEARNALVRRRINILPAEVDNLADILAQETNATVQYKIGH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +      N  Q +  ++ + K+  E              ++     +  G   ++ + ++
Sbjct: 181 IQLRF--NDDQTKEELEAQAKELVEELNSGKDFSTMAYTYSKGPKALQGGDWGWMRKEEM 238

Query: 243 HPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
              F + +K +++ +   P+ +  G   + I D +
Sbjct: 239 PTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 273



 Score = 71.6 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 72/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L   P  
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIEDVK-GLETVAVTEVNARHILIK-PTV 294

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            L + G  ++ +++              + +  S+    ++  G+  Y       P+F++
Sbjct: 295 ILSDDGAKEQ-LEEITRRVNAGEASFGDMAQQYSQDPGSAVQDGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +    +++
Sbjct: 354 QVETLPEGKISAPFKTVHGWHIVEVLDRREVDRTDSALKNKAYQILFNRKFNEEAGAWLQ 413

Query: 307 KLRSNAIIH 315
           ++R++A + 
Sbjct: 414 EVRASAFVE 422


>gi|153834210|ref|ZP_01986877.1| chaperone SurA [Vibrio harveyi HY01]
 gi|148869398|gb|EDL68404.1| chaperone SurA [Vibrio harveyi HY01]
          Length = 427

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 110/267 (41%), Gaps = 15/267 (5%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L+   ++      +     ++   +N  VI   DI   +  L+               L+
Sbjct: 7   LLFTTLLSCGVTAAPVELDKVAVIVNDGVILQSDIDTAMKTLQANARQSGKSLPSASVLK 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
              V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +G+  + 
Sbjct: 67  DQVVEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAEGLSYSE 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+ +   ++   T    +Y I  +     D+K
Sbjct: 127 FREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKETNATVQYKIGHIQLRFSDDK 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
            +++   +    +A   +L+   D +++   ++     +  G   ++ + ++   F + +
Sbjct: 187 DKSEVEAE---ANALVQKLKDGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQI 243

Query: 251 K-KSQNNTTNPYVTQKGVEYIAICDKR 276
           K +++ +   P+ +  G   + I D +
Sbjct: 244 KMQNKGSIIGPFRSGIGFHILKIEDVK 270



 Score = 69.3 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 70/192 (36%), Gaps = 15/192 (7%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L   P  
Sbjct: 236 PTIFADQIKMQ--NKGSIIGPFRSGIGFHILKIEDVK-GLETVAVTEVNARHILIK-PTV 291

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH-----DVSIGKAQYLLESDLHPQ 245
            L + G      K+  E   R+        + A++           G+  Y       P+
Sbjct: 292 ILSDDGA----KKELNEFIRRIKAGEATFGQLATQYSQDPGSAAQNGELGYQTPDLYVPE 347

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAE 303
           F++ ++     + + P+ T  G   + + D+R +   + A+K          K  +    
Sbjct: 348 FKHQVETLPVGSISAPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNRKFNEEAGA 407

Query: 304 YVKKLRSNAIIH 315
           ++++LR++A + 
Sbjct: 408 WMQELRASAFVE 419


>gi|251788205|ref|YP_003002926.1| peptidyl-prolyl cis-trans isomerase SurA [Dickeya zeae Ech1591]
 gi|247536826|gb|ACT05447.1| Peptidylprolyl isomerase [Dickeya zeae Ech1591]
          Length = 430

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/269 (15%), Positives = 97/269 (36%), Gaps = 12/269 (4%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGE 71
            +++   +   +++ +    ++I   ++  V+ + DI+  +  +KL           +  
Sbjct: 6   ALVLGLALSANMAFAAPQEVNKIAAVVDNSVVLESDINSLLQSVKLNAQEAGQQLPDDAT 65

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L    ++ LI++ +  Q  +K G+      ++      A    +S +   S L  +G+  
Sbjct: 66  LRHQILERLIMDNIILQMAQKMGVQVTDEQLDRSIANIAAQNRMSIDQLRSRLTAEGVSF 125

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ--KMKNITVREYLIRTVLFSIPD 189
           + ++  +    I  DV  ++   +   L  E+ +  Q    +     E  +  +L  +P+
Sbjct: 126 DTYRGQIRKDMIIADVRNSEVRRRVTVLPQEVDSLAQQLASQGANGPEVNLSQILLPLPE 185

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
           N  Q+Q    + + +          D  KL    S        G+  +    +L   F  
Sbjct: 186 NPTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQELPTLFAE 245

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
            L   Q      P  +  G   + + D R
Sbjct: 246 RLTNPQKGQIVGPIRSGVGFHILRVNDTR 274



 Score = 72.0 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/299 (11%), Positives = 83/299 (27%), Gaps = 65/299 (21%)

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE-DFSSFL------- 124
                +++I+  ++  E+ +  +T     V+    Q A       E + S  L       
Sbjct: 129 RGQIRKDMIIADVRNSEVRRR-VTVLPQEVDSLAQQLASQGANGPEVNLSQILLPLPENP 187

Query: 125 ------------------DKQGIG-----------DNHFKQYLAIQSIWPD--------- 146
                               QG                 K     Q  W           
Sbjct: 188 TQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKG---GQMGWGRPQELPTLFA 244

Query: 147 ---------VVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
                     +        G   + +   +   + ++V E   R +L +   + + N   
Sbjct: 245 ERLTNPQKGQIVGPIRSGVGFHILRVNDTRGGAQAVSVTEVHARHILLTT--SVVMNDAQ 302

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQNLLKK-SQ 254
            + ++++                K  S+    +   G   +       P F++ L +  +
Sbjct: 303 ARAKLEEVAGQIKSGKLSFANAAKQLSQDPGTANQGGDLGWASPEMYDPAFRDALTQLKK 362

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
              + P  +  G   I + D R++    A +   + +     K  +    ++++ R+ A
Sbjct: 363 GEISTPVHSSFGWHLIQLLDTREVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEKRAAA 421


>gi|134093645|ref|YP_001098720.1| periplasmic peptidyl-prolyl cis-trans isomerase (PPIase), involved
           in maturation of outer membrane proteins [Herminiimonas
           arsenicoxydans]
 gi|133737548|emb|CAL60591.1| Chaperone SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA)
           (PPIase SurA) (Rotamase SurA) [Herminiimonas
           arsenicoxydans]
          Length = 469

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 105/282 (37%), Gaps = 13/282 (4%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKI 68
             +  L T             S     ++  I   +N EVIT  +  +R+ ++  +L+  
Sbjct: 25  GLMSGLMTNVTAQNMAPNASTSRLQPRLADAILVVVNNEVITRYEFIERLKVIENRLKGQ 84

Query: 69  NGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
            G+      L++  ++ +IVE  + Q+ ++SGI  D   ++    + A    L+  +F  
Sbjct: 85  GGQMPPMEQLQRQLLERMIVERAQLQQAKESGIKVDDAMLDRAVARIADQNQLTMPEFRK 144

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYL 179
            L++ G+    F++ +  + I   + + +   K    + E+    A          +E  
Sbjct: 145 RLEQDGMVYFQFREEIRSEMILQRLREREVDNKIQVSDAEVDAYMAEHSGTNANAPQELN 204

Query: 180 IRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLL 238
           +  +L  +P+N    Q    ++  +   ++L    D  K    ++     ++ G+  +  
Sbjct: 205 LGQILIRVPENATPQQLADSRKRAEEVLAQLNAGGDFAKLAAAYSDGTDGLTGGELGWRT 264

Query: 239 ESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLG 279
           +  L   F +      Q        +  G   + +  KR   
Sbjct: 265 QDRLPQLFVDATASLQQGQIAPLVKSGNGFHILKVLGKRTQS 306



 Score = 69.3 bits (168), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 34/313 (10%), Positives = 98/313 (31%), Gaps = 74/313 (23%)

Query: 73  EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT------------------G 114
            +    E+I++ L+++E++   I      V+ +  +H+                      
Sbjct: 157 REEIRSEMILQRLREREVDN-KIQVSDAEVDAYMAEHSGTNANAPQELNLGQILIRVPEN 215

Query: 115 LSAEDFSS-------FLDKQGIGDNHFKQYLA----------IQSIWPD----------- 146
            + +  +         L +   G +  K   A           +  W             
Sbjct: 216 ATPQQLADSRKRAEEVLAQLNAGGDFAKLAAAYSDGTDGLTGGELGWRTQDRLPQLFVDA 275

Query: 147 -----------VVKN-------DFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIP 188
                      +VK+         + K     +            TV++     +L  + 
Sbjct: 276 TASLQQGQIAPLVKSGNGFHILKVLGKRTQSVLRAAPGANPAAANTVKQTHASHILIKV- 334

Query: 189 DNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQFQ 247
            N++ +    ++++ + ++          +L +  S     S  G   ++   D  P+F+
Sbjct: 335 -NQVVSAADARRKLTELKQRLDNKAATFEELARLHSNDFSASKGGDLGWIYPGDTVPEFE 393

Query: 248 NLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKA---YLSAQNTPTKIEKHEAE 303
             +        + P  +  G   I + +++    +++ +     +       K+E+   +
Sbjct: 394 RAMDALPVGEVSEPIESPFGYHLILVKERK--SDDVSQERQRLVVRQALRAQKVEEATQD 451

Query: 304 YVKKLRSNAIIHY 316
           +++++R  A + Y
Sbjct: 452 WLRQVRDRAYVEY 464


>gi|238897972|ref|YP_002923652.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465730|gb|ACQ67504.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 322

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 54/308 (17%), Positives = 114/308 (37%), Gaps = 17/308 (5%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE-------- 71
           +VL+         + +    ++I   +N  VI   D++ R+  +K+   N          
Sbjct: 7   YVLVWLLCSHFTVFSAPKEINKIVAIVNDSVILLSDLNHRLKAIKINANNINQSLPDDAI 66

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L    ++ LIVE+++ Q   K G+      ++      AR   L+ +   S L  + I  
Sbjct: 67  LRHQILERLIVESIQLQIANKIGLKIPDEDLDKIIADIARKNRLTVDQIRSKLASENINY 126

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ--KMKNITVREYLIRTVLFSIPD 189
             ++  +  Q +  +V+KN    +   L  E+ +  +    +     E  +  +L  + +
Sbjct: 127 GTYRNEIRNQILISEVLKNAVQPRINILPQEVDSLSKLILNEKNQNMELNLSQILIPLTE 186

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
           N  Q +    ++  +   S+L+   +  KL    S        G   +    +L   F  
Sbjct: 187 NPSQKEIDKAEKKANKLVSQLKKGANFAKLAIAYSADSQAFKGGTMGWKKVQELPTLFSE 246

Query: 249 LLKKSQN-NTTNPYVTQKGVEYIAICDKRDL---GGEIALKAYLSAQNTPTKIEKHEAEY 304
            LK     +   P  +  G   + I D   +     +I  +AY        K  +    +
Sbjct: 247 KLKVIHKFDIIGPIRSGVGFHILRINDLHTIFENSEDIKNQAYKI--LFNRKFSEQAETW 304

Query: 305 VKKLRSNA 312
           +++ R++A
Sbjct: 305 IQEQRASA 312


>gi|238782669|ref|ZP_04626699.1| Chaperone surA [Yersinia bercovieri ATCC 43970]
 gi|238716329|gb|EEQ08311.1| Chaperone surA [Yersinia bercovieri ATCC 43970]
          Length = 434

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/283 (15%), Positives = 105/283 (37%), Gaps = 16/283 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI+++++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDATLRHQILERLIMDSIQLQMAKKMGITVSDEALDKAIADIAAQNRMTPAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + + +   S ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEELANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           L   F   L+ + + +   P  +  G   + + D R  G +  
Sbjct: 239 LPSLFAEKLQSANKGDVVGPIRSGVGFHILKVNDIR--GADKT 279



 Score = 67.0 bits (162), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 71/244 (29%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+    + A    L ++     DF              K     Q  W  +   
Sbjct: 186 NPSQQQVDQA-EELA--NKLVSDIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 239

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          V        G   +++   +   K ++V E   R +L     + +
Sbjct: 240 PSLFAEKLQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEVHARHILLK--PSPV 297

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN-L 249
                 + ++  A             + K  S+    ++  G   +       P F++ L
Sbjct: 298 MTDDQARAKLAAAAADIKSGKTTFANIAKEISQDPGSAVQGGDLGWASPDIYDPAFRDAL 357

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 358 MKLQKGEISAPVHSSFGWHLIQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQ 417

Query: 309 RSNA 312
           R+ A
Sbjct: 418 RAAA 421


>gi|271502081|ref|YP_003335107.1| Peptidylprolyl isomerase [Dickeya dadantii Ech586]
 gi|270345636|gb|ACZ78401.1| Peptidylprolyl isomerase [Dickeya dadantii Ech586]
          Length = 430

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/269 (15%), Positives = 97/269 (36%), Gaps = 12/269 (4%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGE 71
            +++   +   +++ +    ++I   ++  V+ + DI+  +  +KL           +  
Sbjct: 6   ALVLGLALSANMAFAAPQEVNKIAAVVDNSVVLESDINSLLQSVKLNAQEAGQQLPDDAT 65

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L    ++ LI++ +  Q  +K G+      ++      A    +S +   S L  +G+  
Sbjct: 66  LRHQILERLIMDNIIMQMAQKMGVQVTDEQLDRSITNIAAQNHMSLDQLRSRLAAEGVSF 125

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQ--KMKNITVREYLIRTVLFSIPD 189
           + ++  +    +  DV  ++   +   L  E+ A  Q    +     E  +  +L  +P+
Sbjct: 126 DTYRSQIRKDMMIADVRNSEVRRRVTVLPQEVDALAQQLASQGANGPEVNLSQILIPLPE 185

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQN 248
           N  Q+Q    + + +          D  KL    S        G+  +    +L   F  
Sbjct: 186 NPTQDQVDKAESLANRLVKEASQGADFGKLAITYSADPQALKGGQMGWGRPQELPSLFAE 245

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKR 276
            L   Q      P  +  G   + + D R
Sbjct: 246 RLANPQKGQIIGPIRSGVGFHILRVNDTR 274



 Score = 71.6 bits (174), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 53/150 (35%), Gaps = 6/150 (4%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
           +   + ++V E   R +L +   + + N    + ++++                K  S+ 
Sbjct: 274 RGGSQAVSVTEVHARHILLTT--SVVMNDAQAKAKLEEVASQIRSGKLSFAAAAKQLSQD 331

Query: 227 HDVS--IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
              +   G   +       P F++ L+   +   + P  +  G   I + D R +    A
Sbjct: 332 PGSANQGGDLGWASPDMYDPAFRDALMDLKKGEISAPVHSSFGWHLIQLLDTRQVDKTDA 391

Query: 284 LKAYLSAQN-TPTKIEKHEAEYVKKLRSNA 312
            +   + +     K  +    ++++ R+ A
Sbjct: 392 AQKDRAYRMLFNRKFAEEAQTWMQEKRAAA 421


>gi|330448801|ref|ZP_08312448.1| peptidyl-prolyl cis-trans isomerase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492992|dbj|GAA06945.1| peptidyl-prolyl cis-trans isomerase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 433

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/314 (13%), Positives = 122/314 (38%), Gaps = 15/314 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI---- 68
           +K      + ++   +   S  +     ++  T+N  VI   D++  +  + L       
Sbjct: 1   MKKWKYSVLSLMMMGMSATSMAAPQELDQVVMTVNDGVILQSDVNAMLKTVHLNAAEEHQ 60

Query: 69  ----NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               N  L +  + +LI+E L+ Q+ ++ GI  D + ++      A+  G++ +     L
Sbjct: 61  QLPPNDILRQQVMDKLIMENLQIQQAKQLGIRIDDSQLDQAIADVAKQRGITVDQLRQTL 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDV--VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRT 182
            K GI    F++ +    +  +   V     +     E++  A +   +     +Y I  
Sbjct: 121 AKAGISYPMFREQMRNDMLASEARTVIVRKRVNILPQEVDALAKQMAKQTQQNVQYNISQ 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + ++  +      K+  +   ++L+   D ++L  +++     +  G+  ++ + +
Sbjct: 181 IQIRVDEDAEKAARDKAKQEAEDIVAQLKKGADFSQLAYRYSKGPKALKGGEWGWMSKEE 240

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR---DLGGEIALKAYLSAQNTPTKI 297
           +   F + ++   ++    P+ +  G   + I D +    +        ++  + +    
Sbjct: 241 MPTIFADQIQNNGKDAIIGPFRSGVGYHILKINDVKGMPSVSVVEVKARHILIKPSVILS 300

Query: 298 EKHEAEYVKKLRSN 311
           +    + ++++R  
Sbjct: 301 DAAAKKELEQIRQR 314



