PSIBLAST alignment of GI: 254780396 and protein with PDB id: 1j6y

>gi|22218833|pdb|1J6Y|A Chain A, Solution Structure Of Pin1at From Arabidopsis Thaliana Length = 139
 Score = 53.9 bits (127), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 8/77 (10%), Positives = 18/77 (23%), Gaps = 1/77 (1%)

Query: 196 GFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKK-SQ 254
             V++     E+             + +        G         +   F+        
Sbjct: 60  AAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKV 119

Query: 255 NNTTNPYVTQKGVEYIA 271
            + ++   T  GV  I 
Sbjct: 120 GDISDIVDTDSGVHIIK 136