PSIBLAST alignment of GI: 254780396 and protein with PDB id: 1eq3

>gi|13786637|pdb|1EQ3|A Chain A, Nmr Structure Of Human Parvulin Hpar14 Length = 96
 Score = 54.3 bits (128), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 24/83 (28%), Gaps = 8/83 (9%)

Query: 201 RIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQN-------LLKKS 253
           +I +A E      +      +++        G   ++    +   FQ             
Sbjct: 15  KIMEAMEKLKSGMRFNEVAAQYSED-KARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDK 73

Query: 254 QNNTTNPYVTQKGVEYIAICDKR 276
              T  P  T+ G   I +  ++
Sbjct: 74  PVFTDPPVKTKFGYHIIMVEGRK 96