 Score = 74.3 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 61/151 (40%), Gaps = 6/151 (3%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
            M +++V E   R +L  I  + + +    +K ++   +  +   +      K  S+   
Sbjct: 277 GMPSVSVVEVKARHIL--IKPSVILSDAAAKKELEQIRQRIISGKQSFAAAAKAYSQDPG 334

Query: 229 --VSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
              + G+  + +     P F++ ++    +  + P+ +  G   + +  +R +   + A+
Sbjct: 335 SAANGGELGWQVPDMYAPAFKDKVETLPVDKISEPFKSAFGWHIVEVEGRRKVDRTDAAM 394

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           K   +      K  +    ++++LR+ A I 
Sbjct: 395 KNRAAQILFNRKFNEEAQTWLQELRAGAYIE 425


>gi|283856448|ref|YP_163047.2| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775452|gb|AAV89936.2| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 435

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 98/267 (36%), Gaps = 18/267 (6%)

Query: 44  TTINGEVITDGDISKRIALLKLQKINGELEK-----------IAVQELIVETLKKQEIEK 92
             +NG +IT+ DI +R AL+ L    G++ +             ++ LI ETL+ QE + 
Sbjct: 37  AIVNGTIITNTDIEQRFALI-LASAGGDVSRISEEDRNMARLQILRNLIDETLEIQEAKA 95

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
           + I      ++  F  +ARN   + E FS+ L   G      K+ +     W  ++    
Sbjct: 96  NDIIITPTELDQIFEHYARNMKKTPEAFSADLQAIGSSAKSVKRQVEADMAWRRLLGRRV 155

Query: 153 MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL- 210
                    E+     +MK    + EY I  + FS  D           +I+D    R  
Sbjct: 156 EPFVNISNEEVQNIINRMKAAKGKDEYHIAEIFFSANDTNRAEVRAKANKIQDQILQRGN 215

Query: 211 ---RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKG 266
              R+        +++        G   ++    L      ++K     +   P  T  G
Sbjct: 216 TNERMGLFSAFASQYSEASSAARGGDMGFIQAEQLPDALAAVVKNMPVGSLMGPIETPGG 275

Query: 267 VEYIAICDKRDLGGEIALKAYLSAQNT 293
              +A+ +K+ + G     A ++ +  
Sbjct: 276 FSIVALLEKQQILGIDPKDAIVALKQI 302



 Score = 45.4 bits (106), Expect = 0.010,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 180 IRTVLFSIPDNKLQNQG-FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
           ++ +  + P    QN       +++DA     +  K C  +++ A KI    +     + 
Sbjct: 299 LKQIYVNFPPGTSQNVADEKTAKLRDA----TKELKGCGSVDEIAHKI-GADVMSNDQIS 353

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPY-VTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPT 295
              + P  QN++ K Q   +T P+   Q+GV  + +C + D    +      +  Q    
Sbjct: 354 IRSMPPLLQNMVAKLQVGESTLPFGSIQEGVSVLVVCGRDDPKVAKQPNFQQIHNQLQED 413

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           ++ K    Y++ LR +AII Y
Sbjct: 414 RVNKRAIRYLRDLRRDAIIDY 434


>gi|86148121|ref|ZP_01066421.1| parvulin-like peptidyl-prolyl isomerase [Vibrio sp. MED222]
 gi|218708410|ref|YP_002416031.1| putative parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus
           LGP32]
 gi|85834108|gb|EAQ52266.1| parvulin-like peptidyl-prolyl isomerase [Vibrio sp. MED222]
 gi|218321429|emb|CAV17381.1| putative Parvulin-like peptidyl-prolyl isomerase [Vibrio splendidus
           LGP32]
          Length = 431

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/275 (14%), Positives = 101/275 (36%), Gaps = 13/275 (4%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           + L     + I        SY +      ++  +N  VI   DI   +  L+        
Sbjct: 1   MTLWKRTLIAIAAACTLSTSYAAPVELDSVKVIVNEGVILQSDIDTSMKTLRANAKKSGQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++T++ QE E+ G+  D   ++      A++   + +  ++ +
Sbjct: 61  TLPSQDVLNEQVLEKLIIDTIQTQEAERIGVRIDDARLDQAIEGIAKDNNQTVQQLTASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRT 182
            ++G+  N F++ +  +    +        +   L  E+      +   T    +Y I  
Sbjct: 121 AEEGLSYNAFREQVRKEIAASEARNALVRRRINILPAEVDNLADILAQETNATVQYKIGH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDL 242
           +      N  Q +  ++ +  D  E              ++     +  G   ++ + ++
Sbjct: 181 IQLRF--NDDQTKEELEAQATDLVEELNNGKDFSTMAYTYSKGPKALQGGDWGWMRKEEM 238

Query: 243 HPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
              F + +K +++ +   P+ +  G   + I D +
Sbjct: 239 PTIFADQIKMQNKGSIIGPFRSGVGFHILKIEDVK 273



 Score = 70.8 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 72/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L   P  
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIEDVK-GLETVAVTEVNARHILIK-PTV 294

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            L + G  ++ +++              L +  S+    ++  G+  Y       P+F++
Sbjct: 295 ILSDDGAKEQ-LEEITRRVNAGEASFGDLAQQYSQDPGSAVQDGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +    +++
Sbjct: 354 QVETLPEGKISAPFKTVHGWHIVEVLDRREVDRTDSALKNKAYQILFNRKFNEEVGAWLQ 413

Query: 307 KLRSNAIIH 315
           ++R++A + 
Sbjct: 414 EVRASAFVE 422


>gi|330830997|ref|YP_004393949.1| peptidylprolyl cis-trans isomerase SurA [Aeromonas veronii B565]
 gi|328806133|gb|AEB51332.1| Peptidylprolyl cis-trans isomerase SurA [Aeromonas veronii B565]
          Length = 434

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/278 (14%), Positives = 103/278 (37%), Gaps = 12/278 (4%)

Query: 11  DFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKING 70
           D  K L       +F  +   +  +  +  ++   +N +V+        +  +KL     
Sbjct: 2   DMKKTLIALLTAGMFGAMSQAALAAPELMDKVLAVVNKDVVLSSQQDALVNKVKLSAQES 61

Query: 71  --------ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSS 122
                    L K A+  LI E+L+ Q  E+ G+      +       A +  ++ +   +
Sbjct: 62  GQSLPDDATLRKQALDRLIQESLQLQLAERQGLKISDTQLEQAIQGIAADNKMTLDQLRA 121

Query: 123 FLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR--EYLI 180
            L ++G+    +++ +  + +  +V +N    +    E E+    + +K    +  EY +
Sbjct: 122 QLAREGMTYAQYREEVRREILMNEVRRNQVRRRINISEQEVKQVVEILKKQGQQQNEYHV 181

Query: 181 RTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLE 239
             +  ++PDN    Q    K   +   + L+   D  KL    ++    +  G   ++  
Sbjct: 182 GHIQIALPDNPTAAQLDAAKSKIERILAALKQGADFRKLAIAESNGPKALEGGDWGWMSP 241

Query: 240 SDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
            ++       ++   + +   P  +  G+  + + D +
Sbjct: 242 QEMPTLMAEAVQGAKKGDIVGPLRSGAGLHIVKVFDTK 279



 Score = 70.8 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 54/151 (35%), Gaps = 6/151 (3%)

Query: 169 KMKNITVREYLIRTVLFS--IPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKI 226
             + +   E   R +L    I  ++ + +G +   + D +  +        K  +     
Sbjct: 280 GQQQVMQTEVKARHILIKPSIILSEEKAKGMLDGILHDIKSGKASFASMAEKYSEDPGSA 339

Query: 227 HDVSIGKAQYLLESDLHPQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIAL 284
             V  G+  +   +   P+F++++ +      + P+ T  G   + + D+R     + A 
Sbjct: 340 --VQGGELGWSDPNVYVPEFRDMVNRLQPGQISAPFRTSHGWHIVQVEDRRSQDATDKAQ 397

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +          +  +    ++ +LR  A I 
Sbjct: 398 EQRAYQLIYNRRFVEESQAWLDELRDEAYIQ 428


>gi|87198910|ref|YP_496167.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134591|gb|ABD25333.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 456

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/268 (17%), Positives = 99/268 (36%), Gaps = 15/268 (5%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQK-------INGELEKIAVQELIVETLKKQEIEKS 93
           R    +NGE+IT  D+ +R+AL+               L    ++ LI ETL+ QE + +
Sbjct: 64  RATAIVNGEIITGTDVEQRLALIVSANGGKIDGEEKERLRMQVLRNLIDETLQIQEAKAA 123

Query: 94  GITFDSNTVNYFFVQHARNT-GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            +  D   V+  + + A    G SA+    +L + G      K+ +  +  W ++++ + 
Sbjct: 124 DVPADDGQVDASYERVATQNFGQSADALEKYLARIGSSAASLKRQIRGEIAWQNLLRRNV 183

Query: 153 MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSI-PDNKLQNQGFVQKRIKDAEESRL 210
                  E E+    Q+++      EY I  +  +   +NK Q     +K ++  ++   
Sbjct: 184 QPFVNVSEGEVQEAMQRLQASKGTEEYRIGEIFLAATEENKPQVFANAEKIVEQLKQG-- 241

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEY 269
                     +++        G   ++  + L  +               P   + G   
Sbjct: 242 --GSFVAYARQYSEASTAAVGGDLGWIRLAQLPTELATTAASMGPGQLAGPVEIRGGFSI 299

Query: 270 IAICDKRDLGGEIALKAYLSAQNTPTKI 297
           + + DKR +       A LS +    + 
Sbjct: 300 LYLIDKRQVLTADPRDALLSLKQISIEF 327



 Score = 52.0 bits (123), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 67/180 (37%), Gaps = 12/180 (6%)

Query: 140 IQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQ 199
            Q   P  ++  F + Y   + ++     +   +++++  I          K        
Sbjct: 285 GQLAGPVEIRGGFSILYLIDKRQVLTADPRDALLSLKQISIEF-------PKGATNEIAT 337

Query: 200 KRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTT 258
           KR  +   +   + K C   E  A+KI   ++     +   DL    Q  LL      TT
Sbjct: 338 KRAAEFAAAVKAI-KGCGDAEAQANKI-GATVVANDQIKARDLPGALQETLLNLPIGQTT 395

Query: 259 NPY-VTQKGVEYIAICDKRDLGGEI-ALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            P+   ++GV  + +C + D           + AQ    ++ K    Y++ LR +A+I Y
Sbjct: 396 PPFGSIEEGVRVLMLCGRDDPQVNSGPSFDEMMAQIEDDRVNKRAQTYLRDLRRDAVIEY 455


>gi|332160260|ref|YP_004296837.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325664490|gb|ADZ41134.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 434

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 101/276 (36%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDATLRHQILERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +     S ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEDLAKKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           L   F   L+  S+ +   P  +  G   + + D R
Sbjct: 239 LPSLFAERLQSASKGDVVGPIRSGVGFHILKVNDIR 274



 Score = 63.5 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 68/242 (28%), Gaps = 31/242 (12%)

Query: 96  TFDSNTVNYFFVQHARNTGLSA---EDFSSFLDKQGIGDNHFKQYLAIQSIWPDV----- 147
                 V+      A+          DF              K     Q  W  +     
Sbjct: 186 NPSQQQVDQA-EDLAKKLVSDIKGGADFGKLAIANSADSQALKG---GQMGWGKLQELPS 241

Query: 148 -------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
                        V        G   +++   +   K I+V E   R +L     + +  
Sbjct: 242 LFAERLQSASKGDVVGPIRSGVGFHILKVNDIRGTDKTISVTEVHARHILLK--PSPVMT 299

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-LLK 251
               + ++  A         +   + K  S+    +   G   +       P F++ L+K
Sbjct: 300 DDQARAKLTAAAADIKSGKANFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDALMK 359

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRS 310
             +   + P  +  G   I + D R +    A +   + +     K  +    ++++ R+
Sbjct: 360 LQKGEISAPVHSSFGWHLIQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRA 419

Query: 311 NA 312
            A
Sbjct: 420 AA 421


>gi|241761719|ref|ZP_04759806.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752284|ref|YP_003225177.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|241374027|gb|EER63560.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258551647|gb|ACV74593.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 471

 Score =  135 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 98/267 (36%), Gaps = 18/267 (6%)

Query: 44  TTINGEVITDGDISKRIALLKLQKINGELEK-----------IAVQELIVETLKKQEIEK 92
             +NG +IT+ DI +R AL+ L    G++ +             ++ LI ETL+ QE + 
Sbjct: 73  AIVNGTIITNTDIEQRFALI-LASAGGDVSRISEEDRNMARLQILRNLIDETLEIQEAKA 131

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
           + I      ++  F  +ARN   + E FS+ L   G      K+ +     W  ++    
Sbjct: 132 NDIIITPTELDQIFEHYARNMKKTPEAFSADLQAIGSSAKSVKRQVEADMAWRRLLGRRV 191

Query: 153 MLKYGNLEMEIPANKQKMKNITVR-EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL- 210
                    E+     +MK    + EY I  + FS  D           +I+D    R  
Sbjct: 192 EPFVNISNEEVQNIINRMKAAKGKDEYHIAEIFFSANDTNRAEVRAKANKIQDQILQRGN 251

Query: 211 ---RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKG 266
              R+        +++        G   ++    L      ++K     +   P  T  G
Sbjct: 252 TNERMGLFSAFASQYSEASSAARGGDMGFIQAEQLPDALAAVVKNMPVGSLMGPIETPGG 311

Query: 267 VEYIAICDKRDLGGEIALKAYLSAQNT 293
              +A+ +K+ + G     A ++ +  
Sbjct: 312 FSIVALLEKQQILGIDPKDAIVALKQI 338



 Score = 45.0 bits (105), Expect = 0.013,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 180 IRTVLFSIPDNKLQNQG-FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLL 238
           ++ +  + P    QN       +++DA     +  K C  +++ A KI    +     + 
Sbjct: 335 LKQIYVNFPPGTSQNVADEKTAKLRDA----TKELKGCGSVDEIAHKI-GADVMSNDQIS 389

Query: 239 ESDLHPQFQNLLKKSQ-NNTTNPY-VTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPT 295
              + P  QN++ K Q   +T P+   Q+GV  + +C + D    +      +  Q    
Sbjct: 390 IRSMPPLLQNMVAKLQVGESTLPFGSIQEGVSVLVVCGRDDPKVAKQPNFQQIHNQLQED 449

Query: 296 KIEKHEAEYVKKLRSNAIIHY 316
           ++ K    Y++ LR +AII Y
Sbjct: 450 RVNKRAIRYLRDLRRDAIIDY 470


>gi|123440995|ref|YP_001004984.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122087956|emb|CAL10744.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607170|emb|CBY28668.1| survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase SurA) [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 434

 Score =  135 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 103/283 (36%), Gaps = 16/283 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDATLRHQILERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +     S ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEDLAKKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           L   F   L+  S+ +   P  +  G   + + D R  G +  
Sbjct: 239 LPSLFAERLQSASKGDVVGPIRSGVGFHILKVNDIR--GADKT 279



 Score = 63.1 bits (152), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 68/242 (28%), Gaps = 31/242 (12%)

Query: 96  TFDSNTVNYFFVQHARNTGLSA---EDFSSFLDKQGIGDNHFKQYLAIQSIWPDV----- 147
                 V+      A+          DF              K     Q  W  +     
Sbjct: 186 NPSQQQVDQA-EDLAKKLVSDIKGGADFGKLAIANSADSQALKG---GQMGWGKLQELPS 241

Query: 148 -------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
                        V        G   +++   +   K I+V E   R +L     + +  
Sbjct: 242 LFAERLQSASKGDVVGPIRSGVGFHILKVNDIRGADKTISVTEVHARHILLK--PSPVMT 299

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-LLK 251
               + ++  A         +   + K  S+    +   G   +       P F++ L+K
Sbjct: 300 DDQARAKLTAAAADIKSGKANFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDALMK 359

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKLRS 310
             +   + P  +  G   I + D R +    A +   + +     K  +    ++++ R+
Sbjct: 360 LQKGEISAPVHSSFGWHLIQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQRA 419

Query: 311 NA 312
            A
Sbjct: 420 AA 421


>gi|221234696|ref|YP_002517132.1| peptidyl-prolyl cis-trans isomerase [Caulobacter crescentus NA1000]
 gi|220963868|gb|ACL95224.1| peptidyl-prolyl cis-trans isomerase [Caulobacter crescentus NA1000]
          Length = 449

 Score =  135 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 98/256 (38%), Gaps = 17/256 (6%)

Query: 39  SSRIRTTINGEVITDGDISKRIALL----KLQKINGEL---EKIAVQELIVETLKKQEIE 91
           S  +   +N ++I+  D+ +R+ LL     +Q     L   E+ A++ LI E L+ QE++
Sbjct: 54  SESVAAVVNDDIISSYDLMQRMRLLMATSGMQPTQENLPQIEQEALRSLIDERLQMQELK 113

