PSIBLAST alignment of GI: 254780396 and protein with PDB id: 1zk6

>gi|93278583|pdb|1ZK6|A Chain A, Nmr Solution Structure Of B. Subtilis Prsa Ppiase Length = 93
 Score = 63.5 bits (152), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 29/80 (36%), Gaps = 2/80 (2%)

Query: 197 FVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYL-LESDLHPQF-QNLLKKSQ 254
             +K  ++ E+   +  K  +  +++++       G   +   E  +   F +   K   
Sbjct: 13  ADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKT 72

Query: 255 NNTTNPYVTQKGVEYIAICD 274
              ++P  TQ G   I   +
Sbjct: 73  GEVSDPVKTQYGYHIIKKTE 92