Query: 92  KSG------ITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           +        I      V       A++  L  E     L  QGIG + ++  L  +S W 
Sbjct: 114 RVEKQQKITIISTDKEVEEQIGDIAQSNRLQPEQLKQQLVAQGIGLDTWRAQLRAESSWQ 173

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITV-REYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             ++  +  +    E +I A ++++ +     +Y I  V                   + 
Sbjct: 174 SWIQGRYGSRLRIGEDQIKAYQRRLADAAAKPQYQISEVFLDAARVGGMEVAVNGA-TQL 232

Query: 205 AEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVT 263
             + +   P       +F+      + G+  ++ + ++  +    L++      + P   
Sbjct: 233 INQMQQGAP-FAAVARQFSGSATAANGGEVGWVSQGEMPTEVDAALEQLRPGQLSRPIQV 291

Query: 264 QKGVEYIAICDKRDLG 279
           + GV  I + DKR   
Sbjct: 292 KDGVYIIYLRDKRAGS 307



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 51/133 (38%), Gaps = 2/133 (1%)

Query: 184 LFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLH 243
             + P      +  +    K   + + ++   C  LE  A+K+  +  G       +DL 
Sbjct: 316 QVAAPLAADATEAQIAAATKQLVDLKPKI-TSCQSLEATAAKVDGLVAGDLGEAEITDLA 374

Query: 244 PQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEA 302
           P FQ    K +    ++P  T  G+  IA+C KR  G        +  +    ++     
Sbjct: 375 PAFQEAANKLEVGQISDPIRTDAGLHLIAVCGKRQGGANAPTHDQIENRLRGQQLALIAK 434

Query: 303 EYVKKLRSNAIIH 315
            Y++ LR+ A I 
Sbjct: 435 RYLRDLRNQATIE 447


>gi|330505263|ref|YP_004382132.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina NK-01]
 gi|328919549|gb|AEB60380.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina NK-01]
          Length = 432

 Score =  135 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/289 (15%), Positives = 111/289 (38%), Gaps = 19/289 (6%)

Query: 40  SRIRTTINGEVITDGDISKRIALLK--LQKINGELE------KIAVQELIVETLKKQEIE 91
            R+   ++ +V+    +  R+  ++  + K  G L       +  ++ LI+E ++ Q  +
Sbjct: 33  DRVVAIVDNDVVMQSQLDARLREVQQTIDKRGGALPPEHVLSQQVLERLIIENIQLQIGD 92

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +SGI      +N      A+  G+S E F   L + G+     +  +  + I   V +  
Sbjct: 93  RSGIRITDEELNQAMGTIAQRNGMSLEQFRDALARDGLSYADARDQVRREMIISRVRQRR 152

Query: 152 FMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
              +    + E+         K     E+ +  +L  + +    ++     R       +
Sbjct: 153 VAERIQVTDQEVQNFLASDLGKMQLSEEFRLANILIPVSEGASSSEIQAADRQAQELYQQ 212

Query: 210 LRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
           L+   D  +L    ++  + +  G+  +     L P F +++ + +    T P  T  G 
Sbjct: 213 LQQGADFGQLAVSRSASENALEGGEMGWRKAGQLPPPFDSMISQLNPGEATEPVRTPGGF 272

Query: 268 EYIAICDKRDLGGEIALK-----AYLSAQNTPTKIEKHEAEYVKKLRSN 311
             + + +KR  GG+  ++      ++  + +  + E+     V++L   
Sbjct: 273 IILKLIEKR--GGDTQVRDEVHVRHILIKPSEIRSEEETRRLVERLYQR 319



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 36/312 (11%), Positives = 94/312 (30%), Gaps = 59/312 (18%)

Query: 59  RIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE 118
           R AL +      +      +E+I+  ++++ + +  I      V  F         LS E
Sbjct: 122 RDALARDGLSYADARDQVRREMIISRVRQRRVAER-IQVTDQEVQNFLASDLGKMQLSEE 180

Query: 119 -DFSSFL------------DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP- 164
              ++ L                       Q L   + +  +  +    +      E+  
Sbjct: 181 FRLANILIPVSEGASSSEIQAADRQAQELYQQLQQGADFGQLAVSRSASENALEGGEMGW 240

Query: 165 -------------------------------------ANKQKMKNITVREYLIRTVLFSI 187
                                                  K+        E  +R +L   
Sbjct: 241 RKAGQLPPPFDSMISQLNPGEATEPVRTPGGFIILKLIEKRGGDTQVRDEVHVRHILIKP 300

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQ 245
            + + + +    +R+ +    R+   +D  +L K  S+    +   G   ++  + L P+
Sbjct: 301 SEIRSEEE---TRRLVERLYQRIVDGEDFAELAKSFSEDPGSALNGGDLNWIDPNALVPE 357

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQ-NTPTKIEKHEAE 303
           F+ ++  +     + P+ +  G   + +  +R        +   +A      K ++    
Sbjct: 358 FREVMNNTASGELSKPFKSPYGWHVLQVMGRRATDSSAQFREQQAANLLRNRKYDEELQA 417

Query: 304 YVKKLRSNAIIH 315
           +++++R  A + 
Sbjct: 418 WLRQIRDEAYVE 429


>gi|213018605|ref|ZP_03334413.1| hypothetical protein C1A_378 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995556|gb|EEB56196.1| hypothetical protein C1A_378 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 365

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 94/210 (44%), Gaps = 11/210 (5%)

Query: 30  IVSYKSWAMSSRIRTTINGEVITDGDISKRIAL----LKLQKING-ELEKIAVQELIVET 84
           ++  +  A    I   +NGE I++ DI +RI      L  QKIN  E++   +++LI E 
Sbjct: 1   MLPLRLLATEIEIVADVNGEPISNLDIERRINFINSLLGTQKINQKEVKSQILRQLIDEI 60

Query: 85  LKKQEIEKSGITFDSNTVNYFFVQHARNT-GLSAEDFSSFLDKQGIGDNHFKQYLAIQSI 143
           +   E +K  I   +  +N         +  L A++   ++ K  I  N  K+ +  Q +
Sbjct: 61  IIVSEAQKMNIELSNEELNNAVTLFLTQSLKLKADEVDQYVKKHNIDLNTLKKQIKCQLL 120

Query: 144 WPDVVKNDFMLKYGNLEMEI-PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
           W  +++   +      + E+  A KQK K+    +YLI    F IPD K+      + R 
Sbjct: 121 WNKIIEVGVVPLINISDQEVDDARKQKEKS----DYLITFQEFIIPDQKIAEDLVKKLRT 176

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDVSIG 232
            +  ES +++ K    L +   K+ DV  G
Sbjct: 177 SNNPESSIKMSKATVNLSQLKGKLKDVLEG 206


>gi|162420091|ref|YP_001605345.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Angola]
 gi|162352906|gb|ABX86854.1| chaperone SurA [Yersinia pestis Angola]
          Length = 434

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 102/276 (36%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   DI    + + +   Q   
Sbjct: 1   MKNWRTLILGLVICANT--AFAAPQEVDKVAAVVDNGVVLQSDIDGLLQSVKMNAQQSGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITV-REYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ    ++   E  +  
Sbjct: 119 AADGLSYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQVSGDTELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + + +   + ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPTQQQVDQAEDLANKLVADIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR 276
           L   F   L+ + +     P  +  G   + + D R
Sbjct: 239 LPSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMR 274



 Score = 65.8 bits (159), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 72/244 (29%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+      A    L A+     DF              K     Q  W  +   
Sbjct: 186 NPTQQQVDQA-EDLA--NKLVADIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 239

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          +        G   +++   +   + I+V E   R +L     + +
Sbjct: 240 PSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTISVTEVNARHILLK--PSPM 297

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-L 249
                 + +++ A         +   + K  S+    +   G+  +       P F++ L
Sbjct: 298 MTDEQARAKLEAAAAEIKSGKTNFATIAKEISQDPGSAMQGGELGWASPDIYDPAFRDAL 357

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 358 MKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQ 417

Query: 309 RSNA 312
           R+ A
Sbjct: 418 RAAA 421


>gi|330863030|emb|CBX73162.1| chaperone surA [Yersinia enterocolitica W22703]
          Length = 424

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 42/264 (15%), Positives = 95/264 (35%), Gaps = 12/264 (4%)

Query: 25  FCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN-----GELEKIA 76
             +    ++ +     ++   ++  V+   D+    + + L   Q          L    
Sbjct: 1   MVVCANTAFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQQVPDDATLRHQI 60

Query: 77  VQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQ 136
           ++ LI++ ++ Q  +K GIT     ++      A    ++     S L   G+  + +++
Sbjct: 61  LERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTPAQMRSRLAADGLNYDTYRE 120

Query: 137 YLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRTVLFSIPDNKLQN 194
            +  + +  +V  N+   +   L  E+    KQ     +   E  +  +L  +P+N  Q 
Sbjct: 121 QIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSGDAELNLSHILIPLPENPSQQ 180

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQFQNLLK-K 252
           Q    + +     S ++   D  KL    S        G+  +    +L   F   L+  
Sbjct: 181 QVDQAEDLAKKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQELPSLFAERLQSA 240

Query: 253 SQNNTTNPYVTQKGVEYIAICDKR 276
           S+ +   P  +  G   + + D R
Sbjct: 241 SKGDVVGPIRSGVGFHILKVNDIR 264



 Score = 63.1 bits (152), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 61/195 (31%), Gaps = 24/195 (12%)

Query: 140 IQSIWPDV------------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIR 181
            Q  W  +                  V        G   +++   +   K I+V E   R
Sbjct: 219 GQMGWGKLQELPSLFAERLQSASKGDVVGPIRSGVGFHILKVNDIRGTDKTISVTEVHAR 278

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLE 239
            +L     + +      + ++  A         +   + K  S+    +   G   +   
Sbjct: 279 HILLK--PSPVMTDDQARAKLTAAAADIKSGKANFATIAKEISQDPGSAMQGGDLGWASP 336

Query: 240 SDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKI 297
               P F++ L+K  +   + P  +  G   I + D R +    A +   + +     K 
Sbjct: 337 DIYDPAFRDALMKLQKGEISAPVHSSFGWHLIQVVDTRQVDKTDAAQKDRAYRMLFSRKF 396

Query: 298 EKHEAEYVKKLRSNA 312
            +    ++++ R+ A
Sbjct: 397 AEEAQTWMQEQRAAA 411


>gi|37524613|ref|NP_927957.1| peptidyl-prolyl cis-trans isomerase SurA [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81707805|sp|Q7N8V5|SURA_PHOLL RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|36784037|emb|CAE12906.1| Survival protein SurA precursor (Peptidyl-prolyl cis-trans
           isomerase surA) (PPIase) (Rotamase C) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 433

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/258 (17%), Positives = 95/258 (36%), Gaps = 12/258 (4%)

Query: 31  VSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKI--------NGELEKIAVQELIV 82
            ++ +     +I   +N  V+ + DI+ R+  +K               L    ++ LI+
Sbjct: 17  TAFAAPQQMDKIAAVVNNGVVLESDINNRLQSVKRDAQHAGQQIPDEQTLRHQILERLII 76

Query: 83  ETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQS 142
           + +  Q  ++ GIT     ++      A    ++ +     +   G+  + ++  +  + 
Sbjct: 77  DNILLQMAKQMGITIPDQALDSTIANIAAQNHITVDQMKHRIAADGMNFDTYRDQIRKEM 136

Query: 143 IWPDVVKNDFMLKYGNLEMEIPANKQ--KMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
           +  +V  N+   +   L  EI A  +    +N    E  I  +L  +P+N  Q Q     
Sbjct: 137 LIAEVRNNEVRRRVTILPQEIDALVKQISNQNTNDTELNISHILIPLPENPDQAQMEKAM 196

Query: 201 RIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTT 258
            +     S L+   D  KL   +++    +  G   +    +L   F   L+ +Q     
Sbjct: 197 TVVQKIMSELKHGVDFGKLAIAYSADPQALKGGNMGWSRLQELPTLFAEQLQLAQKGAVV 256

Query: 259 NPYVTQKGVEYIAICDKR 276
            P  +  G   + + D R
Sbjct: 257 GPIRSGVGFHILKVNDIR 274



 Score = 71.6 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/360 (11%), Positives = 98/360 (27%), Gaps = 67/360 (18%)

Query: 12  FIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE 71
            ++ L    +L+       ++    A+ S I        IT   +  RIA   +      
Sbjct: 70  ILERLIIDNILLQMAKQMGITIPDQALDSTIANIAAQNHITVDQMKHRIAADGM--NFDT 127

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNT-----------------G 114
                 +E+++  ++  E+ +  +T     ++    Q +                     
Sbjct: 128 YRDQIRKEMLIAEVRNNEVRRR-VTILPQEIDALVKQISNQNTNDTELNISHILIPLPEN 186

Query: 115 LSAEDFSSFLD---------KQGIG-----------DNHFKQYLAIQSIWPDV------- 147
                    +          K G+                K        W  +       
Sbjct: 187 PDQAQMEKAMTVVQKIMSELKHGVDFGKLAIAYSADPQALKG---GNMGWSRLQELPTLF 243

Query: 148 -----------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQG 196
                      V        G   +++   +     I V E   R +L     + +    
Sbjct: 244 AEQLQLAQKGAVVGPIRSGVGFHILKVNDIRGGNPTIAVTEVHARHILLRT--SPVMTDD 301

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIG--KAQYLLESDLHPQFQN-LLKKS 253
             + +++           D     K  S     ++      +       P F++ L++ +
Sbjct: 302 QARTKLQQIASDIRSGKTDFADAAKEFSDDPGSALRGGDLGWTAPDIYDPAFRDALMRLN 361

Query: 254 QNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNA 312
           +   + P  +  G   I + D R +   ++A K          K  +    ++++ R++A
Sbjct: 362 KGEISQPVHSSFGWHLIQLLDTRKVDKTDVAQKDRAYRMLFNRKFTEEAQSWMQEQRASA 421


>gi|262275062|ref|ZP_06052873.1| peptidyl-prolyl cis-trans isomerase SurA [Grimontia hollisae CIP
           101886]
 gi|262221625|gb|EEY72939.1| peptidyl-prolyl cis-trans isomerase SurA [Grimontia hollisae CIP
           101886]
          Length = 432

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/247 (16%), Positives = 88/247 (35%), Gaps = 10/247 (4%)

Query: 40  SRIRTTINGEVITDGDISKRIALLKLQKINGEL------EKIAVQELIVETLKKQEIEKS 93
            R+   +N  VI   DI      + L      L      E+  + +LI+E L+ QE ++ 
Sbjct: 28  DRVVAVVNDGVILSSDIDALEKTVALNADQANLPPKDVLEQQILDQLILEELQLQEAKRL 87

Query: 94  GITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFM 153
           GI  D   +       A+   LS       L + GI  + ++  +  +    +       
Sbjct: 88  GIRIDDTRLEQAINSIAKERNLSVSQLQERLKRNGISWSSYRDQIRREMTISEARNAQVR 147

Query: 154 LKYGNLEMEIP--ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR 211
            +   L  E+   A++   KN+   EY +  +   + +   + +  +     +     L+
Sbjct: 148 RRISILPQEVESLASQLNAKNLENVEYRLSHIQLRLNEGAEKEEREIVAETANRLVKELK 207

Query: 212 LPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEY 269
             +D   L    +     +  G   ++   ++   F + +K   +     P+ +  G   
Sbjct: 208 DGRDFAALALANSKGPKALQGGDWGWMRLEEMPTIFADQIKNNGKGAIIGPFRSGVGYHI 267

Query: 270 IAICDKR 276
           + I D +
Sbjct: 268 LKITDVK 274



 Score = 76.2 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 57/151 (37%), Gaps = 6/151 (3%)

Query: 169 KMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHD 228
            +K++ V E   R +L  I  + + +    ++++        +  K    L K  S    
Sbjct: 275 GLKSVAVTEVKARHIL--IKPSIVLSDDGAKRQLNQMIAQIKKGEKSFEDLAKQYSADPG 332

Query: 229 VSI--GKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIAL 284
            ++  G   +       P+F++ +        + P+ T  G   + + D+R     + A+
Sbjct: 333 SAVKGGDLGWQTSELYVPEFKDKVDTLPEGEISEPFKTVHGWHIVQVLDRRQADRTDTAM 392

Query: 285 KAYLSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
           +          K  +    ++++LR+ A + 
Sbjct: 393 QNRAYGMLLNRKFNEEVQAWLQELRAGAYVE 423


>gi|207742369|ref|YP_002258761.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum IPO1609]
 gi|206593759|emb|CAQ60686.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum IPO1609]
          Length = 473

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 54/313 (17%), Positives = 112/313 (35%), Gaps = 24/313 (7%)

Query: 23  IIFCIVPIVSYKSWAMSS----RIRTTINGEVITDGDISKRIAL----LKLQKINGELEK 74
           ++   +P  S  S A  S     +   +N ++IT  ++  R  L    L+ Q        
Sbjct: 45  LLRGTLPGPSTASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARA 104

Query: 75  ----IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
                 +++LI+E ++ Q  ++SGI      V+      A+   LS     S L + G+ 
Sbjct: 105 DLLGEVLEQLILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLAQSGLA 164

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
            + +++ L  + +   +   +   K    + EI    A +        +EY +  +L  +
Sbjct: 165 YDKYREDLRQEILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPV 224

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF 246
            ++    Q    +   ++   + +   D  KL + +S   + +  G+        L  QF
Sbjct: 225 AEDASAEQKAAARGKAESLLKQAQGGADFAKLARDSSSGPEAAQGGELGLRSIGRLPTQF 284

Query: 247 QN-LLKKSQNNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIE 298
            N ++             +  G   + + DKR  G   + K       ++  +  PT   
Sbjct: 285 ANAVVDLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSA 344

Query: 299 KHEAEYVKKLRSN 311
                 +  LR  
Sbjct: 345 DDARRQLAGLRDR 357



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 58/151 (38%), Gaps = 4/151 (2%)

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
               +  V +  +R +L         +    ++++    +  +      +   +++    
Sbjct: 319 GTAASAKVAQTQVRHILIKTGPTMSADDA--RRQLAGLRDRIVHGYDFSDAARRYSQDTS 376

Query: 228 DVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
             + G+  ++    L P+F+  +        + P  +Q GV  I +  +RD    +  + 
Sbjct: 377 ASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQPVQSQFGVHLIQVEGRRDAEVPVDRQR 436

Query: 287 -YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            Y  +     K++    +++++LR +A + Y
Sbjct: 437 DYARSVIREQKVQAAYEDWLRQLRDSAHVEY 467


>gi|22127555|ref|NP_670978.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis KIM 10]
 gi|45443417|ref|NP_994956.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51594986|ref|YP_069177.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis IP 32953]
 gi|108810533|ref|YP_646300.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Nepal516]
 gi|145600395|ref|YP_001164471.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Pestoides
           F]
 gi|150260469|ref|ZP_01917197.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis CA88-4125]
 gi|153949109|ref|YP_001402397.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis IP 31758]
 gi|165928093|ref|ZP_02223925.1| chaperone SurA [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165937810|ref|ZP_02226371.1| chaperone SurA [Yersinia pestis biovar Orientalis str. IP275]
 gi|166008803|ref|ZP_02229701.1| chaperone SurA [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212220|ref|ZP_02238255.1| chaperone SurA [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167422012|ref|ZP_02313765.1| chaperone SurA [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167426071|ref|ZP_02317824.1| chaperone SurA [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167470553|ref|ZP_02335257.1| chaperone SurA [Yersinia pestis FV-1]
 gi|170025786|ref|YP_001722291.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis YPIII]
 gi|186893987|ref|YP_001871099.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927692|ref|YP_002345567.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis CO92]
 gi|229836923|ref|ZP_04457088.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Pestoides A]
 gi|229840382|ref|ZP_04460541.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229842462|ref|ZP_04462617.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229900721|ref|ZP_04515845.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Nepal516]
 gi|270487908|ref|ZP_06204982.1| PPIC-type PPIASE domain protein [Yersinia pestis KIM D27]
 gi|294502589|ref|YP_003566651.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Z176003]
 gi|81691900|sp|Q66EQ7|SURA_YERPS RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|121956556|sp|Q7CG87|SURA_YERPE RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|121956562|sp|Q1CMT0|SURA_YERPN RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|21960659|gb|AAM87229.1|AE013971_5 survival protein [Yersinia pestis KIM 10]
 gi|45438286|gb|AAS63833.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis biovar Microtus str. 91001]
 gi|51588268|emb|CAH19875.1| peptidyl-prolyl cis-trans isomerase, survival protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774181|gb|ABG16700.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Nepal516]
 gi|115346303|emb|CAL19174.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis CO92]
 gi|145212091|gb|ABP41498.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Pestoides F]
 gi|149289877|gb|EDM39954.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis CA88-4125]
 gi|152960604|gb|ABS48065.1| chaperone SurA [Yersinia pseudotuberculosis IP 31758]
 gi|165914222|gb|EDR32838.1| chaperone SurA [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919954|gb|EDR37255.1| chaperone SurA [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165992142|gb|EDR44443.1| chaperone SurA [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206966|gb|EDR51446.1| chaperone SurA [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960149|gb|EDR56170.1| chaperone SurA [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167054994|gb|EDR64794.1| chaperone SurA [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169752320|gb|ACA69838.1| SurA domain [Yersinia pseudotuberculosis YPIII]
 gi|186697013|gb|ACC87642.1| SurA domain protein [Yersinia pseudotuberculosis PB1/+]
 gi|229682060|gb|EEO78152.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Nepal516]
 gi|229690772|gb|EEO82826.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229696748|gb|EEO86795.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229705866|gb|EEO91875.1| peptidyl-prolyl cis-trans isomerase (PPIase) [Yersinia pestis
           Pestoides A]
 gi|262360619|gb|ACY57340.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis D106004]
 gi|262364565|gb|ACY61122.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis D182038]
 gi|270336412|gb|EFA47189.1| PPIC-type PPIASE domain protein [Yersinia pestis KIM D27]
 gi|294353048|gb|ADE63389.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Z176003]
 gi|320016865|gb|ADW00437.1| peptidyl-prolyl cis-trans isomerase C [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 434

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 102/276 (36%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   DI    + + +   Q   
Sbjct: 1   MKNWRTLILGLVICANT--AFAAPQEVDKVAAVVDNGVVLQSDIDGLLQSVKMNAQQSGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITV-REYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ    ++   E  +  
Sbjct: 119 AADGLSYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQVSGDTELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + + +   + ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPTQQQVDQAEDLANKLVADIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR 276
           L   F   L+ + +     P  +  G   + + D R
Sbjct: 239 LPSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMR 274



 Score = 66.2 bits (160), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 71/244 (29%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+      A    L A+     DF              K     Q  W  +   
Sbjct: 186 NPTQQQVDQA-EDLA--NKLVADIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 239

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          +        G   +++   +   + I+V E   R +L     + +
Sbjct: 240 PSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTISVTEVNARHILLK--PSPM 297

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-L 249
                 + +++ A             + K  S+    +   G+  +       P F++ L
Sbjct: 298 MTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGELGWASPDIYDPAFRDAL 357

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 358 MKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQ 417

Query: 309 RSNA 312
           R+ A
Sbjct: 418 RAAA 421


>gi|34499685|ref|NP_903900.1| survival protein surA [Chromobacterium violaceum ATCC 12472]
 gi|81711632|sp|Q7NQB0|SURA_CHRVO RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|34105536|gb|AAQ61890.1| survival protein surA precursor [Chromobacterium violaceum ATCC
           12472]
          Length = 429

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/314 (15%), Positives = 113/314 (35%), Gaps = 14/314 (4%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKR----IALLKLQKIN 69
           K L    +  +                RI   +N  VIT  ++  R    I  L+ QK+ 
Sbjct: 3   KTLLALLIASVMQSALAAPATPVREVDRIVAVVNKNVITWQELQARVNEAIKQLEAQKVA 62

Query: 70  GELEK----IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
               +      ++++I E ++ Q     G+  +   V+      A+   LS     + L 
Sbjct: 63  PPPREVLERQVLEQMITEEVQLQYAASGGLRIEDAAVDQAVANLAKQNKLSEAGLKAQLA 122

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLF 185
           K GI  +  +  +  +     +  ++   +    + E+    +  ++    EY + ++L 
Sbjct: 123 KDGITLDRLRADIRRELTISRLRDSEVASRVNVSDSEVDQAMKSAQSANRTEYHLASILV 182

Query: 186 SIPDNKLQNQ-GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHP 244
           ++P+     Q   + +++  A+               ++   + +  G   +   + L  
Sbjct: 183 AVPERADAKQIDQLSQKVHKAQADLAAGQPFAKVSAAYSDAPNALKGGDMGWRSATSLPQ 242

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAY----LSAQNTPTKIEK 299
           +F  LL++ +    T+   TQ+G     + DKR  G  + ++ Y    +  +      E 
Sbjct: 243 EFVQLLEQMKVGADTDVIRTQQGFFIFKLVDKRSGGAPMMVEQYHPRHILIRTNEAVSEA 302

Query: 300 HEAEYVKKLRSNAI 313
                + ++R   +
Sbjct: 303 DAKARIDQVRDRIM 316



 Score = 79.3 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 44/300 (14%), Positives = 95/300 (31%), Gaps = 59/300 (19%)

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL-----DK 126
           L     +EL +  L+  E+    +    + V+    + A++   +    +S L       
Sbjct: 131 LRADIRRELTISRLRDSEVASR-VNVSDSEVDQAM-KSAQSANRTEYHLASILVAVPERA 188

Query: 127 QGIGDNHFKQYLA----------------------------IQSIWP-------DVVKND 151
                +   Q +                                 W        + V+  
Sbjct: 189 DAKQIDQLSQKVHKAQADLAAGQPFAKVSAAYSDAPNALKGGDMGWRSATSLPQEFVQLL 248

Query: 152 FMLKYGNLEMEIPANKQ-----------KMKNITVREYLIRTVLFSIPDNKLQNQGFVQK 200
             +K G     I   +                + V +Y  R +L     N+  ++   + 
Sbjct: 249 EQMKVGADTDVIRTQQGFFIFKLVDKRSGGAPMMVEQYHPRHILIRT--NEAVSEADAKA 306

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTN 259
           RI    +  +R  K  +  + ++    +   G   ++   DL P+F+  +        + 
Sbjct: 307 RIDQVRDRIMRGAKFADMAKLYSEDGSNAKGGDLGWVNMGDLVPEFEKAMVSLPIGQVSQ 366

Query: 260 PYVTQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           P  T  G   I +  KR  D+  +   K  +  Q    K+E+   ++V++LR +A +  +
Sbjct: 367 PVRTPFGWHLILVEGKRNQDVSSDH-EKMAVKQQIRARKMEQAYTDWVRQLRDSAFVEEH 425


>gi|83749338|ref|ZP_00946335.1| Peptidyl-prolyl cis-trans isomerase [Ralstonia solanacearum UW551]
 gi|83724016|gb|EAP71197.1| Peptidyl-prolyl cis-trans isomerase [Ralstonia solanacearum UW551]
          Length = 495

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 54/313 (17%), Positives = 112/313 (35%), Gaps = 24/313 (7%)

Query: 23  IIFCIVPIVSYKSWAMSS----RIRTTINGEVITDGDISKRIAL----LKLQKINGELEK 74
           ++   +P  S  S A  S     +   +N ++IT  ++  R  L    L+ Q        
Sbjct: 67  LLRGTLPGPSTASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARA 126

Query: 75  ----IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
                 +++LI+E ++ Q  ++SGI      V+      A+   LS     S L + G+ 
Sbjct: 127 DLLGEVLEQLILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLAQSGLA 186

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
            + +++ L  + +   +   +   K    + EI    A +        +EY +  +L  +
Sbjct: 187 YDKYREDLRQEILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPV 246

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF 246
            ++    Q    +   ++   + +   D  KL + +S   + +  G+        L  QF
Sbjct: 247 AEDASAEQKAAARGKAESLLKQAQGGADFAKLARDSSSGPEAAQGGELGLRSIGRLPTQF 306

Query: 247 QN-LLKKSQNNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIE 298
            N ++             +  G   + + DKR  G   + K       ++  +  PT   
Sbjct: 307 ANAVVDLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSA 366

Query: 299 KHEAEYVKKLRSN 311
                 +  LR  
Sbjct: 367 DDARRQLAGLRDR 379



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 58/151 (38%), Gaps = 4/151 (2%)

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
               +  V +  +R +L         +    ++++    +  +      +   +++    
Sbjct: 341 GTAASAKVAQTQVRHILIKTGPTMSADDA--RRQLAGLRDRIVHGYDFSDAARRYSQDTS 398

Query: 228 DVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
             + G+  ++    L P+F+  +        + P  +Q GV  I +  +RD    +  + 
Sbjct: 399 ASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQPVQSQFGVHLIQVEGRRDAEVPVDRQR 458

Query: 287 -YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            Y  +     K++    +++++LR +A + Y
Sbjct: 459 DYARSVIREQKVQAAYEDWLRQLRDSAHVEY 489


>gi|262172454|ref|ZP_06040132.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio mimicus MB-451]
 gi|261893530|gb|EEY39516.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio mimicus MB-451]
          Length = 431

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPQQLDSVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + + + +++      + +     L+   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVEEGQDKSEAES---LANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 68.1 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDEGAQKQLNEFIQRIKNGEATFGELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +  + +++
Sbjct: 354 QIEILPVGQISEPFQTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|269960923|ref|ZP_06175293.1| survival protein SurA [Vibrio harveyi 1DA3]
 gi|269834363|gb|EEZ88452.1| survival protein SurA [Vibrio harveyi 1DA3]
          Length = 427

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/267 (16%), Positives = 110/267 (41%), Gaps = 15/267 (5%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LE 73
           L+   ++      +     ++   +N  VI   DI+  +  L+               L+
Sbjct: 7   LLFTTLLSCGVTAAPVELDKVAVIVNDGVILQSDINTAMKTLQANARQSGKSLPSASVLK 66

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
              V++LI++TL+ QE E+ G+  D N +N    + ARN   S E  ++ +  +G+    
Sbjct: 67  DQVVEKLIIDTLQGQEAERIGVRIDDNRLNQAIAEIARNNNQSVEQLAASVQAEGLSYPE 126

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRTVLFSIPDNK 191
           F++ +  +    +        +   L  E+   A++   +     +Y I  +     D+K
Sbjct: 127 FREQIRKEIAASEARNALVRRRINILPAEVDSLADQLATETNATVQYKIGHIQLRFSDDK 186

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
            +++   +    +A   +L+   D +++   ++     +  G   ++ + ++   F + +
Sbjct: 187 DKSEVEAE---ANALVKKLKDGADFSEMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQI 243

Query: 251 K-KSQNNTTNPYVTQKGVEYIAICDKR 276
           K +++ +   P+ +  G   + + D +
Sbjct: 244 KMQNKGSIIGPFRSGIGFHILKVEDVK 270



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/192 (16%), Positives = 71/192 (36%), Gaps = 15/192 (7%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   +++   K  ++ + V E   R +L   P  
Sbjct: 236 PTIFADQIKMQ--NKGSIIGPFRSGIGFHILKVEDVK-GLETVAVTEVNARHILIK-PTV 291

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH-----DVSIGKAQYLLESDLHPQ 245
            L ++G      K+  E   R+        + A++           G+  Y       P+
Sbjct: 292 ILSDEGA----QKELNEFIRRIKAGEATFAQLATQYSQDPGSAAQNGELGYQTPDLYVPE 347

Query: 246 FQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAE 303
           F++ ++     + + P+ T  G   + + D+R +   + A+K          K  +    
Sbjct: 348 FKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNRKFNEEAGA 407

Query: 304 YVKKLRSNAIIH 315
           ++++LR++A + 
Sbjct: 408 WMQELRASAFVE 419


>gi|207727966|ref|YP_002256360.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum MolK2]
 gi|206591209|emb|CAQ56821.1| peptidyl-prolyl cis-trans isomerase (rotamase c) protein [Ralstonia
           solanacearum MolK2]
          Length = 473

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 54/313 (17%), Positives = 109/313 (34%), Gaps = 24/313 (7%)

Query: 23  IIFCIVPIVSYKSWAMSS----RIRTTINGEVITDGDISKRIAL----LKLQKINGELEK 74
           ++   +P  S  S A  S     +   +N ++IT  ++  R  L    L+ Q        
Sbjct: 45  LLRGTLPGPSTASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARA 104

Query: 75  ----IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
                 +++LI+E ++ Q  ++SGI      V+      A+   LS     S L + G+ 
Sbjct: 105 DLLGEVLEQLILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLAQSGLA 164

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
            + +++ L  + +   +   +   K    + EI    A +        +EY +  +L  +
Sbjct: 165 YDKYREDLRQEILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPV 224

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLESDLHPQF 246
            ++    Q    +   +    + +   D  KL +  +S       G+        L  QF
Sbjct: 225 AEDASAEQKAAARGKAENLLKQAQGGADFAKLARDNSSGPEAAQGGELGLRSIGRLPTQF 284

Query: 247 QN-LLKKSQNNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIE 298
            N ++             +  G   + + DKR  G   + K       ++  +  PT   
Sbjct: 285 ANAVVDLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSA 344

Query: 299 KHEAEYVKKLRSN 311
                 +  LR  
Sbjct: 345 DDARRQLAGLRDR 357



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 58/151 (38%), Gaps = 4/151 (2%)

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
               +  V +  +R +L         +    ++++    +  +      +   +++    
Sbjct: 319 GTAASAKVAQTQVRHILIKTGPTMSADDA--RRQLAGLRDRIVHGYDFSDAARRYSQDTS 376

Query: 228 DVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
             + G+  ++    L P+F+  +        + P  +Q GV  I +  +RD    +  + 
Sbjct: 377 ASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQPVQSQFGVHLIQVEGRRDAEVPVDRQR 436

Query: 287 -YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            Y  +     K++    +++++LR +A + Y
Sbjct: 437 DYARSVIREQKVQAAYEDWLRQLRDSAHVEY 467


>gi|146309025|ref|YP_001189490.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina ymp]
 gi|145577226|gb|ABP86758.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Pseudomonas
           mendocina ymp]
          Length = 430

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 100/261 (38%), Gaps = 14/261 (5%)

Query: 40  SRIRTTINGEVITDGDISKRIALLK--LQKINGELE------KIAVQELIVETLKKQEIE 91
            R+   ++ +V+    +  R+  ++  + K  G L       +  ++ LI+E ++ Q  E
Sbjct: 31  DRVVAIVDNDVVMQSQLDARLREVQQTIDKRGGALPPEHVLSQQVLERLIIENIQLQIGE 90

Query: 92  KSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKND 151
           +SGI      +N      A+  G+S E F   L + G+     +  +  + I   V +  
Sbjct: 91  RSGIRITDEELNQAMGTIAQRNGMSLEQFRQALARDGLSYADARDQVRREMIISRVRQRR 150

Query: 152 FMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
              +    + E+         K     E+ +  +L  + +    ++     R       +
Sbjct: 151 VAERIQVTDQEVQNFLASDLGKMQLSEEFRLANILIPVSEGASSSEIQAADRQARELYQQ 210

Query: 210 LRLPKDCNKLE-KFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGV 267
           L+   D  +L    ++    +  G+  +     L P F +++ + +    T P  T  G 
Sbjct: 211 LQQGADFAQLAISRSASETALEGGEMGWRKAGQLPPPFDSMISQLNPGEVTEPVRTPGGF 270

Query: 268 EYIAICDKRDLGGEIALKAYL 288
             + + +KR  GG+  ++  +
Sbjct: 271 IILKLIEKR--GGDTQVRDEV 289



 Score = 65.8 bits (159), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 61/154 (39%), Gaps = 7/154 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            K+        E  +R +L    + +   +    +R+ +    R+   +D  +L K  S+
Sbjct: 277 EKRGGDTQVRDEVHVRHILIKPSEIRSPEE---TRRLVERLYQRIVAGEDFAELAKSFSE 333

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEI 282
               +   G   ++  + L P+F+ ++ ++     + P+ TQ G   + +  +R      
Sbjct: 334 DPGSALNGGDLNWIDPNALVPEFRQVMSETASGELSKPFQTQFGWHVLQVMGRRATDSSA 393

Query: 283 ALKAYLSAQ-NTPTKIEKHEAEYVKKLRSNAIIH 315
             +   +A      K ++    +++++R  A + 
Sbjct: 394 QFREQQAANLLRNRKYDEELQAWLRQIRDEAYVE 427


>gi|296161011|ref|ZP_06843822.1| SurA domain protein [Burkholderia sp. Ch1-1]
 gi|295888710|gb|EFG68517.1| SurA domain protein [Burkholderia sp. Ch1-1]
          Length = 453

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 103/276 (37%), Gaps = 14/276 (5%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE------- 71
            F+ +       +S  S      I   +N  VIT  ++ +R+ L+  +            
Sbjct: 21  SFLSVAPVQAQALSGSSGQTVDTIAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMD 80

Query: 72  -LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L +  + ++++E ++ Q+ ++ GI  D  TV     + A    L+ + + S ++ QG+ 
Sbjct: 81  QLRQQVLNQMVLERIQLQKAKEDGINIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVP 140

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
            + F      +     + + +   K    + E+    A+++        +  ++ +    
Sbjct: 141 WSTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKA 200

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF 246
           P N  +      +R   A  +  +   +  KL K  S+  D S  G   ++  S L P+F
Sbjct: 201 PLNASETDIEAAQRKAQALLAEAKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEF 260

Query: 247 -QNLLKKSQNNTTN-PYVTQKGVEYIAICDKRDLGG 280
            +                T  G E + + D+R   G
Sbjct: 261 VKAASTLRPGEINPDLIRTNDGFEIVRLVDRRTGQG 296



 Score = 69.3 bits (168), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 68/180 (37%), Gaps = 4/180 (2%)

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
           L    I PD+++ +   +   L               + +  +R +L  +      ++  
Sbjct: 267 LRPGEINPDLIRTNDGFEIVRLVDRRTGQGTSSDAPKLVQTHVRHILLRV--GDGMSEPQ 324

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NN 256
            ++++ + +               ++        G   ++   +  P+F+  +   Q   
Sbjct: 325 ARQKLLEIKNEIAAGGDFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFERAMNSLQDGQ 384

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT-KIEKHEAEYVKKLRSNAIIH 315
            ++P  ++ G   I +  +R+  G +A +  L+ Q     K E+  A+++++LR  A + 
Sbjct: 385 ISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQAIGQRKAEQAYADWLRELRDTAYVE 444


>gi|291612516|ref|YP_003522673.1| SurA domain protein [Sideroxydans lithotrophicus ES-1]
 gi|291582628|gb|ADE10286.1| SurA domain protein [Sideroxydans lithotrophicus ES-1]
          Length = 433

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/316 (16%), Positives = 121/316 (38%), Gaps = 18/316 (5%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMS-SRIRTTINGEVITDGDISKRIA----LLKLQKI 68
           K +   F+++   +      +  A S  RI   +N +VIT  ++  R+A    +L+ QK 
Sbjct: 4   KKIFALFLIVFATVASAAESQKQATSLDRIDVIVNDDVITHRELENRVASVTKMLQRQKT 63

Query: 69  ----NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGL-SAEDFSSF 123
                  LE+  ++ +I E L  Q  ++SG+  D   ++   ++ A+         F + 
Sbjct: 64  ALPEKSILERQVLERMITEMLLAQYAKESGLRIDDGQLDKTILRIAQQNKFPDVAAFRAK 123

Query: 124 LDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIR 181
           L + G   N F++ +  + I   + + +   K    E +I    N Q  +     E  + 
Sbjct: 124 LTRDGTDYNEFREEIRNEIIAVRLREREVDSKLVISENDIDNYLNNQAHQEGKGEELQLS 183

Query: 182 TVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLES 240
            +L  +P+    ++    +   +   ++LR      ++    S   D    G+  +    
Sbjct: 184 HILVVVPEQATADKIQSYRDRAEQALAKLRAGAPFAQVAAGYSDAQDALKGGELGWRPAD 243

Query: 241 DLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR----DLGGEIALKAYLSAQNTPT 295
            L P F   L+K    + ++   +  G   I + D+R     +        ++  + +  
Sbjct: 244 RLPPLFAEALQKMKPGDLSDVLRSPSGFHIIKLLDRRSNDAPVVITQTHARHILIKTSEL 303

Query: 296 KIEKHEAEYVKKLRSN 311
             +      +++++  
Sbjct: 304 VTDSEAKSRLQEIKQR 319



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/154 (11%), Positives = 56/154 (36%), Gaps = 4/154 (2%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
            +     + + +   R +L    +  L      + R+++ ++   +      +   ++  
Sbjct: 279 RRSNDAPVVITQTHARHILIKTSE--LVTDSEAKSRLQEIKQRIDKGASFAEQARLYSED 336

Query: 226 IHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIAL 284
                 G   +L   +  P+F++ +   +    +    T  G   I + ++R+    +  
Sbjct: 337 GSAPQGGDLGWLSPGETVPEFESAMNALKVGQVSGLVQTGFGWHLIQVLERRNTDVSVEQ 396

Query: 285 KAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHYY 317
           K           K ++   +++++LR  A + Y+
Sbjct: 397 KRQRARNAIRTVKSDEAFQDWLRQLRDRAFVEYH 430


>gi|237746912|ref|ZP_04577392.1| chaperone SurA [Oxalobacter formigenes HOxBLS]
 gi|229378263|gb|EEO28354.1| chaperone SurA [Oxalobacter formigenes HOxBLS]
          Length = 468

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/290 (16%), Positives = 111/290 (38%), Gaps = 17/290 (5%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTI------NGEVITDGDISKRI 60
           + L+  + LL  +              ++ A + +           N +VIT G++++RI
Sbjct: 13  SVLNWAVTLLFGFACSTCVLAQTEKPVQAPAQAPKPVVVDAIAAVVNNDVITMGELNERI 72

Query: 61  ALL--KLQKIN------GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARN 112
            ++  +LQK N       EL+K  ++ +IVE+ + Q  ++ G+  D   ++    + A +
Sbjct: 73  QMIESQLQKQNVNLPPRAELQKQVLEHMIVESAQMQLAKEMGLRIDDTQLDRTIARIAES 132

Query: 113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKN 172
             ++   F  ++++ G      ++ +  +     +   + + K    + E+         
Sbjct: 133 KHMTVPQFQQYIERDGTSFESHREKIRSEITMQRLRDREVVNKIQINDAEVDHLLGADSQ 192

Query: 173 ITVRE-YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDC-NKLEKFASKIHDVS 230
           + + E   +  +L  IP+N    Q   ++   +     L+   D       ++     +S
Sbjct: 193 MQMPEQVRLGHILIRIPENASPEQIAEKRERAEKVLQILQSGGDFQQNAASYSDADEGLS 252

Query: 231 IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLG 279
            G   +     L   F + L+     N T    +  G   + + DKR + 
Sbjct: 253 GGDIGWRSTDRLPKIFADALVGVKPGNITGIIKSPNGFHILKVLDKRSMS 302



 Score = 73.5 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 57/149 (38%), Gaps = 11/149 (7%)

Query: 174 TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--- 230
            V++   R +L  +      ++       +   + + R+  D    E+ A    + +   
Sbjct: 316 AVQQIHARHILIKVNQLVSADEA-----KRKLLDLKQRIQNDSASFEELAKTYSNDTSAS 370

Query: 231 -IGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYL 288
             G   ++   D  P+F+  L+       + P  TQ G   I + DK+     +  K   
Sbjct: 371 RGGDLGWIYPGDTVPEFEKALVSLQPGEISEPVETQFGFHLIQVLDKKTDDVSLERKRIA 430

Query: 289 SAQ-NTPTKIEKHEAEYVKKLRSNAIIHY 316
           + Q     KI +   E++++LR  A + Y
Sbjct: 431 AKQALRERKIAEATEEWLRQLRDRAYVEY 459


>gi|108810078|ref|YP_653994.1| peptidyl-prolyl cis-trans isomerase SurA [Yersinia pestis Antiqua]
 gi|167401555|ref|ZP_02307049.1| chaperone SurA [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|121956548|sp|Q1C0H3|SURA_YERPA RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|108781991|gb|ABG16049.1| survival protein SurA precursor (peptidyl-prolyl cis-trans
           isomerase) [Yersinia pestis Antiqua]
 gi|167048937|gb|EDR60345.1| chaperone SurA [Yersinia pestis biovar Antiqua str. UG05-0454]
          Length = 434

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/276 (15%), Positives = 103/276 (37%), Gaps = 14/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKI- 68
           +K   T  + ++ C     ++ +     ++   ++  V+   DI    + + +   Q   
Sbjct: 1   MKNWRTLILGLVICANT--AFAAPQEVDKVAAVVDNGVVLQSDIDGLLQSVKMNAQQSGL 58

Query: 69  ----NGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
               +  L    ++ LI++ ++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITV-REYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ    ++   E  +  
Sbjct: 119 AADGLSYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQVSGDTELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + + +   + ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPTQQQVDQAEDLANKLVADIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKR 276
           L   F   L+ + +     P  +  G   + + D R
Sbjct: 239 LPSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMR 274



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 71/244 (29%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+      A    L A+     DF              K     Q  W  +   
Sbjct: 186 NPTQQQVDQA-EDLA--NKLVADIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 239

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          +        G   +++   +   + I+V E   R +L     + +
Sbjct: 240 PSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTISVTEVNARHILLK--PSPM 297

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-L 249
                 + +++ A             + K  S+    +   G+  +       P F++ L
Sbjct: 298 MTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGELGWASPDIYDPAFRDAL 357

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 358 MKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNRKFAEEAQTWMQEQ 417

Query: 309 RSNA 312
           R+ A
Sbjct: 418 RAAA 421


>gi|258627055|ref|ZP_05721853.1| survival protein SurA [Vibrio mimicus VM603]
 gi|258580729|gb|EEW05680.1| survival protein SurA [Vibrio mimicus VM603]
          Length = 431

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPEQLDGVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + + + +++      + +     L+   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVEEGQDKSEAES---LANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 68.9 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDEGAQKQLNEFVQRIKNGEATFGELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +  + +++
Sbjct: 354 QIEILPVGQISEPFQTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|122070617|sp|Q5P7I9|SURA_AZOSE RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 439

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/324 (14%), Positives = 121/324 (37%), Gaps = 25/324 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSR--------IRTTINGEVITDGDISKRI--AL 62
           ++ +++   L++F  +   +    A ++         I   +N EVIT  ++ +R+  A+
Sbjct: 1   MRRISSRLSLVLFAALSCATALFPAHAANPRSVEVDHIAAVVNNEVITARELRERVEQAI 60

Query: 63  LKLQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
            +L +          LE+  ++ L++E  + Q   ++ +  D  T+     + A +  L+
Sbjct: 61  HQLNRQGTPQPPADVLERQLLERLVLERAQLQLARETSLQVDEATLERAIARIAESNRLT 120

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI-TV 175
                + L+K G+  + F+  +  + +   + + +   +    + E+        +  + 
Sbjct: 121 IAQLQAALEKDGVSWSRFRDNIRTEILLTRLREREVDNRIVVTDAEVDNFLANNADALSG 180

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKA 234
            E+ +  +L  +P+   Q Q        +  + RL    D  ++    S   D  + G  
Sbjct: 181 EEFELAHILIRVPEAATQQQMAGLVARAETAKQRLNSGDDFARVAASYSDAPDAMNGGAL 240

Query: 235 QYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGG------EIALKAY 287
            +     L P F   ++  S  + +    +  G+  + + D+R          E     +
Sbjct: 241 GWRSRDRLPPLFAEAVRELSPGSVSPVLRSSAGLHIVKLLDRRGGAAAGPQQLEQTRARH 300

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSN 311
           +  + +    +      +  LR  
Sbjct: 301 ILIRTSEILNDSEAESRLLGLRER 324



 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 49/143 (34%), Gaps = 6/143 (4%)

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
           +   R +L    +  + N    + R+    E  +         +  ++ +     G   +
Sbjct: 295 QTRARHILIRTSE--ILNDSEAESRLLGLRERVVNGASFAELAKAHSADLSSAKGGDLGW 352

Query: 237 LLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR--DLGGEIALKAYLSAQNT 293
           L   D  P+F+  +        + P  +  G   I +  +R  D+  E   +        
Sbjct: 353 LSPGDTVPEFERTMNALKPGEVSAPVRSPFGWHLIQVEARRLQDVSDER-KRNAARNALR 411

Query: 294 PTKIEKHEAEYVKKLRSNAIIHY 316
             K ++   +++++LR    + Y
Sbjct: 412 ERKADEAFEDWLRQLRDRTYVEY 434


>gi|258623407|ref|ZP_05718411.1| survival protein SurA [Vibrio mimicus VM573]
 gi|258584373|gb|EEW09118.1| survival protein SurA [Vibrio mimicus VM573]
          Length = 431

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE- 71
           +KL     + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVISALTLFNAHAEPEQLDGVAVIVNSGVILQSDVDGALKTVKANAKQNNQ 60

Query: 72  -------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE E+ G+  D N +N    + A+N   + E   S +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEAERIGVKIDDNRLNDAIKEIAKNNQQTQEQLISSV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + + + +++      + +     L+   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVEEGQDKSKAES---LANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 68.9 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDEGAQKQLNEFVQRIKNGEATFGELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +  + +++
Sbjct: 354 QIEILPVGQISEPFQTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|238797487|ref|ZP_04640985.1| Chaperone surA [Yersinia mollaretii ATCC 43969]
 gi|238718628|gb|EEQ10446.1| Chaperone surA [Yersinia mollaretii ATCC 43969]
          Length = 434

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/283 (15%), Positives = 104/283 (36%), Gaps = 16/283 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQAGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GIT     ++      A    ++     S L
Sbjct: 59  QVPDDATLRHQILERLIMDNIQLQMAKKMGITVSDEALDKAIADIAAQNRMTTAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQIGNQTSADAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + + +   S ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEELANKLVSDIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           L   F   L+ + + +   P  +  G   + + D R  G +  
Sbjct: 239 LPSLFAERLQSANKGDVVGPIRSGVGFHILKVNDIR--GADKT 279



 Score = 66.2 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 32/244 (13%), Positives = 71/244 (29%), Gaps = 35/244 (14%)

Query: 96  TFDSNTVNYFFVQHARNTGLSAE-----DFSSFLDKQGIGDNHFKQYLAIQSIWPDV--- 147
                 V+    + A    L ++     DF              K     Q  W  +   
Sbjct: 186 NPSQQQVDQA-EELA--NKLVSDIKGGADFGKLAIANSADSQALKG---GQMGWGKLQEL 239

Query: 148 ---------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL 192
                          V        G   +++   +   K ++V E   R +L     + +
Sbjct: 240 PSLFAERLQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEVHARHILLK--PSPV 297

Query: 193 QNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN-L 249
                 + ++  A             + K  S+    ++  G   +       P F++ L
Sbjct: 298 MTDDQARAKLTAAAADIKSGKATFANIAKEISQDPGSAVQGGDLGWASPDIYDPAFRDAL 357

Query: 250 LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQN-TPTKIEKHEAEYVKKL 308
           +K  +   + P  +  G   I + D R +    A +   + +     K  +    ++++ 
Sbjct: 358 MKLQKGEISAPVHSSFGWHLIQVVDTRQVDKTDAAQKDRAYRMLFSRKFAEEAQTWMQEQ 417

Query: 309 RSNA 312
           R+ A
Sbjct: 418 RAAA 421


>gi|289209139|ref|YP_003461205.1| peptidylprolyl isomerase [Thioalkalivibrio sp. K90mix]
 gi|288944770|gb|ADC72469.1| Peptidylprolyl isomerase [Thioalkalivibrio sp. K90mix]
          Length = 475

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 101/292 (34%), Gaps = 16/292 (5%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIALLKLQ--------KINGELEKIAVQELIVETLKKQ 88
             + RI   +  +V+T  ++ +R+ L+  Q             L +  ++ LIVE ++ Q
Sbjct: 68  QFTDRILAVVGDDVVTQRELVERMNLVAQQMMERGTRPPDRDTLARQVMERLIVERVQLQ 127

Query: 89  EIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVV 148
           E ++ GI  D  T+N      AR   ++       L + G+  N F++ +  +     + 
Sbjct: 128 EAQRVGINIDEMTLNRAMENIARENRMTLPQLRQALLQDGVDFNAFREQIRNELTVNQLQ 187

Query: 149 KNDFMLKYGNLEMEIPANKQKMKNIT--VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAE 206
           +     +    + EI                Y I  +  S+P      Q    +      
Sbjct: 188 RRQVDNQIRVSDQEIADLIASESGAIDRGVRYRIAHIQVSLPRGADSGQIATAREKAREL 247

Query: 207 ESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF-QNLLKKSQNNTTNPYVTQ 264
             R+R  +D   +    S   D    G   +    ++   F +  +       ++   + 
Sbjct: 248 RQRVREGEDFASVAISESDAPDALEGGDLGWRTAGEIPSVFAREAVLMRTGEISDVLRSP 307

Query: 265 KGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            G   + + D+   GG+         ++     ++  ++  ++ R  A   Y
Sbjct: 308 NGFHIMKLVDRE--GGDQTRVRQTQVRHILISPDQVRSD--EEARRQAESLY 355



 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 63/155 (40%), Gaps = 7/155 (4%)

Query: 166 NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASK 225
           +++      VR+  +R +L S    +   +    +R  ++  +R+R   D   L +  S 
Sbjct: 317 DREGGDQTRVRQTQVRHILISPDQVRSDEEA---RRQAESLYNRIREGSDFEALARANSD 373

Query: 226 IHDVS--IGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDL-GGE 281
               +   G+  ++   +L P+F+  +        + P  +Q G   I + D R++    
Sbjct: 374 DPGSAAQGGQLGWISPGELVPEFEEAMNALQPGEISEPVESQFGWHIIEVLDHREVDTSR 433

Query: 282 IALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             ++A         K E+    ++++LR  A + Y
Sbjct: 434 EQIRARAREILQNRKREEEIELWMRRLRDEAYVEY 468


>gi|261209784|ref|ZP_05924089.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC341]
 gi|260841174|gb|EEX67687.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC341]
          Length = 431

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 109/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +KL  T  + +I  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKTTLISVISMLTLFNAHAEPQQLDGVAVIVNSGVILQSDVDGALKTVKANAKQNKQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQESVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + + + +++      + +     L+   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVEEGQDKSEAES---LANKLVGELKHGADFAQMAYTYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D R
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVR 273



 Score = 70.5 bits (171), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I  + + ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKID-DVRGLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDDGAQKQLSEFVQRIKNGEVSFGELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R +   + ALK          K  +  + +++
Sbjct: 354 QVETLPVGQISEPFKTVHGWHIVEVLDRRQVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|119899176|ref|YP_934389.1| putative peptidyl-prolyl cis-trans isomerase [Azoarcus sp. BH72]
 gi|119671589|emb|CAL95502.1| putative peptidyl-prolyl cis-trans isomerase [Azoarcus sp. BH72]
          Length = 439

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/315 (15%), Positives = 111/315 (35%), Gaps = 17/315 (5%)

Query: 14  KLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGE 71
           + L    V      +P+ +        RI   +N EVIT   +  R+     +LQ+   +
Sbjct: 9   RSLFVALVACSALALPVRAAVQPVAVDRIIAVVNNEVITAVQLRDRVDQTTRQLQRQGVQ 68

Query: 72  L------EKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLD 125
           L      E+  ++ LIVE  + Q    S +  D  T+     + A N  ++     + L+
Sbjct: 69  LPPADVLERQLLERLIVERAQLQLARDSSLRVDDATLERAIGRIAENNKMNTTQLRAALE 128

Query: 126 KQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA-NKQKMKNITVREYLIRTVL 184
           + G+  + F+  +  + +   + + +   K    + E+           +  E+ +  +L
Sbjct: 129 RDGVAWDRFRNEIRTEILLSRLREREVDAKIVVTDAEVDNFLTSNPDAFSGEEFHVAHIL 188

Query: 185 FSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLH 243
              P+     Q    ++  D   +RLR  +D  ++   +S   D  S G   +     L 
Sbjct: 189 LRAPEGATPEQIDRLRQRADTVINRLRNGEDFARVAADSSDAPDGISGGDLGWRQRDRLP 248

Query: 244 PQFQNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGG------EIALKAYLSAQNTPTK 296
             + + +        +    +  G+  + + D+R          E     ++  + +   
Sbjct: 249 ALYSDAVRDLRPGELSPLMRSAAGLHLVKLVDRRGGAAAGPQRLEQTRARHILIKTSAVL 308

Query: 297 IEKHEAEYVKKLRSN 311
            +      +  LR  
Sbjct: 309 SDAEAEARLLGLRER 323



 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 57/174 (32%), Gaps = 19/174 (10%)

Query: 146 DVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDA 205
            +V        G   +E              +   R +L     + + +    + R+   
Sbjct: 277 KLVDRRGGAAAGPQRLE--------------QTRARHILIKT--SAVLSDAEAEARLLGL 320

Query: 206 EESRLRLPKDCNKLEKFASK-IHDVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVT 263
            E  +    D  +L K +S  +     G   ++   D  P+F+  +        + P  +
Sbjct: 321 RERVVAGGADFGELAKASSADLSAAKGGDLGWVNPGDTVPEFERAMNVLKPGEVSPPVRS 380

Query: 264 QKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
             G   I + ++R     +   +          K E+   ++V++LR +  + Y
Sbjct: 381 PFGWHLIQVLERRQQDVTDERKRMAARNILRERKAEEAYEDWVRQLRDSTYVEY 434


>gi|56476034|ref|YP_157623.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Aromatoleum
           aromaticum EbN1]
 gi|56312077|emb|CAI06722.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Aromatoleum
           aromaticum EbN1]
          Length = 454

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/324 (14%), Positives = 121/324 (37%), Gaps = 25/324 (7%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSR--------IRTTINGEVITDGDISKRI--AL 62
           ++ +++   L++F  +   +    A ++         I   +N EVIT  ++ +R+  A+
Sbjct: 16  LRRISSRLSLVLFAALSCATALFPAHAANPRSVEVDHIAAVVNNEVITARELRERVEQAI 75

Query: 63  LKLQKINGE------LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLS 116
            +L +          LE+  ++ L++E  + Q   ++ +  D  T+     + A +  L+
Sbjct: 76  HQLNRQGTPQPPADVLERQLLERLVLERAQLQLARETSLQVDEATLERAIARIAESNRLT 135

Query: 117 AEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNI-TV 175
                + L+K G+  + F+  +  + +   + + +   +    + E+        +  + 
Sbjct: 136 IAQLQAALEKDGVSWSRFRDNIRTEILLTRLREREVDNRIVVTDAEVDNFLANNADALSG 195

Query: 176 REYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKA 234
            E+ +  +L  +P+   Q Q        +  + RL    D  ++    S   D  + G  
Sbjct: 196 EEFELAHILIRVPEAATQQQMAGLVARAETAKQRLNSGDDFARVAASYSDAPDAMNGGAL 255

Query: 235 QYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGG------EIALKAY 287
            +     L P F   ++  S  + +    +  G+  + + D+R          E     +
Sbjct: 256 GWRSRDRLPPLFAEAVRELSPGSVSPVLRSSAGLHIVKLLDRRGGAAAGPQQLEQTRARH 315

Query: 288 LSAQNTPTKIEKHEAEYVKKLRSN 311
           +  + +    +      +  LR  
Sbjct: 316 ILIRTSEILNDSEAESRLLGLRER 339



 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 49/143 (34%), Gaps = 6/143 (4%)

Query: 177 EYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQY 236
           +   R +L    +  + N    + R+    E  +         +  ++ +     G   +
Sbjct: 310 QTRARHILIRTSE--ILNDSEAESRLLGLRERVVNGASFAELAKAHSADLSSAKGGDLGW 367

Query: 237 LLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKR--DLGGEIALKAYLSAQNT 293
           L   D  P+F+  +        + P  +  G   I +  +R  D+  E   +        
Sbjct: 368 LSPGDTVPEFERTMNALKPGEVSAPVRSPFGWHLIQVEARRLQDVSDER-KRNAARNALR 426

Query: 294 PTKIEKHEAEYVKKLRSNAIIHY 316
             K ++   +++++LR    + Y
Sbjct: 427 ERKADEAFEDWLRQLRDRTYVEY 449


>gi|254251452|ref|ZP_04944770.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia dolosa
           AUO158]
 gi|124894061|gb|EAY67941.1| Parvulin-like peptidyl-prolyl isomerase [Burkholderia dolosa
           AUO158]
          Length = 454

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/300 (16%), Positives = 114/300 (38%), Gaps = 22/300 (7%)

Query: 34  KSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGE------LEKIAVQELIVETL 85
           +   ++  +   +N +VIT  ++ +R++L+  +LQ+ N        L    + ++++E +
Sbjct: 36  QGAQLADEVVAVVNNDVITGRELDQRVSLIARRLQQQNAPVPPADQLRAQVLNQMVLERI 95

Query: 86  KKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWP 145
           + Q+ +  GI  D  TV     + A+  G++ + + + L+ QG+  N F      + +  
Sbjct: 96  QVQKAKDDGIRIDDATVQATLQRLAQANGMTLDQYRARLEAQGVPWNIFTNDARTELMLS 155

Query: 146 DVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRI 202
            + + +   K    + E+    A+++       ++   + +    P N  Q +    ++ 
Sbjct: 156 KLREREVDSKITVSDAEVANYIASQRGPNAAQQQDLRFQHIFIKAPTNAPQTEIEAAQKK 215

Query: 203 KDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQ-FQNLLKKSQNNTTNP 260
            +A   +     D  KL +  S+ +D    G   +     L P   Q   K         
Sbjct: 216 AEALLQQAMSGADFEKLARNNSEANDAKKGGDLGFKSPGALPPDVVQAASKLRPGQVNPT 275

Query: 261 -YVTQKGVEYIAICDKRDLGGEIALK--------AYLSAQNTPTKIEKHEAEYVKKLRSN 311
                 G E + + D+R   G  A           ++  +    K E    + +  +R  
Sbjct: 276 LIRVPDGFEIVRLVDRRPSQGATAAAPKIVQTHVRHILIRVGEGKSEGQARQELLDIRKQ 335



 Score = 72.0 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 71/183 (38%), Gaps = 4/183 (2%)

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQ 195
             L    + P +++     +   L    P+         + +  +R +L  + + K  ++
Sbjct: 265 SKLRPGQVNPTLIRVPDGFEIVRLVDRRPSQGATAAAPKIVQTHVRHILIRVGEGK--SE 322

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ- 254
           G  ++ + D  +              ++        G   ++   +  P+F+  +   Q 
Sbjct: 323 GQARQELLDIRKQIEAGGDFAKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNSLQD 382

Query: 255 NNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT-KIEKHEAEYVKKLRSNAI 313
              + P  T+ G   I + D+R+  G +  +  ++ Q     K E+  A+++++LR ++ 
Sbjct: 383 GQISQPVRTEYGYHLIQVLDRREAEGSVQQQMDIARQAIGQRKAEQAYADWLRELRDSSY 442

Query: 314 IHY 316
           + Y
Sbjct: 443 VQY 445


>gi|307728470|ref|YP_003905694.1| SurA domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307583005|gb|ADN56403.1| SurA domain protein [Burkholderia sp. CCGE1003]
          Length = 468

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 106/276 (38%), Gaps = 14/276 (5%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALL--KLQKINGE----- 71
            FV +       ++         I   +N  VIT  ++ +R+ L+  +L + N       
Sbjct: 36  SFVSVAPVQAQALAGNRGQTVDTIAAVVNNGVITRRELDERVGLIARRLNQQNAPVPPAD 95

Query: 72  -LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L +  + ++++E ++ Q+ ++ GI  D   V     + A+   +S + + + ++ QG+ 
Sbjct: 96  QLRQQVLNQMVLERIQLQKAKEVGINIDDAAVQKTLERLAQANNMSLDTYRARIEAQGVP 155

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
              F      +     + + +   K    + E+    A+++        +  ++ +    
Sbjct: 156 WATFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGATSDLHMQHIFLKA 215

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESDLHPQF 246
           P N  Q      ++  +A  +  +   +  KL K  S+  D    G   Y   S L P+F
Sbjct: 216 PLNAPQTDIEAAQKKAEALLAEAKGGANFEKLAKSNSQAPDAGKGGDMGYASPSKLPPEF 275

Query: 247 QNLLKKSQNNTTNPYV--TQKGVEYIAICDKRDLGG 280
                  +    NP V  T  G E + + D+R   G
Sbjct: 276 VKAASSLRPGQVNPEVIRTNDGFEIVRLVDRRTGQG 311



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 69/180 (38%), Gaps = 4/180 (2%)

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
           L    + P+V++ +   +   L               + +  +R +L  +      ++  
Sbjct: 282 LRPGQVNPEVIRTNDGFEIVRLVDRRTGQGTSSDAPKLMQTHVRHILLRV--GDGMSEPQ 339

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NN 256
            ++++ + +               ++        G   ++   +  P+F+  +   Q   
Sbjct: 340 ARQKLLEIKREIAAGGDFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFERAMNTLQDGQ 399

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT-KIEKHEAEYVKKLRSNAIIH 315
            ++P  ++ G   I + ++R+  G IA +  L+ Q     K E+  A+++++LR  A + 
Sbjct: 400 ISDPVRSEYGYHLIQVLERREAQGSIAQQMDLARQAIGQRKAEQAYADWLRELRDTAYVE 459


>gi|88810558|ref|ZP_01125815.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrococcus mobilis
           Nb-231]
 gi|88792188|gb|EAR23298.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Nitrococcus mobilis
           Nb-231]
          Length = 430

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/305 (13%), Positives = 104/305 (34%), Gaps = 13/305 (4%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK--LQKI------NGE 71
           F+ ++  I       +  +  RI   +N  V+   ++ + + +++  LQ+          
Sbjct: 11  FLALVVFIEAQTPLLAAQVLDRIVAVVNDSVVLQSELKEELIIVRQQLQRQDMQLPDPRN 70

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           L+   +++LI++ L+     ++GI+ D  T++    + A    ++   F   L  + IG 
Sbjct: 71  LQHQVLEQLILKKLQLDAASRTGISVDDATLDAAVRRVAEQNQMTLSQFRDALAAEAIGW 130

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNK 191
             F+  L  Q I   +       +      EI     + +     EY +  +L ++PD  
Sbjct: 131 EDFRDKLRDQIIISRLRHQVMQSRINVTPQEIAQFVAQQRGGQSAEYHLGHILVALPDAA 190

Query: 192 LQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNLL 250
                   +   +    +L            ++     +  G   +  + +L      L+
Sbjct: 191 SPQTIAQARDKAERIHRQLEQEASFETLAASYSDSQTALQGGDLGWRKQGELPTLIAELI 250

Query: 251 KKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGEIALK---AYLSAQNTPTKIEKHEAEYVK 306
                   T    +  G     +  +R+    I  +    ++  +      ++     ++
Sbjct: 251 SGLPVGKVTPVLRSPSGFHIFKLLARREGERHIITQTHARHILIETNAVVSDRDARRRLE 310

Query: 307 KLRSN 311
            LR  
Sbjct: 311 SLRKR 315



 Score = 59.7 bits (143), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/155 (12%), Positives = 54/155 (34%), Gaps = 7/155 (4%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
             +++ +   + +   R +L               +R  ++   R+        L K  S
Sbjct: 274 LARREGERHIITQTHARHILIETNAVVSDRDA---RRRLESLRKRIENGDSFAALAKAHS 330

Query: 225 --KIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
                    G   ++    +   F+ ++     +  + P+ T+ G   + + ++R     
Sbjct: 331 DDSTSAFQGGDLGWVDPGRMVATFEQVMDSLQPDEISQPFHTRYGWHIVQVLNRRKQDTT 390

Query: 282 IALKAYLSAQNT-PTKIEKHEAEYVKKLRSNAIIH 315
            A +   +AQ     K++     ++++LR  A + 
Sbjct: 391 EAYRREQAAQQIQNRKLQDETQLWLRQLREEAYVD 425


>gi|122070641|sp|Q145L3|SURA_BURXL RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
          Length = 450

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 102/276 (36%), Gaps = 14/276 (5%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE------- 71
            F+ +       +S         I   +N  VIT  ++ +R+ L+  +            
Sbjct: 18  SFLSVAPVQAQALSGSGGQTVDTIAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMD 77

Query: 72  -LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L +  + ++++E ++ Q+ ++ GIT D  TV     + A    L+ + + S ++ QG+ 
Sbjct: 78  QLRQQVLNQMVLERIQLQKAKEDGITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVP 137

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
              F      +     + + +   K    + E+    A+++        +  ++ +    
Sbjct: 138 WTTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKA 197

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF 246
           P N  +      +R   A  +  +   +  KL K  S+  D S  G   ++  S L P+F
Sbjct: 198 PLNASETDIEAAQRKAQALLAEAKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEF 257

Query: 247 -QNLLKKSQNNTTN-PYVTQKGVEYIAICDKRDLGG 280
            +                T  G E + + D+R   G
Sbjct: 258 VKAASALRPGEVNPDLIRTSDGFEIVRLVDRRAGQG 293



 Score = 69.7 bits (169), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 67/180 (37%), Gaps = 4/180 (2%)

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
           L    + PD+++     +   L               + +  +R +L  +      ++  
Sbjct: 264 LRPGEVNPDLIRTSDGFEIVRLVDRRAGQGTSSDAPKLVQTHVRHILLRV--GDGMSEPQ 321

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NN 256
            ++++ + +               ++        G   ++   +  P+F+  +   Q   
Sbjct: 322 ARQKLLEIKNEIAAGGDFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFERAMNSLQDGQ 381

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT-KIEKHEAEYVKKLRSNAIIH 315
            ++P  ++ G   I +  +R+  G +A +  L+ Q     K E+  A+++++LR  A + 
Sbjct: 382 ISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQAIGQRKAEQAYADWLRELRDTAYVE 441


>gi|254491890|ref|ZP_05105069.1| SurA N-terminal domain family [Methylophaga thiooxidans DMS010]
 gi|224463368|gb|EEF79638.1| SurA N-terminal domain family [Methylophaga thiooxydans DMS010]
          Length = 421

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 114/303 (37%), Gaps = 15/303 (4%)

Query: 24  IFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE--------LEKI 75
           +   + + +        RI   +N EVI + ++ +    ++ Q    +        L K 
Sbjct: 5   LMAALLLTTNVLAQPLDRITAVVNDEVILESELMEMQQTVRQQLRQRDAAIPPSEVLNKQ 64

Query: 76  AVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFK 135
            ++ LI++ L+ Q  E+ G+    + +N    Q A N  ++   F   L+  G   ++F+
Sbjct: 65  VLERLIMQRLQLQRAEQVGVRVGDDALNAALKQIANNNNMNLRQFRDVLEDDGYNFSNFR 124

Query: 136 QYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQ 193
             +  + I   + K+    +    E E+      Q ++     EY ++ +L S+P+    
Sbjct: 125 NTIREEMIITRLRKSQVEDRVVVSEREVDNFLTTQTIQEGGEVEYQLQHILVSMPEAASP 184

Query: 194 NQGF-VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLL-K 251
            Q    +++++  +       +       ++   + +  G+  +    +L   F  ++  
Sbjct: 185 EQVQEAEQQLQKVQALLDEGGEFSEVAAGYSDGQNALEGGELGWRKHGELPSLFAEVVPD 244

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLG---GEIALKAYLSAQNTPTKIEKHEAEYVKKL 308
                 +    +  G   + + DK+       +  L +++  +       +   E +++L
Sbjct: 245 LEVGEVSQALRSGSGFHLVRVKDKKSQELHLVKQTLASHILIRANELTSAEQAEERLQQL 304

Query: 309 RSN 311
           R  
Sbjct: 305 RQR 307



 Score = 62.4 bits (150), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 61/146 (41%), Gaps = 7/146 (4%)

Query: 175 VREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--G 232
           V++ L   +L     N+L +    ++R++   + R+   ++  +L +  S     +I  G
Sbjct: 276 VKQTLASHILIRA--NELTSAEQAEERLQQLRQ-RIAKGENFAELARAHSDDTGSAIDGG 332

Query: 233 KAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSA 290
              +     + P+F+  +        ++ + ++ G   I + D+R+    +   +     
Sbjct: 333 SLGWTSPGVMVPEFEEKMNALAIGEMSDVFESRFGWHLIKVYDRREQNMADEFKRNKARE 392

Query: 291 QNTPTKIEKHEAEYVKKLRSNAIIHY 316
           Q    KI++    +++ +R  A + Y
Sbjct: 393 QIRQRKIDEELESWLRAMRDEAYVEY 418


>gi|238758995|ref|ZP_04620166.1| Chaperone surA [Yersinia aldovae ATCC 35236]
 gi|238702806|gb|EEP95352.1| Chaperone surA [Yersinia aldovae ATCC 35236]
          Length = 434

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/283 (15%), Positives = 104/283 (36%), Gaps = 16/283 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDIS---KRIALLKLQKIN 69
           +K   T  + ++ C     ++ +     ++   ++  V+   D+    + + L   Q   
Sbjct: 1   MKNWRTLILGLVVCANT--AFAAPQEVDKVAAVVDNGVVLQSDVDGLLQSVKLNAQQSGQ 58

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L    ++ LI++ ++ Q  +K GIT     ++      A    ++A    S L
Sbjct: 59  QVPDDATLRHQILERLIMDNIQLQMAKKMGITISDEALDKAIADIAAQNRMTAAQMRSRL 118

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP-ANKQKMKNITVR-EYLIRT 182
              G+  + +++ +  + +  +V  N+   +   L  E+    KQ     +   E  +  
Sbjct: 119 AADGLNYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQVGNQTSGDAELNLSH 178

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDV-SIGKAQYLLESD 241
           +L  +P+N  Q Q    + +     + ++   D  KL    S        G+  +    +
Sbjct: 179 ILIPLPENPSQQQVDQAEDLAKRLVTEIKGGADFGKLAIANSADSQALKGGQMGWGKLQE 238

Query: 242 LHPQFQNLLKKS-QNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           L   F   L+ + + +   P  +  G   + + D R  G +  
Sbjct: 239 LPSLFAERLQSANKGDVVGPIRSGVGFHILKVNDIR--GADKT 279



 Score = 66.6 bits (161), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 67/242 (27%), Gaps = 31/242 (12%)

Query: 96  TFDSNTVNYFFVQHARNTGLSA---EDFSSFLDKQGIGDNHFKQYLAIQSIWPDV----- 147
                 V+      A+          DF              K     Q  W  +     
Sbjct: 186 NPSQQQVDQA-EDLAKRLVTEIKGGADFGKLAIANSADSQALKG---GQMGWGKLQELPS 241

Query: 148 -------------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQN 194
                        V        G   +++   +   K ++V E   R +L     + +  
Sbjct: 242 LFAERLQSANKGDVVGPIRSGVGFHILKVNDIRGADKTVSVTEVHARHILLK--PSPVMT 299

Query: 195 QGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS--IGKAQYLLESDLHPQFQN-LLK 251
               + ++  A             + K  S+    +   G   +       P F++ ++K
Sbjct: 300 DDQARAKLTAAAADIKSGKSSFATIAKEISQDPGSAMQGGDLGWASPDIYDPAFRDAVMK 359

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVKKLRS 310
            S+   + P  +  G   I + D R +   + A K          K  +    ++++ R+
Sbjct: 360 LSKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKDKAYRMLFSRKFAEEAQTWMQEQRA 419

Query: 311 NA 312
            A
Sbjct: 420 AA 421


>gi|92113046|ref|YP_572974.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Chromohalobacter
           salexigens DSM 3043]
 gi|122070642|sp|Q1QZ33|SURA_CHRSD RecName: Full=Chaperone surA; AltName: Full=Peptidyl-prolyl
           cis-trans isomerase surA; Short=PPIase surA; AltName:
           Full=Rotamase surA; Flags: Precursor
 gi|91796136|gb|ABE58275.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Chromohalobacter
           salexigens DSM 3043]
          Length = 435

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 103/270 (38%), Gaps = 10/270 (3%)

Query: 22  LIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--------GELE 73
           +++  + P ++        RI   +N + I    +  R+  ++ Q  +         +L 
Sbjct: 12  MLLVAMAPSMASAQPQPLDRIVAVVNKDAIMQSRLEDRVTQVRRQMASRNVPAPNEADLR 71

Query: 74  KIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNH 133
           +  +  +I+E ++ Q  E++ ++ D   +N      A + G+S ++F+  L++ G+    
Sbjct: 72  RQVLDRMILEQIQLQMAERANLSIDDTQLNATVRGIAEDNGMSMDEFADALEEDGMSLAS 131

Query: 134 FKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQ 193
            ++ +  + +   V ++    +    + E+     +        Y +  +L S+P++   
Sbjct: 132 MREQVRREMLLRQVQQSQVASRVNVTDREVERYLDQQGETADTAYHLAHILVSVPESPTP 191

Query: 194 NQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQNLL-K 251
            Q    +        +L+   +  +     +     +S G   +     L   F +++  
Sbjct: 192 EQVEQAQAKVRDLYRQLQNGANFAQLATAESDGQQALSGGDLGWRRGDQLPSLFADVVPT 251

Query: 252 KSQNNTTNPYVTQKGVEYIAICDKRDLGGE 281
            S    + P  +  G   + + D R   GE
Sbjct: 252 LSNGEVSEPIRSPSGFHLVKLIDTRGQQGE 281



 Score = 63.5 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 56/155 (36%), Gaps = 7/155 (4%)

Query: 165 ANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS 224
             +Q  +   V E  +R +L  I  N  +N    +   +D  + R+   +    L +  S
Sbjct: 276 RGQQGEQKRVVTENRVRHIL--IGTNPNRNDQQAEALARDIRQ-RIANGESFAALAQEYS 332

Query: 225 KIHDVS--IGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGGE 281
                +   G+  +     + P F++ +K       + P  ++ G   I + D+R     
Sbjct: 333 DDDGSALDGGELGWTRPGQMVPAFEDAVKALDVGELSQPVRSRFGYHVIELEDRRRQDVT 392

Query: 282 IALKAY-LSAQNTPTKIEKHEAEYVKKLRSNAIIH 315
              +   +       K+      + +++RS A I 
Sbjct: 393 RDAQREQIRQTLFQRKVSDEMEAWTQEIRSGAYID 427


>gi|148553334|ref|YP_001260916.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas
           wittichii RW1]
 gi|148498524|gb|ABQ66778.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas
           wittichii RW1]
          Length = 446

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/259 (18%), Positives = 95/259 (36%), Gaps = 14/259 (5%)

Query: 44  TTINGEVITDGDISKRIALLKLQKIN-------GELEKIAVQELIVETLKKQEIEKSGIT 96
             +NG +IT  D+ +R+AL+               L    ++ LI ETL+ QE     + 
Sbjct: 58  AIVNGTIITQTDVEQRLALVIAANGGNIPDEERERLRLQVLRNLIDETLQIQEATAQKVE 117

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
                V   + + A N   S ++F+ FL ++G      K+ +  ++ W  V+        
Sbjct: 118 VSREEVQQTYDRVAANFRKSPKEFAEFLHEKGSSQASIKRQIEGEAAWRRVLSRKVEPFV 177

Query: 157 GNLEMEIPANKQKMKNI-TVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKD 215
              + E+ A   ++K      EY +  +  S     +       +RI D    ++R    
Sbjct: 178 AVSDEEVNAIIARLKASKGANEYHVGEIFLSATPETMNEANANAERIID----QVRRGAS 233

Query: 216 CNKLEKFASKIHDVSI-GKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAIC 273
                +  S+    ++ G   ++    L  Q   ++ +      + P     G   + + 
Sbjct: 234 FAAYARQFSEASTAAVGGDLGWVRAEQLPDQLSAVVNQLQPGQISQPIAIPGGYSILLLS 293

Query: 274 DKRDLGGEIALKAYLSAQN 292
           DKR + G     A L  + 
Sbjct: 294 DKRQVLGADPRDAQLLLKQ 312



 Score = 55.0 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 59/156 (37%), Gaps = 7/156 (4%)

Query: 164 PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFA 223
              +    +    + L++ +  + P    Q Q   +    +A    L   K C    + A
Sbjct: 294 DKRQVLGADPRDAQLLLKQLTVNFPPGITQAQATPK---VEAFAKALEQIKGCGNANEVA 350

Query: 224 SKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPY-VTQKGVEYIAICDKRD-LGG 280
           + I    +     +   DL PQ Q ++   Q   +T P+   + G+  + +C + D    
Sbjct: 351 ANI-GAEVVNNDQMKIRDLPPQLQEVMLNLQIGQSTPPFGSMRDGIRALILCGRDDPAPS 409

Query: 281 EIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                  + +Q    ++ +    Y++ LR +A+I Y
Sbjct: 410 SGPSFEQIQSQIEQERVNRRAQRYLRDLRRDAVIEY 445


>gi|94497694|ref|ZP_01304262.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas sp.
           SKA58]
 gi|94422911|gb|EAT07944.1| PpiC-type peptidyl-prolyl cis-trans isomerase [Sphingomonas sp.
           SKA58]
          Length = 462

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 95/259 (36%), Gaps = 14/259 (5%)

Query: 44  TTINGEVITDGDISKRIALLKLQK-------INGELEKIAVQELIVETLKKQEIEKSGIT 96
             +NG +IT  D+ +R+AL+               L    ++ LI ETL+ QE   + I 
Sbjct: 74  AIVNGRIITGTDVDQRLALIITANGGKVSDEEKERLRVQVLRNLIDETLQIQEAAANDIK 133

Query: 97  FDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKY 156
                +   + + A N   S  +F ++L  QG      K+ +  +  W  +++ +     
Sbjct: 134 IAPEEIEQSYQRVAANFRKSPTEFDAYLRSQGSSAASIKRQIEGELAWSRLLRRNIQPFV 193

Query: 157 GNLEMEIPANKQKMKNITVR-EYLIRTVLF-SIPDNKLQNQGFVQKRIKDAEESRLRLPK 214
              E E+ +   ++       EY I  +   + P+N+ Q     +  I+  ++       
Sbjct: 194 NVSEDEVKSVIDRLNAAKGSDEYRIGEIYLSATPENQAQIVANARNIIQQIQQG----GS 249

Query: 215 DCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPYVTQKGVEYIAIC 273
                 +F+        G   ++  + L  +      + Q      P  T  GV  I + 
Sbjct: 250 FQAYARQFSEASTAAVGGDLGWIRPAQLPSELAQAAAEMQVGQIAGPIETVGGVSIIYVM 309

Query: 274 DKRDLGGEIALKAYLSAQN 292
           DKR +       A LS + 
Sbjct: 310 DKRKVLTADPRDALLSLKQ 328



 Score = 51.2 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 4/106 (3%)

Query: 214 KDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NNTTNPY-VTQKGVEYIA 271
           K C +  +  ++I    +     +   DL PQ Q +L   Q   TT P+   + GV  + 
Sbjct: 357 KGCGQANEIGARI-GADVVDNDNVKVRDLPPQLQEILLNLQVGETTPPFGSIEDGVRVLI 415

Query: 272 ICDKRD-LGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
           +C + D           + AQ    ++ K    Y++ LR +A+I Y
Sbjct: 416 VCGRDDPASANAPNADQIMAQLEEERVNKRARIYLRDLRRDAVIDY 461


>gi|91781822|ref|YP_557028.1| putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           xenovorans LB400]
 gi|91685776|gb|ABE28976.1| Putative peptidyl-prolyl cis-trans isomerase [Burkholderia
           xenovorans LB400]
          Length = 453

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 102/276 (36%), Gaps = 14/276 (5%)

Query: 19  YFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGE------- 71
            F+ +       +S         I   +N  VIT  ++ +R+ L+  +            
Sbjct: 21  SFLSVAPVQAQALSGSGGQTVDTIAAVVNNGVITRRELDERMGLITRRLNQQNAPVPPMD 80

Query: 72  -LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
            L +  + ++++E ++ Q+ ++ GIT D  TV     + A    L+ + + S ++ QG+ 
Sbjct: 81  QLRQQVLNQMVLERIQLQKAKEDGITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVP 140

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
              F      +     + + +   K    + E+    A+++        +  ++ +    
Sbjct: 141 WTTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKA 200

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVS-IGKAQYLLESDLHPQF 246
           P N  +      +R   A  +  +   +  KL K  S+  D S  G   ++  S L P+F
Sbjct: 201 PLNASETDIEAAQRKAQALLAEAKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEF 260

Query: 247 -QNLLKKSQNNTTN-PYVTQKGVEYIAICDKRDLGG 280
            +                T  G E + + D+R   G
Sbjct: 261 VKAASALRPGEVNPDLIRTSDGFEIVRLVDRRAGQG 296



 Score = 69.7 bits (169), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 67/180 (37%), Gaps = 4/180 (2%)

Query: 138 LAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGF 197
           L    + PD+++     +   L               + +  +R +L  +      ++  
Sbjct: 267 LRPGEVNPDLIRTSDGFEIVRLVDRRAGQGTSSDAPKLVQTHVRHILLRV--GDGMSEPQ 324

Query: 198 VQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQ-NN 256
            ++++ + +               ++        G   ++   +  P+F+  +   Q   
Sbjct: 325 ARQKLLEIKNEIAAGGDFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFERAMNSLQDGQ 384

Query: 257 TTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPT-KIEKHEAEYVKKLRSNAIIH 315
            ++P  ++ G   I +  +R+  G +A +  L+ Q     K E+  A+++++LR  A + 
Sbjct: 385 ISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQAIGQRKAEQAYADWLRELRDTAYVE 444


>gi|300114054|ref|YP_003760629.1| peptidylprolyl isomerase [Nitrosococcus watsonii C-113]
 gi|299539991|gb|ADJ28308.1| Peptidylprolyl isomerase [Nitrosococcus watsonii C-113]
          Length = 426

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/277 (17%), Positives = 112/277 (40%), Gaps = 13/277 (4%)

Query: 16  LTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ-KINGE--- 71
           +    V I+     + S+ + ++  RI   +N +++ + ++ + +  ++ Q    G    
Sbjct: 1   MGKVLVAIVVLFWTMGSFATMSL-DRIVAVVNEDIVLESELEQMVRTVQDQLAAQGTSLP 59

Query: 72  ----LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQ 127
               LE+  ++ L++E L+ Q   ++GI     T+N    + A+N GL+   F + L++ 
Sbjct: 60  PGYVLERQVLERLVMEQLQLQLAARTGIQVGDETLNEALGRIAQNNGLTLSQFRNVLEQD 119

Query: 128 GIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVR--EYLIRTVLF 185
           G    +F++ +  + I   + K +   +    + EI       K    +  +Y +  +L 
Sbjct: 120 GYDFPNFRENIRKELIISQLHKREVNDRVSVSKAEIDNFLATQKKHGNQDAQYHLAHILI 179

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHP 244
           ++P+     Q    K   +    +LR   D  K    ++     +  G   +     L  
Sbjct: 180 TVPEAASPEQVQGAKAKAEQVLQQLREGTDFQKVAVTYSDGQQALEGGDLGWRKVGQLPT 239

Query: 245 QFQNLLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLGG 280
            F +++ + Q    +    +  G   + + + R  GG
Sbjct: 240 LFVDVVPQLQVGEISKLIRSPSGFHIVKLLEYRGEGG 276



 Score = 67.8 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 62/154 (40%), Gaps = 7/154 (4%)

Query: 167 KQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFAS-- 224
           + +     V +   R +L     ++L ++  VQ R+    + R+    D ++L +  S  
Sbjct: 272 RGEGGQQLVTQTQARHILLRA--DELASEQEVQLRLSQLRQ-RILSGDDFSELAQAHSDD 328

Query: 225 KIHDVSIGKAQYLLESDLHPQFQNLLKK-SQNNTTNPYVTQKGVEYIAICDKRDLGGEIA 283
           K   +  G   ++    + P+F+  ++       + P+ TQ G   + + D+R       
Sbjct: 329 KASALKGGDLGWVSPGQMIPRFEEAMRSLEPGEISEPFKTQFGWHVVQVLDRRQENVTEE 388

Query: 284 LKAYL-SAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
                   +    K+E+    ++++LR  A + Y
Sbjct: 389 FNRNRAKTEIHQRKVEEELENWLRQLRDEAYVEY 422


>gi|229512625|ref|ZP_04402094.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae TMA 21]
 gi|229350302|gb|EEO15253.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio cholerae TMA 21]
          Length = 431

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLTQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + D + ++       + +   + LR   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVDDGQDKSAAET---LANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 70.8 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +  + +++
Sbjct: 354 QIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|300705125|ref|YP_003746728.1| peptidyl-prolyl cis-trans isomerase (ppiase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum CFBP2957]
 gi|299072789|emb|CBJ44144.1| peptidyl-prolyl cis-trans isomerase (PPIase), involved in
           maturation of outer membrane proteins [Ralstonia
           solanacearum CFBP2957]
          Length = 474

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/313 (17%), Positives = 109/313 (34%), Gaps = 24/313 (7%)

Query: 23  IIFCIVPIVSYKSWAMSS----RIRTTINGEVITDGDISKRIAL----LKLQKINGELEK 74
           ++   +P  S  S A  S     +   +N ++IT  ++  R  L    L+ Q        
Sbjct: 46  LLRGTLPGPSTASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERTLQAQNRPMPARA 105

Query: 75  ----IAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIG 130
                 +++LI+E ++ Q  ++SGI      V+      A+   LS     S L + G+ 
Sbjct: 106 DLLGEVLEQLILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVPQLKSKLVQSGLA 165

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP---ANKQKMKNITVREYLIRTVLFSI 187
            + +++ L  + +   +   +   K    + EI    A +        +EY +  +L  +
Sbjct: 166 YDKYREDLRQEILLARLRDREVDSKVQVFDGEIDNFLAQQGGGATGEAQEYNVAQILVPV 225

Query: 188 PDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEK-FASKIHDVSIGKAQYLLESDLHPQF 246
            ++    Q    +   +    + +   D  KL +  +S       G+        L  QF
Sbjct: 226 AEDASAEQKAAARGKAENLLKQAQGGADFAKLVRDNSSGPEAAQGGELGLRSIGRLPTQF 285

Query: 247 QN-LLKKSQNNTT-NPYVTQKGVEYIAICDKRDLGGEIALK------AYLSAQNTPTKIE 298
            N ++             +  G   + + DKR  G   + K       ++  +  PT   
Sbjct: 286 ANAVVDLKPGQLAGQVIESPAGFHVLKLVDKRAPGTAASAKVAQTQVRHILIKTGPTMSA 345

Query: 299 KHEAEYVKKLRSN 311
                 +  LR  
Sbjct: 346 DDARRQLAGLRDR 358



 Score = 75.5 bits (184), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 58/151 (38%), Gaps = 4/151 (2%)

Query: 168 QKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIH 227
               +  V +  +R +L         +    ++++    +  +      +   +++    
Sbjct: 320 GTAASAKVAQTQVRHILIKTGPTMSADDA--RRQLAGLRDRIVHGYDFSDAARRYSQDTS 377

Query: 228 DVSIGKAQYLLESDLHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKA 286
             + G+  ++    L P+F+  +        + P  +Q GV  I +  +RD    +  + 
Sbjct: 378 ASAGGELGWVSPGQLVPEFEQAMNLLKPGEVSQPVQSQFGVHLIQVEGRRDAEVPVDRQR 437

Query: 287 -YLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            Y  +     K++    +++++LR +A + Y
Sbjct: 438 DYARSVIREQKVQAAYEDWLRQLRDSAHVEY 468


>gi|190571205|ref|YP_001975563.1| hypothetical protein WPa_0803 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357477|emb|CAQ54911.1| hypothetical protein WP0803 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 375

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 91/203 (44%), Gaps = 11/203 (5%)

Query: 37  AMSSRIRTTINGEVITDGDISKRIAL----LKLQKING-ELEKIAVQELIVETLKKQEIE 91
           A    I   +NGE I++ DI +RI      L  QKIN  E++   +++LI E +   E +
Sbjct: 18  ATEIEIVADVNGEPISNLDIERRINFINSLLGTQKINQKEVKSQILRQLIDEIIIVSEAQ 77

Query: 92  KSGITFDSNTVNYFFVQHARNT-GLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKN 150
           K  I   +  +N         +  L A++   ++ K  I  N  K+ +  Q +W  +++ 
Sbjct: 78  KMNIELSNEELNNAVTLFLTQSLKLKADEVDQYVKKHNIDLNTLKKQIKCQLLWNKIIEV 137

Query: 151 DFMLKYGNLEMEI-PANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESR 209
             +      + E+  A KQK K+    +YLI    F IPD K+      + R  +  ES 
Sbjct: 138 GVVPLINISDQEVDDARKQKEKS----DYLITFQEFIIPDQKIAEDLVKKLRTSNNPESS 193

Query: 210 LRLPKDCNKLEKFASKIHDVSIG 232
           +++ K    L +   K+ DV  G
Sbjct: 194 IKMSKATVNLSQLKGKLKDVLEG 216


>gi|149377958|ref|ZP_01895684.1| Parvulin-like peptidyl-prolyl isomerase [Marinobacter algicola
           DG893]
 gi|149357732|gb|EDM46228.1| Parvulin-like peptidyl-prolyl isomerase [Marinobacter algicola
           DG893]
          Length = 429

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/309 (14%), Positives = 115/309 (37%), Gaps = 21/309 (6%)

Query: 20  FVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLK-LQKINGE------- 71
            + ++  +V         +  ++   +N +VI   ++  RI  +    +  G        
Sbjct: 1   MLALMVVMVSATVQADRKLLDQVVAVVNDDVILQSELEARINTITGRLRAQGTGLPPRDI 60

Query: 72  LEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGD 131
           LE+  +++LI E+++ Q  +++G+    N +N      A+   ++   F   L ++G+  
Sbjct: 61  LEERVLEQLISESIQLQMADRAGMRISDNELNETLASIAQRNNMTLAQFEQQLVQEGVTY 120

Query: 132 NHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPD 189
              ++ +  + I   V +     +    + E+         +  +  EY +  +L  +  
Sbjct: 121 REAREQIRNEMITSRVQQRQVGNRVRVTDREVENYLAAMAGQGRSNAEYELAHILIEV-- 178

Query: 190 NKLQNQGFVQKRIKDAEESRLRLPKDCN---KLEKFASKIHDVSIGKAQYLLESDLHPQF 246
           N   ++  V    +  E+ R  + +  +        +   + +  G   +  E+ L    
Sbjct: 179 NDFNDEEEVSAAREKVEQLREEIAEGRDFRSVAVAESDASNALDGGNMGWRAENQLPSLV 238

Query: 247 QNLL-KKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV 305
            +++        +       G   + + D+R  GG+   KA    Q+    I    +E V
Sbjct: 239 ADVVPDLETGTVSPVLRNSSGFHLVMVMDRR--GGD---KAQFIEQSKVRHILVRTSETV 293

Query: 306 KKLRSNAII 314
            + ++ A I
Sbjct: 294 SEAQAEATI 302



 Score = 67.4 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 35/303 (11%), Positives = 91/303 (30%), Gaps = 62/303 (20%)

Query: 71  ELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAE--------DFSS 122
           E  +    E+I   ++++++    +      V  +    A     +AE        + + 
Sbjct: 122 EAREQIRNEMITSRVQQRQVGNR-VRVTDREVENYLAAMAGQGRSNAEYELAHILIEVND 180

Query: 123 FLDKQGIG-----DNHFKQYLAIQ---------------------SIWPDV--------- 147
           F D++ +          ++ +A                         W            
Sbjct: 181 FNDEEEVSAAREKVEQLREEIAEGRDFRSVAVAESDASNALDGGNMGWRAENQLPSLVAD 240

Query: 148 ---------VKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFV 198
                    V        G   + +   +   K   + +  +R +L    +   + Q   
Sbjct: 241 VVPDLETGTVSPVLRNSSGFHLVMVMDRRGGDKAQFIEQSKVRHILVRTSETVSEAQAEA 300

Query: 199 QKRIKDAEESRLRLPKDCNKLEKFASK--IHDVSIGKAQYLLESDLHPQF-QNLLKKSQN 255
             R       ++    D   + +  S   +     G   ++    + P+F Q +++    
Sbjct: 301 TIR---DLYQQIDNGADFAVIAREHSDDPVSGSDGGNLGWVSPGQMVPEFEQAMMEADVG 357

Query: 256 NTTNPYVTQKGVEYIAICDKR--DLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAI 313
               P+ +Q G   + + D+R  D+ G+   ++         K +     +++++R  A 
Sbjct: 358 ELKGPFRSQFGWHILQVQDRRQQDISGD-VRESEARQAIYRRKFDTELQNWLREIRDEAF 416

Query: 314 IHY 316
           I +
Sbjct: 417 IEF 419


>gi|262403929|ref|ZP_06080486.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC586]
 gi|262349891|gb|EEY99027.1| peptidyl-prolyl cis-trans isomerase SurA [Vibrio sp. RC586]
          Length = 431

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQIRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + D + ++       + +   + L+   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVDDGQDKSAAET---LANKLVNDLKNGADFAQMAYAYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 70.8 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +  + +++
Sbjct: 354 QIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|153827415|ref|ZP_01980082.1| survival protein SurA [Vibrio cholerae MZO-2]
 gi|149738658|gb|EDM53001.1| survival protein SurA [Vibrio cholerae MZO-2]
          Length = 431

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + D + +N       + +   + L+   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVDDGQDKNAAET---LANKLVNDLKNGADFAQMAYAYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 70.8 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 73/189 (38%), Gaps = 9/189 (4%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y       P+F++
Sbjct: 294 IILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKH 353

Query: 249 LLKKSQ-NNTTNPYVTQKGVEYIAICDKRDLG-GEIALKAYLSAQNTPTKIEKHEAEYVK 306
            ++       + P+ T  G   + + D+R++   + ALK          K  +  + +++
Sbjct: 354 QIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQ 413

Query: 307 KLRSNAIIH 315
           +LR++A + 
Sbjct: 414 ELRASAFVE 422


>gi|153820172|ref|ZP_01972839.1| survival protein SurA [Vibrio cholerae NCTC 8457]
 gi|126509282|gb|EAZ71876.1| survival protein SurA [Vibrio cholerae NCTC 8457]
          Length = 393

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/276 (14%), Positives = 108/276 (39%), Gaps = 15/276 (5%)

Query: 13  IKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKIN--- 69
           +KL     + ++  +    ++        +   +N  VI   D+   +  +K        
Sbjct: 1   MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ 60

Query: 70  -----GELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFL 124
                  L +  +++LI++TL++QE ++ G+  D N +N    + A+N   + E   + +
Sbjct: 61  PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV 120

Query: 125 DKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIP--ANKQKMKNITVREYLIRT 182
            ++G+    F++ +  +    D        +   L  E+   A     +     +Y I  
Sbjct: 121 AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH 180

Query: 183 VLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLE-KFASKIHDVSIGKAQYLLESD 241
           +   + D + ++       + +   + LR   D  ++   ++     +  G   ++ + +
Sbjct: 181 IQLRVDDGQDKSTAET---LANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEE 237

Query: 242 LHPQFQNLLK-KSQNNTTNPYVTQKGVEYIAICDKR 276
           +   F + +K +++ +   P+ +  G   + I D +
Sbjct: 238 MPTIFADQIKMQNKGSIIGPFRSGVGFHILKIDDVK 273



 Score = 55.0 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 60/160 (37%), Gaps = 9/160 (5%)

Query: 131 DNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDN 190
              F   + +Q      +   F    G   ++I   K  ++ + V E   R +L  I   
Sbjct: 239 PTIFADQIKMQ--NKGSIIGPFRSGVGFHILKIDDVK-GLETVAVTEVNARHIL--IKPT 293

Query: 191 KLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSI--GKAQYLLESDLHPQFQN 248
            + +    QK++ +  +          +L +  S+    +   G+  Y